Psyllid ID: psy9529

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
GDGNLSDDLASKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKWRKKEHTKKGPGRPAHNAHPVTCSGDPIPAEELKRKERARRQKKLMKSLERQQRKLAAKGVTVDLETLKREWESQQASELLD
cccccccccHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcc
cccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccc
gdgnlsddlaskrrrsrtnfnsWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKWrkkehtkkgpgrpahnahpvtcsgdpipaeELKRKERARRQKKLMKSLERQQRKLAAKGVTVDLETLKREWESQQASELLD
gdgnlsddlaskrrrsrtnfnswqlEELERAFLASHYPDVFMREALALRldlkesrvavwfqnrrakwrkkehtkkgpgrpahnahpvtcsgdpipaeelKRKERARRQKKLMKSLerqqrklaakgvtvdletlkrewesqqaselld
GDGNLSDDLASKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKWRKKEHTKKGPGRPAHNAHPVTCSGDPIPaeelkrkerarrqkklMKSLERQQRKLAAKGVTVDLETLKREWESQQASELLD
********************NSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKW*********************************************************************************
******************NFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWF****************************************************************************************
*****************TNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRA*****************NAHPVTCSGDPIPAEELKRKERARRQKKLMKSLERQQRKLAAKGVTVDLETLKRE***********
*****************TNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKWRKKEHT***************CSGDPIPAEELKRKERARRQKKLMKSLERQQRKLAAKGVTVDLETLKREWESQQA*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GDGNLSDDLASKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKWRKKEHTKKGPGRPAHNAHPVTCSGDPIPAEELKRKERxxxxxxxxxxxxxxxxxxxxxGVTVDLETLKREWESQQASELLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query149 2.2.26 [Sep-21-2011]
O77215 428 Homeobox protein unc-4 OS yes N/A 0.899 0.313 0.813 5e-60
Q50D79 470 Homeobox protein unc-4 ho yes N/A 0.718 0.227 0.724 4e-41
O08934 530 Homeobox protein unc-4 ho yes N/A 0.624 0.175 0.795 1e-40
A6NJT0 531 Homeobox protein unc-4 ho yes N/A 0.624 0.175 0.795 3e-40
P97830 530 Homeobox protein unc-4 ho yes N/A 0.624 0.175 0.784 3e-40
P29506252 Homeobox protein unc-4 OS yes N/A 0.510 0.301 0.736 6e-27
O42115 453 Aristaless-related homeob no N/A 0.510 0.167 0.604 5e-22
Q96QS3562 Homeobox protein ARX OS=H no N/A 0.409 0.108 0.754 7e-22
A6YP92566 Homeobox protein ARX OS=R no N/A 0.409 0.107 0.754 8e-22
O35085564 Homeobox protein ARX OS=M no N/A 0.409 0.108 0.754 1e-21
>sp|O77215|UNC4_DROME Homeobox protein unc-4 OS=Drosophila melanogaster GN=unc-4 PE=2 SV=1 Back     alignment and function desciption
 Score =  229 bits (584), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 120/134 (89%)

Query: 10  ASKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKWR 69
           A+KRRRSRTNFNSWQLEELERAF ASHYPD+FMREALA+RLDLKESRVAVWFQNRRAK R
Sbjct: 80  AAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVWFQNRRAKVR 139

Query: 70  KKEHTKKGPGRPAHNAHPVTCSGDPIPAEELKRKERARRQKKLMKSLERQQRKLAAKGVT 129
           K+EHTKKGPGRPAHNA P TCSG+PIP  ELK KERARR+KKL K+++RQ RKL AKG+T
Sbjct: 140 KREHTKKGPGRPAHNAQPQTCSGEPIPPNELKAKERARRRKKLAKAIDRQARKLQAKGIT 199

Query: 130 VDLETLKREWESQQ 143
           VDLE LK E+ SQ 
Sbjct: 200 VDLEALKAEYISQH 213
Transcription factor that regulates synaptic specificity.
Drosophila melanogaster (taxid: 7227)
>sp|Q50D79|UNC4_DANRE Homeobox protein unc-4 homolog OS=Danio rerio GN=uncx PE=2 SV=2 Back     alignment and function description
>sp|O08934|UNC4_MOUSE Homeobox protein unc-4 homolog OS=Mus musculus GN=Uncx PE=2 SV=2 Back     alignment and function description
>sp|A6NJT0|UNC4_HUMAN Homeobox protein unc-4 homolog OS=Homo sapiens GN=UNCX PE=2 SV=1 Back     alignment and function description
>sp|P97830|UNC4_RAT Homeobox protein unc-4 homolog OS=Rattus norvegicus GN=Uncx PE=2 SV=1 Back     alignment and function description
>sp|P29506|UNC4_CAEEL Homeobox protein unc-4 OS=Caenorhabditis elegans GN=unc-4 PE=1 SV=2 Back     alignment and function description
>sp|O42115|ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio GN=arx PE=2 SV=1 Back     alignment and function description
>sp|Q96QS3|ARX_HUMAN Homeobox protein ARX OS=Homo sapiens GN=ARX PE=1 SV=1 Back     alignment and function description
>sp|A6YP92|ARX_RAT Homeobox protein ARX OS=Rattus norvegicus GN=Arx PE=2 SV=1 Back     alignment and function description
>sp|O35085|ARX_MOUSE Homeobox protein ARX OS=Mus musculus GN=Arx PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
328711031 578 PREDICTED: hypothetical protein LOC10015 0.939 0.242 0.907 6e-63
195447188 637 GK25621 [Drosophila willistoni] gi|19416 0.899 0.210 0.813 2e-58
18860107 428 unc-4 [Drosophila melanogaster] gi|54036 0.899 0.313 0.813 3e-58
198470007 615 GA19478 [Drosophila pseudoobscura pseudo 0.899 0.217 0.813 3e-58
195396745 606 GJ16592 [Drosophila virilis] gi|19414675 0.899 0.221 0.813 4e-58
195163882 613 GL14568 [Drosophila persimilis] gi|19410 0.899 0.218 0.813 4e-58
195048270 625 GH24785 [Drosophila grimshawi] gi|193893 0.899 0.214 0.813 4e-58
194767836 610 GF19454 [Drosophila ananassae] gi|190622 0.899 0.219 0.813 5e-58
195351788 588 GM13524 [Drosophila sechellia] gi|194124 0.899 0.227 0.813 5e-58
195132011 604 GI14686 [Drosophila mojavensis] gi|19390 0.899 0.221 0.813 5e-58
>gi|328711031|ref|XP_001947663.2| PREDICTED: hypothetical protein LOC100159095 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 127/140 (90%), Positives = 138/140 (98%)

Query: 6   SDDLASKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRR 65
           S+DLA+KRRRSRTNFN+WQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRR
Sbjct: 222 SEDLANKRRRSRTNFNTWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRR 281

Query: 66  AKWRKKEHTKKGPGRPAHNAHPVTCSGDPIPAEELKRKERARRQKKLMKSLERQQRKLAA 125
           AKWRKKEHTKKGPGRPAHNAHPVTCSG+PIPA+EL+RKER RRQKKL+KSLERQQRKLAA
Sbjct: 282 AKWRKKEHTKKGPGRPAHNAHPVTCSGEPIPADELRRKERERRQKKLLKSLERQQRKLAA 341

Query: 126 KGVTVDLETLKREWESQQAS 145
           KGV VDL+TL++EWESQQA+
Sbjct: 342 KGVHVDLDTLRKEWESQQAN 361

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195447188|ref|XP_002071103.1| GK25621 [Drosophila willistoni] gi|194167188|gb|EDW82089.1| GK25621 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|18860107|ref|NP_573242.1| unc-4 [Drosophila melanogaster] gi|54036548|sp|O77215.1|UNC4_DROME RecName: Full=Homeobox protein unc-4; AltName: Full=Paired-like homeodomain protein unc-4; Short=DPHD-1 gi|3641287|gb|AAC36333.1| paired-like homeodomain protein UNC-4 [Drosophila melanogaster] gi|7293384|gb|AAF48762.1| unc-4 [Drosophila melanogaster] gi|115646544|gb|ABJ17079.1| RT01021p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|198470007|ref|XP_001355189.2| GA19478 [Drosophila pseudoobscura pseudoobscura] gi|198147137|gb|EAL32246.2| GA19478 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195396745|ref|XP_002056989.1| GJ16592 [Drosophila virilis] gi|194146756|gb|EDW62475.1| GJ16592 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195163882|ref|XP_002022778.1| GL14568 [Drosophila persimilis] gi|194104801|gb|EDW26844.1| GL14568 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195048270|ref|XP_001992500.1| GH24785 [Drosophila grimshawi] gi|193893341|gb|EDV92207.1| GH24785 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|194767836|ref|XP_001966020.1| GF19454 [Drosophila ananassae] gi|190622905|gb|EDV38429.1| GF19454 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195351788|ref|XP_002042411.1| GM13524 [Drosophila sechellia] gi|194124254|gb|EDW46297.1| GM13524 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195132011|ref|XP_002010437.1| GI14686 [Drosophila mojavensis] gi|193908887|gb|EDW07754.1| GI14686 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
FB|FBgn0024184 428 unc-4 "unc-4" [Drosophila mela 0.946 0.329 0.711 1.5e-49
FB|FBgn0026058382 OdsH "Ods-site homeobox" [Dros 0.926 0.361 0.609 9.3e-43
UNIPROTKB|E2R5H2 538 UNCX "Uncharacterized protein" 0.563 0.156 0.845 1.3e-36
UNIPROTKB|A6NJT0 531 UNCX "Homeobox protein unc-4 h 0.563 0.158 0.845 1.3e-36
UNIPROTKB|F1RIW6 523 UNCX "Uncharacterized protein" 0.563 0.160 0.845 1.3e-36
UNIPROTKB|I3L874 518 UNCX "Uncharacterized protein" 0.563 0.162 0.845 1.3e-36
MGI|MGI:108013 530 Uncx "UNC homeobox" [Mus muscu 0.563 0.158 0.845 1.3e-36
RGD|69361 530 Uncx "UNC homeobox" [Rattus no 0.563 0.158 0.833 2.7e-36
UNIPROTKB|P97830 530 Uncx "Homeobox protein unc-4 h 0.563 0.158 0.833 2.7e-36
ZFIN|ZDB-GENE-050714-1 470 uncx4.1 "Unc4.1 homeobox (C. e 0.637 0.202 0.762 3.5e-36
FB|FBgn0024184 unc-4 "unc-4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 516 (186.7 bits), Expect = 1.5e-49, P = 1.5e-49
 Identities = 101/142 (71%), Positives = 112/142 (78%)

Query:     1 GDGNLSDDLASKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVW 60
             GDG+  D  A+KRRRSRTNFNSWQLEELERAF ASHYPD+FMREALA+RLDLKESRVAVW
Sbjct:    72 GDGD-DDSSAAKRRRSRTNFNSWQLEELERAFSASHYPDIFMREALAMRLDLKESRVAVW 130

Query:    61 FQNRRAKWRKKEHTKKGPGRPAHNAHPVTCSGDPIPXXXXXXXXXXXXXXXXMKSLERQQ 120
             FQNRRAK RK+EHTKKGPGRPAHNA P TCSG+PIP                 K+++RQ 
Sbjct:   131 FQNRRAKVRKREHTKKGPGRPAHNAQPQTCSGEPIPPNELKAKERARRRKKLAKAIDRQA 190

Query:   121 RKLAAKGVTVDLETLKREWESQ 142
             RKL AKG+TVDLE LK E+ SQ
Sbjct:   191 RKLQAKGITVDLEALKAEYISQ 212
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
FB|FBgn0026058 OdsH "Ods-site homeobox" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5H2 UNCX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A6NJT0 UNCX "Homeobox protein unc-4 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIW6 UNCX "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3L874 UNCX "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:108013 Uncx "UNC homeobox" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|69361 Uncx "UNC homeobox" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P97830 Uncx "Homeobox protein unc-4 homolog" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050714-1 uncx4.1 "Unc4.1 homeobox (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4LAL6ALX4_BOVINNo assigned EC number0.68850.40930.1536yesN/A
Q50D79UNC4_DANRENo assigned EC number0.72470.71810.2276yesN/A
O77215UNC4_DROMENo assigned EC number0.81340.89930.3130yesN/A
O08934UNC4_MOUSENo assigned EC number0.79560.62410.1754yesN/A
P29506UNC4_CAEELNo assigned EC number0.73680.51000.3015yesN/A
A6NJT0UNC4_HUMANNo assigned EC number0.79560.62410.1751yesN/A
P97830UNC4_RATNo assigned EC number0.78490.62410.1754yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
pfam0004657 pfam00046, Homeobox, Homeobox domain 1e-22
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 2e-18
smart0038957 smart00389, HOX, Homeodomain 1e-17
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 4e-09
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 84.1 bits (209), Expect = 1e-22
 Identities = 32/57 (56%), Positives = 38/57 (66%)

Query: 14 RRSRTNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKWRK 70
          RR RT F   QLEELE+ F  + YP    RE LA +L L E +V VWFQNRRAKW++
Sbjct: 1  RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWKR 57

Length = 57
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 149
KOG0484|consensus125 99.84
KOG0489|consensus261 99.81
KOG0850|consensus245 99.8
KOG0488|consensus309 99.79
KOG2251|consensus228 99.78
KOG0494|consensus332 99.77
KOG0843|consensus197 99.77
KOG0842|consensus307 99.74
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.74
KOG0487|consensus308 99.72
KOG0485|consensus268 99.7
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.67
KOG0848|consensus317 99.67
KOG0492|consensus246 99.65
KOG3802|consensus398 99.64
KOG0486|consensus 351 99.63
KOG0493|consensus342 99.62
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.61
COG5576156 Homeodomain-containing transcription factor [Trans 99.6
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.6
KOG0491|consensus194 99.54
KOG0483|consensus198 99.52
KOG0847|consensus288 99.52
KOG0844|consensus408 99.51
KOG4577|consensus383 99.48
KOG0490|consensus235 99.45
KOG0849|consensus354 99.33
KOG1168|consensus385 99.23
KOG0775|consensus304 98.98
KOG0774|consensus334 98.72
KOG2252|consensus558 98.67
KOG0490|consensus235 98.5
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.49
KOG1146|consensus 1406 97.93
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.81
KOG3623|consensus 1007 96.36
KOG0773|consensus342 96.17
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 95.4
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 82.41
KOG1146|consensus 1406 81.55
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 81.08
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 80.12
>KOG0484|consensus Back     alignment and domain information 
Probab=99.84  E-value=1.3e-21  Score=134.89  Aligned_cols=69  Identities=57%  Similarity=0.928  Sum_probs=63.7

Q ss_pred             CCCcCCCCCCCCCCCCHHHHHHHHHHHhhCCCCCHHHHHHHHHhcCCCccchhhhhhhhhhhHHHhhhh
Q psy9529           6 SDDLASKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKWRKKEHT   74 (149)
Q Consensus         6 ~~~~~~k~rr~Rt~ft~~ql~~Le~~F~~~~~p~~~~r~~LA~~lgl~~~~V~vWFqNRRak~rk~~~~   74 (149)
                      +..-.+|.||.||.||..||..||..|...+||++.+|++||.+++|++..|+|||||||+|+||+++.
T Consensus        10 ~l~ekrKQRRIRTTFTS~QLkELErvF~ETHYPDIYTREEiA~kidLTEARVQVWFQNRRAKfRKQEr~   78 (125)
T KOG0484|consen   10 GLTEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREEIALKIDLTEARVQVWFQNRRAKFRKQERA   78 (125)
T ss_pred             ChhHHHHhhhhhhhhhHHHHHHHHHHHHhhcCCcchhHHHHHHhhhhhHHHHHHHHHhhHHHHHHHHHH
Confidence            334467889999999999999999999999999999999999999999999999999999999998644

>KOG0489|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 2e-20
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 2e-19
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 3e-18
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 3e-17
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 2e-16
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 4e-16
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 3e-15
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 5e-14
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 9e-14
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 6e-13
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 8e-12
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 1e-08
2k40_A67 Nmr Structure Of Hesx-1 Homeodomain Double Mutant R 3e-08
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 7e-08
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 1e-07
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 2e-07
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 2e-07
1hom_A68 Determination Of The Three-Dimensional Structure Of 2e-07
1qry_A80 Homeobox Protein Vnd (Ventral Nervous System Defect 8e-07
1nk2_P77 VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES 9e-07
2djn_A70 The Solution Structure Of The Homeobox Domain Of Hu 9e-07
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 2e-06
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 2e-06
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 4e-06
3a03_A56 Crystal Structure Of Hox11l1 Homeodomain Length = 5 5e-06
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 6e-06
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 7e-06
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 2e-05
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 2e-05
1jgg_A60 Even-Skipped Homeodomain Complexed To At-Rich Dna L 2e-05
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 3e-05
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 3e-05
1zq3_P68 Nmr Solution Structure Of The Bicoid Homeodomain Bo 4e-05
2dmq_A80 Solution Structure Of The Homeobox Domain Of LimHOM 4e-05
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 5e-05
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 6e-05
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 6e-05
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 7e-05
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 8e-05
3rkq_A58 Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Lengt 8e-05
2cra_A70 Solution Structure Of The Homeobox Domain Of Human 9e-05
1bw5_A66 The Nmr Solution Structure Of The Homeodomain Of Th 1e-04
2lp0_A60 The Solution Structure Of Homeodomain-Protein Compl 1e-04
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 2e-04
1ftt_A68 Thyroid Transcription Factor 1 Homeodomain (Rattus 2e-04
2ld5_A67 Solution Nmr-Derived Complex Structure Of Hoxa13 Dn 2e-04
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 3e-04
2l7z_A73 Nmr Structure Of A13 Homedomain Length = 73 3e-04
2l9r_A69 Solution Nmr Structure Of Homeobox Domain Of Homeob 3e-04
2da3_A80 Solution Structure Of The Third Homeobox Domain Of 6e-04
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 6e-04
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 8e-04
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure 
Iteration: 1

 Score = 94.4 bits (233), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 42/61 (68%), Positives = 51/61 (83%)
Query: 12 KRRRSRTNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKWRKK 71
          K+RR+RT F S+QLEELE+ F  +HYPDV+ RE LA+R DL E+RV VWFQNRRAKWRK+
Sbjct: 8  KKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQVWFQNRRAKWRKR 67
Query: 72 E 72
          E
Sbjct: 68 E 68
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 Back     alignment and structure
>pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 Back     alignment and structure
>pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|3A03|A Chain A, Crystal Structure Of Hox11l1 Homeodomain Length = 56 Back     alignment and structure
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|1JGG|A Chain A, Even-Skipped Homeodomain Complexed To At-Rich Dna Length = 60 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|1ZQ3|P Chain P, Nmr Solution Structure Of The Bicoid Homeodomain Bound To The Consensus Dna Binding Site Taatcc Length = 68 Back     alignment and structure
>pdb|2DMQ|A Chain A, Solution Structure Of The Homeobox Domain Of LimHOMEOBOX Protein Lhx9 Length = 80 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|3RKQ|A Chain A, Nkx2.5 Homeodomain Dimer Bound To Anf-242 Dna Length = 58 Back     alignment and structure
>pdb|2CRA|A Chain A, Solution Structure Of The Homeobox Domain Of Human Homeo Box B13 Length = 70 Back     alignment and structure
>pdb|1BW5|A Chain A, The Nmr Solution Structure Of The Homeodomain Of The Rat Insulin Gene Enhancer Protein Isl-1, 50 Structures Length = 66 Back     alignment and structure
>pdb|2LP0|A Chain A, The Solution Structure Of Homeodomain-Protein Complex Length = 60 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|1FTT|A Chain A, Thyroid Transcription Factor 1 Homeodomain (Rattus Norvegicus) Length = 68 Back     alignment and structure
>pdb|2LD5|A Chain A, Solution Nmr-Derived Complex Structure Of Hoxa13 Dna Binding Domain Bound To Dna Length = 67 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 Back     alignment and structure
>pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 Back     alignment and structure
>pdb|2DA3|A Chain A, Solution Structure Of The Third Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 80 Back     alignment and structure
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 2e-35
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 2e-34
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 3e-33
3a02_A60 Homeobox protein aristaless; homeodomain, developm 1e-32
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 2e-32
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 7e-32
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-31
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 2e-30
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-28
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-27
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 3e-25
1uhs_A72 HOP, homeodomain only protein; structural genomics 4e-25
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-22
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 1e-22
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 5e-21
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 2e-19
3d1n_I151 POU domain, class 6, transcription factor 1; prote 5e-19
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 4e-18
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 5e-18
1e3o_C160 Octamer-binding transcription factor 1; transcript 3e-17
2xsd_C164 POU domain, class 3, transcription factor 1; trans 5e-17
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 6e-16
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-15
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 5e-15
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 5e-15
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 8e-15
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-14
3a01_A93 Homeodomain-containing protein; homeodomain, prote 3e-14
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 3e-14
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 4e-14
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-14
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 4e-14
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 5e-14
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 7e-14
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 3e-13
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 4e-13
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 7e-13
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 8e-13
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 1e-12
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 1e-12
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 2e-12
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 3e-12
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 5e-12
1lfb_A99 Liver transcription factor (LFB1); transcription r 7e-12
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-11
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 1e-11
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 3e-11
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 4e-11
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 7e-11
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 9e-11
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 1e-10
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 2e-10
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 5e-10
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 5e-10
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 3e-07
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 2e-06
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-05
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 1e-04
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 7e-04
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
 Score =  116 bits (293), Expect = 2e-35
 Identities = 35/75 (46%), Positives = 51/75 (68%)

Query: 11 SKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKWRK 70
          S  +R+RT+F   Q+E LE+ F  +HYPDVF RE LA ++DL E+R+ VWF NRRAKWR+
Sbjct: 5  SSGQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRR 64

Query: 71 KEHTKKGPGRPAHNA 85
          +E  +    +   ++
Sbjct: 65 EEKLRNQRRQSGPSS 79
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.88
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.87
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.87
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.87
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.87
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.87
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.86
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.86
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.86
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.86
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.86
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.86
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.86
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.86
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.85
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.85
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.85
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.85
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.85
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.85
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.85
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.85
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.84
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.84
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.84
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.84
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.84
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.84
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.84
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.84
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.84
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.83
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.83
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.83
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.82
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.82
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.82
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.82
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.82
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.82
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.82
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.82
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.82
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.81
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.81
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.81
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.81
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.81
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.8
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.8
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.8
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.79
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.79
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.79
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.79
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.79
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.78
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.78
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.77
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.77
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.76
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.76
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.76
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.75
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.74
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.74
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.74
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.74
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.73
2e19_A64 Transcription factor 8; homeobox domain, structura 99.72
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.7
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.65
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.63
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.57
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.56
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.48
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.39
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.83
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 95.44
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 85.59
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 84.4
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 82.73
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
Probab=99.88  E-value=1.1e-22  Score=133.83  Aligned_cols=74  Identities=38%  Similarity=0.532  Sum_probs=66.8

Q ss_pred             CCCcCCCCCCCCCCCCHHHHHHHHHHHhhCCCCCHHHHHHHHHhcCCCccchhhhhhhhhhhHHHhhhhcCCCC
Q psy9529           6 SDDLASKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKWRKKEHTKKGPG   79 (149)
Q Consensus         6 ~~~~~~k~rr~Rt~ft~~ql~~Le~~F~~~~~p~~~~r~~LA~~lgl~~~~V~vWFqNRRak~rk~~~~~~~~~   79 (149)
                      +++.+.+.++.||.||..|+.+||..|..++||+..++..||..+||++.+|+|||||||+|+|+........+
T Consensus         2 s~~~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~La~~l~l~~~qV~~WFqNRR~k~kr~~~~~~~~~   75 (77)
T 1nk2_P            2 SDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKGYEG   75 (77)
T ss_dssp             CSCCSCCCCCCCCCCCHHHHHHHHHHHHHCSCCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHTTCCC
T ss_pred             CCCCCCCCCCCCccCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHhCCCHHHHHHHhHHhhcchhhhhccccCCC
Confidence            34556778899999999999999999999999999999999999999999999999999999999877655444
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 149
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 3e-19
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 4e-19
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 4e-19
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 9e-19
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-18
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 7e-18
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 2e-17
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 2e-17
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-17
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 4e-17
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-16
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-16
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-16
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-16
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-15
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 5e-15
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 6e-15
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 9e-15
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 3e-14
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 4e-14
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 5e-14
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 5e-14
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 2e-13
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-12
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 5e-12
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 8e-12
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 1e-11
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 4e-11
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 1e-10
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 1e-08
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-08
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 6e-07
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 74.5 bits (183), Expect = 3e-19
 Identities = 24/66 (36%), Positives = 34/66 (51%)

Query: 10 ASKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKWR 69
          A   R+ R  +   Q  ELE+ FL + Y     R  +A  L+L E +V +WFQNRR K +
Sbjct: 10 ARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMK 69

Query: 70 KKEHTK 75
          K    +
Sbjct: 70 KINKDR 75
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.89
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.89
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.88
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.88
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.88
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.88
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.88
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.87
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.87
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.86
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.86
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.86
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.86
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.85
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.85
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.84
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.84
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.83
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.83
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.82
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.82
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.82
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.81
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.79
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.76
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.76
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.71
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.71
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.68
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.65
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.65
d1hlva166 DNA-binding domain of centromere binding protein B 90.91
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 88.4
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: VND/NK-2 protein
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

Probab=99.89  E-value=1.7e-24  Score=141.17  Aligned_cols=71  Identities=38%  Similarity=0.545  Sum_probs=64.3

Q ss_pred             CCCcCCCCCCCCCCCCHHHHHHHHHHHhhCCCCCHHHHHHHHHhcCCCccchhhhhhhhhhhHHHhhhhcC
Q psy9529           6 SDDLASKRRRSRTNFNSWQLEELERAFLASHYPDVFMREALALRLDLKESRVAVWFQNRRAKWRKKEHTKK   76 (149)
Q Consensus         6 ~~~~~~k~rr~Rt~ft~~ql~~Le~~F~~~~~p~~~~r~~LA~~lgl~~~~V~vWFqNRRak~rk~~~~~~   76 (149)
                      +++.+.++++.||+||.+|+.+|+.+|..++||+..+++.||..|||++.+|+|||||+|+|+|+......
T Consensus         2 s~g~p~k~rr~Rt~ft~~Q~~~Le~~F~~~~yP~~~~r~~LA~~l~l~~~qV~~WFqNrR~k~kr~~~~~~   72 (77)
T d1vnda_           2 SDGLPNKKRKRRVLFTKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKTKRAQNEKG   72 (77)
T ss_dssp             CSCCSSSSCSSCCCCCTTHHHHHHHHHHHCSCCCHHHHHHHHHHHTCCHHHHHHHHHHSSSSCSSSCCCSS
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCChhhhhhcchhHHHHHHHHhhccC
Confidence            44566788899999999999999999999999999999999999999999999999999999987654443
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure