Psyllid ID: psy9547
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 363 | ||||||
| 422416194 | 365 | A/G-specific adenine glycosylase [Lister | 0.958 | 0.953 | 0.468 | 1e-92 | |
| 423098396 | 365 | A/G-specific adenine glycosylase [Lister | 0.958 | 0.953 | 0.463 | 4e-92 | |
| 16800865 | 365 | hypothetical protein lin1797 [Listeria i | 0.958 | 0.953 | 0.463 | 5e-92 | |
| 410457149 | 363 | A/G-specific adenine glycosylase [Bacill | 0.947 | 0.947 | 0.471 | 9e-92 | |
| 424714567 | 420 | Probable A/G-specific adenine glycosylas | 0.958 | 0.828 | 0.460 | 4e-90 | |
| 46907920 | 362 | A/G-specific adenine glycosylase [Lister | 0.958 | 0.961 | 0.460 | 5e-90 | |
| 422809770 | 362 | A/G-specific adenine glycosylase [Lister | 0.958 | 0.961 | 0.463 | 5e-90 | |
| 226224292 | 365 | A/G-specific adenine glycosylase [Lister | 0.958 | 0.953 | 0.460 | 1e-89 | |
| 254826063 | 362 | A/G-specific adenine glycosylase [Lister | 0.958 | 0.961 | 0.460 | 1e-89 | |
| 16803729 | 365 | hypothetical protein lmo1689 [Listeria m | 0.958 | 0.953 | 0.457 | 1e-89 |
| >gi|422416194|ref|ZP_16493151.1| A/G-specific adenine glycosylase [Listeria innocua FSL J1-023] gi|313623442|gb|EFR93654.1| A/G-specific adenine glycosylase [Listeria innocua FSL J1-023] | Back alignment and taxonomy information |
|---|
Score = 345 bits (886), Expect = 1e-92, Method: Compositional matrix adjust.
Identities = 166/354 (46%), Positives = 235/354 (66%), Gaps = 6/354 (1%)
Query: 10 ILAFQESILTWYKQNARQLPWRESNNPYYVWISEVMLQQTQVKTVLPYYEKFIKTYPTIK 69
I AFQE++++WY+ N R LPWRE+ PY +W+SE+MLQQT+V TV+PY+ +F+ +PT++
Sbjct: 14 ITAFQEALVSWYEANKRILPWRENTEPYRIWVSEIMLQQTKVDTVIPYFNRFMTQFPTME 73
Query: 70 DFAFDTEDNVLKMWEGLGYYSRVRNFQAGCRQVIEQFGGEVPRDKKQLLSIKGVGDYTAG 129
F E ++LK WEGLGYYSRVRN Q +QVI F GEVP D +LS+KGVG YTAG
Sbjct: 74 SFVNADEADILKAWEGLGYYSRVRNLQTAMKQVITDFSGEVPSDLTTILSLKGVGPYTAG 133
Query: 130 ALASICYNIPTPAVDGNVFRIYGRLFEIEDDISKGKTKVVYETLVSKTMSQTNAREFNQA 189
A+ SI YN PAVDGNV R+ R+ EI +DI K T+ ++E ++ + + Q N FNQ
Sbjct: 134 AILSIAYNQAEPAVDGNVMRVIARVLEISEDIMKASTRKIFEEVLYQLIDQENPAAFNQG 193
Query: 190 LMDLGATVCLFKNPKCKECPLSRFCSAYKNNTIENFPVKLGKTKVKDVFLLTVVVKTDTN 249
LM++GA VC P C CPL FC A+KN N+PVK+ KTK K LL+++V +D
Sbjct: 194 LMEIGALVCTPTKPMCLLCPLQPFCEAHKNGVETNYPVKIKKTKTKTKELLSIIVISDDG 253
Query: 250 KYLIQKRPTTGLLSNFYMFLSFE---SDTPYTSQVEFLSENLPFKVNLNEKCLGNVKHVF 306
K I+KRP GLL+N + F + E + ++++FL N +V+L E+ + ++KHVF
Sbjct: 254 KIAIEKRPENGLLANMWQFPTIEIAKKENDEVAKLQFL-HNYGLEVSLEEEPIAHIKHVF 312
Query: 307 SHLKWNMDVYSGTAKEKTIPANKTYKLITETQMKKYAFPVPYQKVWKLFTKSKG 360
SHL W MD+ A+ ++ N+ + TE +MK+ AFPVPYQK+W+ + + KG
Sbjct: 313 SHLVWKMDIR--VARLRSAVPNENWHFATEEEMKRLAFPVPYQKMWQAWKEFKG 364
|
Source: Listeria innocua FSL J1-023 Species: Listeria innocua Genus: Listeria Family: Listeriaceae Order: Bacillales Class: Bacilli Phylum: Firmicutes Superkingdom: Bacteria |
| >gi|423098396|ref|ZP_17086165.1| A/G-specific adenine glycosylase [Listeria innocua ATCC 33091] gi|370795062|gb|EHN62792.1| A/G-specific adenine glycosylase [Listeria innocua ATCC 33091] | Back alignment and taxonomy information |
|---|
| >gi|16800865|ref|NP_471133.1| hypothetical protein lin1797 [Listeria innocua Clip11262] gi|422413175|ref|ZP_16490134.1| A/G-specific adenine glycosylase [Listeria innocua FSL S4-378] gi|16414300|emb|CAC97028.1| lin1797 [Listeria innocua Clip11262] gi|313618548|gb|EFR90537.1| A/G-specific adenine glycosylase [Listeria innocua FSL S4-378] | Back alignment and taxonomy information |
|---|
| >gi|410457149|ref|ZP_11310983.1| A/G-specific adenine glycosylase [Bacillus bataviensis LMG 21833] gi|409926411|gb|EKN63588.1| A/G-specific adenine glycosylase [Bacillus bataviensis LMG 21833] | Back alignment and taxonomy information |
|---|
| >gi|424714567|ref|YP_007015282.1| Probable A/G-specific adenine glycosylase YfhQ [Listeria monocytogenes serotype 4b str. LL195] gi|424013751|emb|CCO64291.1| Probable A/G-specific adenine glycosylase YfhQ [Listeria monocytogenes serotype 4b str. LL195] | Back alignment and taxonomy information |
|---|
| >gi|46907920|ref|YP_014309.1| A/G-specific adenine glycosylase [Listeria monocytogenes serotype 4b str. F2365] gi|405752914|ref|YP_006676379.1| A/G-specific adenine glycosylase [Listeria monocytogenes SLCC2378] gi|46881189|gb|AAT04486.1| A/G-specific adenine glycosylase [Listeria monocytogenes serotype 4b str. F2365] gi|404222114|emb|CBY73477.1| A/G-specific adenine glycosylase [Listeria monocytogenes SLCC2378] | Back alignment and taxonomy information |
|---|
| >gi|422809770|ref|ZP_16858181.1| A/G-specific adenine glycosylase [Listeria monocytogenes FSL J1-208] gi|378752089|gb|EHY62675.1| A/G-specific adenine glycosylase [Listeria monocytogenes FSL J1-208] | Back alignment and taxonomy information |
|---|
| >gi|226224292|ref|YP_002758399.1| A/G-specific adenine glycosylase [Listeria monocytogenes serotype 4b str. CLIP 80459] gi|424823451|ref|ZP_18248464.1| A/G-specific adenine glycosylase protein [Listeria monocytogenes str. Scott A] gi|225876754|emb|CAS05463.1| Putative A/G-specific adenine glycosylase [Listeria monocytogenes serotype 4b str. CLIP 80459] gi|332312131|gb|EGJ25226.1| A/G-specific adenine glycosylase protein [Listeria monocytogenes str. Scott A] | Back alignment and taxonomy information |
|---|
| >gi|254826063|ref|ZP_05231064.1| A/G-specific adenine glycosylase [Listeria monocytogenes FSL J1-194] gi|254853605|ref|ZP_05242953.1| A/G-specific adenine glycosylase [Listeria monocytogenes FSL R2-503] gi|254932865|ref|ZP_05266224.1| A/G-specific adenine glycosylase [Listeria monocytogenes HPB2262] gi|300764752|ref|ZP_07074743.1| A/G-specific adenine glycosylase [Listeria monocytogenes FSL N1-017] gi|386732429|ref|YP_006205925.1| A/G-specific adenine glycosylase [Listeria monocytogenes 07PF0776] gi|404281253|ref|YP_006682151.1| A/G-specific adenine glycosylase [Listeria monocytogenes SLCC2755] gi|404287120|ref|YP_006693706.1| A/G-specific adenine glycosylase [Listeria monocytogenes serotype 7 str. SLCC2482] gi|405750039|ref|YP_006673505.1| A/G-specific adenine glycosylase [Listeria monocytogenes ATCC 19117] gi|405755851|ref|YP_006679315.1| A/G-specific adenine glycosylase [Listeria monocytogenes SLCC2540] gi|406704471|ref|YP_006754825.1| A/G-specific adenine glycosylase [Listeria monocytogenes L312] gi|417317779|ref|ZP_12104385.1| A/G-specific adenine glycosylase [Listeria monocytogenes J1-220] gi|258606979|gb|EEW19587.1| A/G-specific adenine glycosylase [Listeria monocytogenes FSL R2-503] gi|293584420|gb|EFF96452.1| A/G-specific adenine glycosylase [Listeria monocytogenes HPB2262] gi|293595304|gb|EFG03065.1| A/G-specific adenine glycosylase [Listeria monocytogenes FSL J1-194] gi|300514638|gb|EFK41694.1| A/G-specific adenine glycosylase [Listeria monocytogenes FSL N1-017] gi|328473936|gb|EGF44752.1| A/G-specific adenine glycosylase [Listeria monocytogenes J1-220] gi|384391187|gb|AFH80257.1| A/G-specific adenine glycosylase [Listeria monocytogenes 07PF0776] gi|404219239|emb|CBY70603.1| A/G-specific adenine glycosylase [Listeria monocytogenes ATCC 19117] gi|404225051|emb|CBY76413.1| A/G-specific adenine glycosylase [Listeria monocytogenes SLCC2540] gi|404227888|emb|CBY49293.1| A/G-specific adenine glycosylase [Listeria monocytogenes SLCC2755] gi|404246049|emb|CBY04274.1| A/G-specific adenine glycosylase [Listeria monocytogenes serotype 7 str. SLCC2482] gi|406361501|emb|CBY67774.1| A/G-specific adenine glycosylase [Listeria monocytogenes L312] | Back alignment and taxonomy information |
|---|
| >gi|16803729|ref|NP_465214.1| hypothetical protein lmo1689 [Listeria monocytogenes EGD-e] gi|16411143|emb|CAC99767.1| lmo1689 [Listeria monocytogenes EGD-e] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 363 | ||||||
| TIGR_CMR|BA_0522 | 365 | BA_0522 "A/G-specific adenine | 0.931 | 0.926 | 0.387 | 2.1e-70 | |
| DICTYBASE|DDB_G0270764 | 574 | myh "monofunctional DNA glycos | 0.581 | 0.367 | 0.447 | 3.7e-60 | |
| RGD|620045 | 516 | Mutyh "mutY homolog (E. coli)" | 0.578 | 0.406 | 0.429 | 4.8e-54 | |
| UNIPROTKB|Q8R5G2 | 516 | Mutyh "A/G-specific adenine DN | 0.578 | 0.406 | 0.429 | 4.8e-54 | |
| MGI|MGI:1917853 | 515 | Mutyh "mutY homolog (E. coli)" | 0.578 | 0.407 | 0.424 | 6.1e-52 | |
| TIGR_CMR|CPS_4148 | 362 | CPS_4148 "A/G-specific adenine | 0.831 | 0.834 | 0.365 | 1.9e-51 | |
| UNIPROTKB|E2RG99 | 636 | MUTYH "Uncharacterized protein | 0.578 | 0.330 | 0.424 | 2.6e-51 | |
| UNIPROTKB|E5KP25 | 549 | MUTYH "A/G-specific adenine DN | 0.573 | 0.378 | 0.433 | 2.3e-50 | |
| UNIPROTKB|Q9UIF7 | 546 | MUTYH "A/G-specific adenine DN | 0.573 | 0.380 | 0.433 | 2.3e-50 | |
| ZFIN|ZDB-GENE-081104-193 | 526 | mutyh "mutY homolog (E. coli)" | 0.575 | 0.397 | 0.413 | 2.3e-50 |
| TIGR_CMR|BA_0522 BA_0522 "A/G-specific adenine glycosylase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
Score = 713 (256.0 bits), Expect = 2.1e-70, P = 2.1e-70
Identities = 134/346 (38%), Positives = 211/346 (60%)
Query: 13 FQESILTWYKQNARQLPWRESNNPYYVWISEVMLQQTQVKTVLPYYEKFIKTYPTIKDFA 72
FQ ++ W+++ R LPWR++ +PY VW+SE+MLQQT+V+ V PYY F+ +PT++ A
Sbjct: 14 FQNDLIGWFEKEQRDLPWRKNKDPYRVWVSEIMLQQTRVEAVKPYYANFMGKFPTLEALA 73
Query: 73 FDTEDNVLKMWEGLGYYSRVRNFQAGCRQVIEQFGGEVPRDKKQLLSIKGVGDYTAGALA 132
++ VLK WEGLGYYSR RN A ++V E +GG VP D K++ +KGVG YT GA+
Sbjct: 74 NADDEEVLKAWEGLGYYSRARNLHAAVKEVKEVYGGIVPSDVKKIEKLKGVGPYTKGAIL 133
Query: 133 SICYNIPTPAVDGNVFRIYGRLFEIEDDISKGKTKVVYETLVSKTMSQTNAREFNQALMD 192
SI Y IP PAVDGNV R+ R+ + DDI+K KT+ V+E +V + +S N FNQ LM+
Sbjct: 134 SIAYGIPEPAVDGNVVRVLSRILSVWDDIAKPKTRKVFEEIVREIISAENPSYFNQGLME 193
Query: 193 LGATVCLFKNPKCKECPLSRFCSAYKNNTIENFPVKLGKTKVKDVF-LLTVVVKTDTNKY 251
LGA +C+ KNP C CP+ C Y + PVK K K + ++ V++T+ +Y
Sbjct: 194 LGALICIPKNPACLLCPVREHCRGYAEGVQKELPVK-SKAKAPTMVPIVAGVLQTEDGRY 252
Query: 252 LIQKRPTTGLLSNFYMFLSFESDTPYTSQ----VEFLSENLPFKVNLNEKCLGNVKHVFS 307
+I KRP+TGLL+N + F + E +Q ++++ E +++ E + NV+H F+
Sbjct: 253 VINKRPSTGLLANMWEFPNVELGEGIRNQKEQLIDYMKEKFELSISIEEYAM-NVQHTFT 311
Query: 308 HLKWNMDVYSGTAKEKTIPANKTYKLITETQMKKYAFPVPYQKVWK 353
H W++ V+ G + + T K +++ ++ F ++ +++
Sbjct: 312 HRTWDIFVFYGKVTGDIVETD-TLKFVSKEAFEQLPFSKSHRTIYE 356
|
|
| DICTYBASE|DDB_G0270764 myh "monofunctional DNA glycosylase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| RGD|620045 Mutyh "mutY homolog (E. coli)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8R5G2 Mutyh "A/G-specific adenine DNA glycosylase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1917853 Mutyh "mutY homolog (E. coli)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CPS_4148 CPS_4148 "A/G-specific adenine glycosylase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RG99 MUTYH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E5KP25 MUTYH "A/G-specific adenine DNA glycosylase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UIF7 MUTYH "A/G-specific adenine DNA glycosylase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-081104-193 mutyh "mutY homolog (E. coli)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 363 | |||
| COG1194 | 342 | COG1194, MutY, A/G-specific DNA glycosylase [DNA r | 1e-134 | |
| TIGR01084 | 275 | TIGR01084, mutY, A/G-specific adenine glycosylase | 1e-107 | |
| PRK10880 | 350 | PRK10880, PRK10880, adenine DNA glycosylase; Provi | 4e-66 | |
| cd00056 | 158 | cd00056, ENDO3c, endonuclease III; includes endonu | 2e-44 | |
| smart00478 | 149 | smart00478, ENDO3c, endonuclease III | 2e-37 | |
| PRK13910 | 289 | PRK13910, PRK13910, DNA glycosylase MutY; Provisio | 7e-34 | |
| COG0177 | 211 | COG0177, Nth, Predicted EndoIII-related endonuclea | 7e-33 | |
| pfam00730 | 144 | pfam00730, HhH-GPD, HhH-GPD superfamily base excis | 1e-28 | |
| TIGR01083 | 191 | TIGR01083, nth, endonuclease III | 4e-25 | |
| cd03431 | 118 | cd03431, DNA_Glycosylase_C, DNA glycosylase (MutY | 1e-24 | |
| PRK10702 | 211 | PRK10702, PRK10702, endonuclease III; Provisional | 8e-11 | |
| pfam00633 | 30 | pfam00633, HHH, Helix-hairpin-helix motif | 1e-04 | |
| smart00525 | 21 | smart00525, FES, iron-sulpphur binding domain in D | 0.001 | |
| COG2231 | 215 | COG2231, COG2231, Uncharacterized protein related | 0.002 |
| >gnl|CDD|224115 COG1194, MutY, A/G-specific DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Score = 386 bits (994), Expect = e-134
Identities = 142/351 (40%), Positives = 202/351 (57%), Gaps = 15/351 (4%)
Query: 6 SAKEILAFQESILTWYKQNARQLPWRESNNPYYVWISEVMLQQTQVKTVLPYYEKFIKTY 65
S +I FQE++L WY +N R LPWRE+ +PY VW+SE+MLQQTQV TV+PYYE+F++ +
Sbjct: 4 SDGDIEKFQEALLDWYDKNGRDLPWRETKDPYRVWVSEIMLQQTQVATVIPYYERFLERF 63
Query: 66 PTIKDFAFDTEDNVLKMWEGLGYYSRVRNFQAGCRQVIEQFGGEVPRDKKQLLSIKGVGD 125
PTIK A ED VLK WEGLGYYSR RN ++V+E+ GGE P D+++L ++ GVG
Sbjct: 64 PTIKALAAAPEDEVLKAWEGLGYYSRARNLHKAAQEVVERHGGEFPDDEEELAALPGVGP 123
Query: 126 YTAGALASICYNIPTPAVDGNVFRIYGRLFEIEDDISKGKTKVVYETLVSKTMSQTN-AR 184
YTAGA+ S +N P P +DGNV R+ RLF I DI K KTK L + ++
Sbjct: 124 YTAGAILSFAFNQPEPVLDGNVKRVLSRLFAISGDIGKPKTKKELWELAEQLLTPDRRPG 183
Query: 185 EFNQALMDLGATVCLFKNPKCKECPLSRFCSAYKNNTIENFPVKLGKTKVKDVFLLTVVV 244
+FNQA+MDLGAT+C K PKC CPL C+AY+N T E +PVK K K+ F +++
Sbjct: 184 DFNQAMMDLGATICTAKKPKCSLCPLRDNCAAYRNGTPEKYPVKKPKKKLPRRFAAFLIL 243
Query: 245 KTDTNKYLIQKRPTTGLLSNFYMFLSFESDTPYTSQVEFLSENLPFKVNLNEKCLGNVKH 304
D + L++KRP GLL + F FE + + L + LG +H
Sbjct: 244 NRD-GEVLLEKRPEKGLLGGLWCFPQFEDEADLLDWL--------AADGLAAEPLGAFRH 294
Query: 305 VFSHLKWNMDVYSGTAKEKTIPANKTYKLITETQMKKYAFPVPYQKVWKLF 355
F+H + +++ + + + ++ P P +K+ +
Sbjct: 295 TFTHFRLTIELRA-----SASLVLSDGRWYNLSDLESIGLPAPVKKLLQQL 340
|
Length = 342 |
| >gnl|CDD|130156 TIGR01084, mutY, A/G-specific adenine glycosylase | Back alignment and domain information |
|---|
| >gnl|CDD|182805 PRK10880, PRK10880, adenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238013 cd00056, ENDO3c, endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases | Back alignment and domain information |
|---|
| >gnl|CDD|214684 smart00478, ENDO3c, endonuclease III | Back alignment and domain information |
|---|
| >gnl|CDD|172427 PRK13910, PRK13910, DNA glycosylase MutY; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223255 COG0177, Nth, Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|216088 pfam00730, HhH-GPD, HhH-GPD superfamily base excision DNA repair protein | Back alignment and domain information |
|---|
| >gnl|CDD|130155 TIGR01083, nth, endonuclease III | Back alignment and domain information |
|---|
| >gnl|CDD|239523 cd03431, DNA_Glycosylase_C, DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone | Back alignment and domain information |
|---|
| >gnl|CDD|182661 PRK10702, PRK10702, endonuclease III; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|109681 pfam00633, HHH, Helix-hairpin-helix motif | Back alignment and domain information |
|---|
| >gnl|CDD|197771 smart00525, FES, iron-sulpphur binding domain in DNA-(apurinic or apyrimidinic site) lyase (subfamily of ENDO3) | Back alignment and domain information |
|---|
| >gnl|CDD|225140 COG2231, COG2231, Uncharacterized protein related to Endonuclease III [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 363 | |||
| PRK10880 | 350 | adenine DNA glycosylase; Provisional | 100.0 | |
| COG1194 | 342 | MutY A/G-specific DNA glycosylase [DNA replication | 100.0 | |
| TIGR01084 | 275 | mutY A/G-specific adenine glycosylase. This equiva | 100.0 | |
| PRK13910 | 289 | DNA glycosylase MutY; Provisional | 100.0 | |
| KOG2457|consensus | 555 | 100.0 | ||
| COG0177 | 211 | Nth Predicted EndoIII-related endonuclease [DNA re | 100.0 | |
| PRK10702 | 211 | endonuclease III; Provisional | 100.0 | |
| TIGR01083 | 191 | nth endonuclease III. This equivalog model identif | 100.0 | |
| PRK13913 | 218 | 3-methyladenine DNA glycosylase; Provisional | 100.0 | |
| KOG1921|consensus | 286 | 100.0 | ||
| COG2231 | 215 | Uncharacterized protein related to Endonuclease II | 100.0 | |
| smart00478 | 149 | ENDO3c endonuclease III. includes endonuclease III | 99.97 | |
| cd00056 | 158 | ENDO3c endonuclease III; includes endonuclease III | 99.97 | |
| PRK01229 | 208 | N-glycosylase/DNA lyase; Provisional | 99.95 | |
| TIGR00588 | 310 | ogg 8-oxoguanine DNA-glycosylase (ogg). All protei | 99.93 | |
| TIGR03252 | 177 | uncharacterized HhH-GPD family protein. This model | 99.89 | |
| TIGR00586 | 128 | mutt mutator mutT protein. All proteins in this fa | 99.89 | |
| PF14815 | 114 | NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3 | 99.89 | |
| PRK10776 | 129 | nucleoside triphosphate pyrophosphohydrolase; Prov | 99.88 | |
| PRK10546 | 135 | pyrimidine (deoxy)nucleoside triphosphate pyrophos | 99.88 | |
| cd03431 | 118 | DNA_Glycosylase_C DNA glycosylase (MutY in bacteri | 99.88 | |
| PRK10308 | 283 | 3-methyl-adenine DNA glycosylase II; Provisional | 99.87 | |
| COG0122 | 285 | AlkA 3-methyladenine DNA glycosylase/8-oxoguanine | 99.85 | |
| cd03425 | 124 | MutT_pyrophosphohydrolase The MutT pyrophosphohydr | 99.81 | |
| KOG2875|consensus | 323 | 99.8 | ||
| PRK08999 | 312 | hypothetical protein; Provisional | 99.8 | |
| KOG1918|consensus | 254 | 99.75 | ||
| PF00730 | 108 | HhH-GPD: HhH-GPD superfamily base excision DNA rep | 99.75 | |
| PRK15472 | 141 | nucleoside triphosphatase NudI; Provisional | 99.68 | |
| PRK15434 | 159 | GDP-mannose mannosyl hydrolase NudD; Provisional | 99.64 | |
| cd04676 | 129 | Nudix_Hydrolase_17 Members of the Nudix hydrolase | 99.63 | |
| cd03427 | 137 | MTH1 MutT homolog-1 (MTH1) is a member of the Nudi | 99.61 | |
| cd04669 | 121 | Nudix_Hydrolase_11 Members of the Nudix hydrolase | 99.61 | |
| cd04696 | 125 | Nudix_Hydrolase_37 Members of the Nudix hydrolase | 99.6 | |
| cd04673 | 122 | Nudix_Hydrolase_15 Members of the Nudix hydrolase | 99.58 | |
| cd03430 | 144 | GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mann | 99.56 | |
| cd04691 | 117 | Nudix_Hydrolase_32 Members of the Nudix hydrolase | 99.55 | |
| cd04684 | 128 | Nudix_Hydrolase_25 Contains a crystal structure of | 99.55 | |
| PRK09438 | 148 | nudB dihydroneopterin triphosphate pyrophosphatase | 99.55 | |
| cd04679 | 125 | Nudix_Hydrolase_20 Members of the Nudix hydrolase | 99.55 | |
| cd04699 | 129 | Nudix_Hydrolase_39 Members of the Nudix hydrolase | 99.54 | |
| cd04683 | 120 | Nudix_Hydrolase_24 Members of the Nudix hydrolase | 99.52 | |
| cd04682 | 122 | Nudix_Hydrolase_23 Members of the Nudix hydrolase | 99.52 | |
| cd03673 | 131 | Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hy | 99.51 | |
| cd04664 | 129 | Nudix_Hydrolase_7 Members of the Nudix hydrolase s | 99.5 | |
| cd04681 | 130 | Nudix_Hydrolase_22 Members of the Nudix hydrolase | 99.5 | |
| cd04680 | 120 | Nudix_Hydrolase_21 Members of the Nudix hydrolase | 99.49 | |
| cd02883 | 123 | Nudix_Hydrolase Nudix hydrolase is a superfamily o | 99.49 | |
| PLN02325 | 144 | nudix hydrolase | 99.48 | |
| cd04695 | 131 | Nudix_Hydrolase_36 Members of the Nudix hydrolase | 99.48 | |
| cd04688 | 126 | Nudix_Hydrolase_29 Members of the Nudix hydrolase | 99.47 | |
| cd04671 | 123 | Nudix_Hydrolase_13 Members of the Nudix hydrolase | 99.47 | |
| cd04687 | 128 | Nudix_Hydrolase_28 Members of the Nudix hydrolase | 99.47 | |
| cd04678 | 129 | Nudix_Hydrolase_19 Members of the Nudix hydrolase | 99.46 | |
| cd04670 | 127 | Nudix_Hydrolase_12 Members of the Nudix hydrolase | 99.46 | |
| cd03675 | 134 | Nudix_Hydrolase_2 Contains a crystal structure of | 99.46 | |
| cd04690 | 118 | Nudix_Hydrolase_31 Members of the Nudix hydrolase | 99.46 | |
| cd04511 | 130 | Nudix_Hydrolase_4 Members of the Nudix hydrolase s | 99.45 | |
| PRK15393 | 180 | NUDIX hydrolase YfcD; Provisional | 99.44 | |
| cd03674 | 138 | Nudix_Hydrolase_1 Members of the Nudix hydrolase s | 99.44 | |
| cd04667 | 112 | Nudix_Hydrolase_10 Members of the Nudix hydrolase | 99.44 | |
| cd04700 | 142 | DR1025_like DR1025 from Deinococcus radiodurans, a | 99.42 | |
| cd04697 | 126 | Nudix_Hydrolase_38 Members of the Nudix hydrolase | 99.4 | |
| cd04672 | 123 | Nudix_Hydrolase_14 Members of the Nudix hydrolase | 99.39 | |
| cd03426 | 157 | CoAse Coenzyme A pyrophosphatase (CoAse), a member | 99.38 | |
| cd04693 | 127 | Nudix_Hydrolase_34 Members of the Nudix hydrolase | 99.37 | |
| cd04661 | 132 | MRP_L46 Mitochondrial ribosomal protein L46 (MRP L | 99.37 | |
| cd03429 | 131 | NADH_pyrophosphatase NADH pyrophosphatase, a membe | 99.36 | |
| cd03671 | 147 | Ap4A_hydrolase_plant_like Diadenosine tetraphospha | 99.35 | |
| cd03424 | 137 | ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) | 99.34 | |
| cd03428 | 130 | Ap4A_hydrolase_human_like Diadenosine tetraphospha | 99.33 | |
| cd04689 | 125 | Nudix_Hydrolase_30 Members of the Nudix hydrolase | 99.33 | |
| cd04694 | 143 | Nudix_Hydrolase_35 Members of the Nudix hydrolase | 99.33 | |
| cd03672 | 145 | Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalyt | 99.32 | |
| PF00293 | 134 | NUDIX: NUDIX domain; InterPro: IPR000086 The gener | 99.3 | |
| cd02885 | 165 | IPP_Isomerase Isopentenyl diphosphate (IPP) isomer | 99.3 | |
| cd04677 | 132 | Nudix_Hydrolase_18 Members of the Nudix hydrolase | 99.3 | |
| TIGR02150 | 158 | IPP_isom_1 isopentenyl-diphosphate delta-isomerase | 99.29 | |
| COG1051 | 145 | ADP-ribose pyrophosphatase [Nucleotide transport a | 99.28 | |
| cd04692 | 144 | Nudix_Hydrolase_33 Members of the Nudix hydrolase | 99.23 | |
| cd04666 | 122 | Nudix_Hydrolase_9 Members of the Nudix hydrolase s | 99.23 | |
| PRK05379 | 340 | bifunctional nicotinamide mononucleotide adenylylt | 99.22 | |
| cd04686 | 131 | Nudix_Hydrolase_27 Members of the Nudix hydrolase | 99.22 | |
| PRK00241 | 256 | nudC NADH pyrophosphatase; Reviewed | 99.21 | |
| cd04685 | 133 | Nudix_Hydrolase_26 Members of the Nudix hydrolase | 99.19 | |
| COG1059 | 210 | Thermostable 8-oxoguanine DNA glycosylase [DNA rep | 99.19 | |
| PRK00714 | 156 | RNA pyrophosphohydrolase; Reviewed | 99.18 | |
| PRK03759 | 184 | isopentenyl-diphosphate delta-isomerase; Provision | 99.12 | |
| cd04674 | 118 | Nudix_Hydrolase_16 Members of the Nudix hydrolase | 99.12 | |
| PRK10707 | 190 | putative NUDIX hydrolase; Provisional | 99.07 | |
| cd04663 | 126 | Nudix_Hydrolase_6 Members of the Nudix hydrolase s | 99.03 | |
| PRK11762 | 185 | nudE adenosine nucleotide hydrolase NudE; Provisio | 99.01 | |
| cd04665 | 118 | Nudix_Hydrolase_8 Members of the Nudix hydrolase s | 98.88 | |
| cd04662 | 126 | Nudix_Hydrolase_5 Members of the Nudix hydrolase s | 98.84 | |
| cd03676 | 180 | Nudix_hydrolase_3 Members of the Nudix hydrolase s | 98.8 | |
| PLN02709 | 222 | nudix hydrolase | 98.79 | |
| PF00633 | 30 | HHH: Helix-hairpin-helix motif; InterPro: IPR00044 | 98.76 | |
| TIGR02705 | 156 | nudix_YtkD nucleoside triphosphatase YtkD. The fun | 98.75 | |
| PLN02552 | 247 | isopentenyl-diphosphate delta-isomerase | 98.64 | |
| TIGR00052 | 185 | nudix-type nucleoside diphosphatase, YffH/AdpP fam | 98.59 | |
| COG0494 | 161 | MutT NTP pyrophosphohydrolases including oxidative | 98.46 | |
| cd03670 | 186 | ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) | 98.41 | |
| PRK10729 | 202 | nudF ADP-ribose pyrophosphatase NudF; Provisional | 98.31 | |
| PLN02791 | 770 | Nudix hydrolase homolog | 98.14 | |
| PRK15009 | 191 | GDP-mannose pyrophosphatase NudK; Provisional | 98.09 | |
| PF10576 | 17 | EndIII_4Fe-2S: Iron-sulfur binding domain of endon | 98.08 | |
| KOG3069|consensus | 246 | 97.93 | ||
| COG2816 | 279 | NPY1 NTP pyrophosphohydrolases containing a Zn-fin | 97.81 | |
| PLN03143 | 291 | nudix hydrolase; Provisional | 97.75 | |
| smart00525 | 26 | FES FES domain. iron-sulpphur binding domain in DN | 97.53 | |
| KOG3084|consensus | 345 | 97.11 | ||
| COG1443 | 185 | Idi Isopentenyldiphosphate isomerase [Lipid metabo | 96.97 | |
| KOG2839|consensus | 145 | 96.91 | ||
| COG4119 | 161 | Predicted NTP pyrophosphohydrolase [DNA replicatio | 96.61 | |
| smart00278 | 26 | HhH1 Helix-hairpin-helix DNA-binding motif class 1 | 95.78 | |
| KOG0648|consensus | 295 | 95.54 | ||
| PF14716 | 68 | HHH_8: Helix-hairpin-helix domain; PDB: 2W9M_A 1HU | 94.88 | |
| PF03352 | 179 | Adenine_glyco: Methyladenine glycosylase; InterPro | 94.57 | |
| KOG3041|consensus | 225 | 94.57 | ||
| PF12826 | 64 | HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS | 94.55 | |
| PRK10353 | 187 | 3-methyl-adenine DNA glycosylase I; Provisional | 93.79 | |
| PLN02839 | 372 | nudix hydrolase | 93.41 | |
| TIGR00426 | 69 | competence protein ComEA helix-hairpin-helix repea | 92.98 | |
| PRK00024 | 224 | hypothetical protein; Reviewed | 92.18 | |
| TIGR00608 | 218 | radc DNA repair protein radc. This family is based | 92.18 | |
| PF09674 | 232 | DUF2400: Protein of unknown function (DUF2400); In | 91.78 | |
| PRK02515 | 132 | psbU photosystem II complex extrinsic protein prec | 90.82 | |
| PRK14601 | 183 | ruvA Holliday junction DNA helicase RuvA; Provisio | 90.75 | |
| TIGR02757 | 229 | conserved hypothetical protein TIGR02757. Members | 90.54 | |
| PRK13901 | 196 | ruvA Holliday junction DNA helicase RuvA; Provisio | 90.42 | |
| COG0353 | 198 | RecR Recombinational DNA repair protein (RecF path | 90.07 | |
| PRK14606 | 188 | ruvA Holliday junction DNA helicase RuvA; Provisio | 90.05 | |
| TIGR00624 | 179 | tag DNA-3-methyladenine glycosylase I. This family | 89.58 | |
| TIGR00615 | 195 | recR recombination protein RecR. This family is ba | 89.53 | |
| PRK14602 | 203 | ruvA Holliday junction DNA helicase RuvA; Provisio | 89.52 | |
| PRK00076 | 196 | recR recombination protein RecR; Reviewed | 89.44 | |
| PRK14603 | 197 | ruvA Holliday junction DNA helicase RuvA; Provisio | 89.27 | |
| PRK14604 | 195 | ruvA Holliday junction DNA helicase RuvA; Provisio | 89.17 | |
| COG0632 | 201 | RuvA Holliday junction resolvasome, DNA-binding su | 89.03 | |
| PRK13844 | 200 | recombination protein RecR; Provisional | 88.9 | |
| PRK00116 | 192 | ruvA Holliday junction DNA helicase RuvA; Reviewed | 88.22 | |
| smart00483 | 334 | POLXc DNA polymerase X family. includes vertebrate | 88.15 | |
| KOG4548|consensus | 263 | 88.13 | ||
| PRK14605 | 194 | ruvA Holliday junction DNA helicase RuvA; Provisio | 87.72 | |
| PF12836 | 65 | HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE | 87.2 | |
| PRK08609 | 570 | hypothetical protein; Provisional | 86.88 | |
| PRK14600 | 186 | ruvA Holliday junction DNA helicase RuvA; Provisio | 86.77 | |
| PF14520 | 60 | HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU | 86.76 | |
| KOG4195|consensus | 275 | 86.47 | ||
| PF11731 | 93 | Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd | 86.29 | |
| PRK14605 | 194 | ruvA Holliday junction DNA helicase RuvA; Provisio | 86.2 | |
| PRK00116 | 192 | ruvA Holliday junction DNA helicase RuvA; Reviewed | 85.9 | |
| PF12836 | 65 | HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE | 85.85 | |
| TIGR01259 | 120 | comE comEA protein. This model describes the ComEA | 85.64 | |
| COG4112 | 203 | Predicted phosphoesterase (MutT family) [General f | 85.62 | |
| PF05559 | 319 | DUF763: Protein of unknown function (DUF763); Inte | 85.46 | |
| PRK02515 | 132 | psbU photosystem II complex extrinsic protein prec | 85.17 | |
| COG1555 | 149 | ComEA DNA uptake protein and related DNA-binding p | 84.91 | |
| PRK07945 | 335 | hypothetical protein; Provisional | 84.85 | |
| COG2818 | 188 | Tag 3-methyladenine DNA glycosylase [DNA replicati | 84.8 | |
| TIGR01259 | 120 | comE comEA protein. This model describes the ComEA | 84.09 | |
| PF14520 | 60 | HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU | 83.47 | |
| COG2003 | 224 | RadC DNA repair proteins [DNA replication, recombi | 83.28 | |
| PF02371 | 87 | Transposase_20: Transposase IS116/IS110/IS902 fami | 83.21 | |
| PF11798 | 32 | IMS_HHH: IMS family HHH motif; InterPro: IPR024728 | 82.46 | |
| TIGR00084 | 191 | ruvA Holliday junction DNA helicase, RuvA subunit. | 81.99 | |
| KOG0142|consensus | 225 | 81.24 | ||
| TIGR00575 | 652 | dnlj DNA ligase, NAD-dependent. The member of this | 81.08 | |
| PRK13482 | 352 | DNA integrity scanning protein DisA; Provisional | 80.86 | |
| PRK07956 | 665 | ligA NAD-dependent DNA ligase LigA; Validated | 80.15 | |
| PRK14601 | 183 | ruvA Holliday junction DNA helicase RuvA; Provisio | 80.05 |
| >PRK10880 adenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.9e-83 Score=606.21 Aligned_cols=341 Identities=31% Similarity=0.552 Sum_probs=303.7
Q ss_pred HHHHHHHHHHHhhcCC-CCCCCCCCChHHHHHHHHHhhhcchhhHHHHHHHHHHhCCCHHHHhcCCHHHHHHHHhccCch
Q psy9547 11 LAFQESILTWYKQNAR-QLPWRESNNPYYVWISEVMLQQTQVKTVLPYYEKFIKTYPTIKDFAFDTEDNVLKMWEGLGYY 89 (363)
Q Consensus 11 ~~~~~~l~~~~~~~~~-~lpw~~~~dp~~~lv~~il~qqt~~~~v~~~~~~l~~~~pt~~~la~a~~~el~~~~~~lG~~ 89 (363)
..|.+.|++||..++| ++|||.+.|||++|||+||+|||++++|.++|.+|+++|||+++||++++++|+++|+++|||
T Consensus 4 ~~~~~~ll~W~~~~~r~~lpWr~~~dpy~ilVseILlQQT~v~~v~~~~~rl~~~fPt~~~La~a~~eel~~~~~glGyy 83 (350)
T PRK10880 4 SQFSAQVLDWYDKYGRKTLPWQIDKTPYKVWLSEVMLQQTQVATVIPYFERFMARFPTVTDLANAPLDEVLHLWTGLGYY 83 (350)
T ss_pred HHHHHHHHHHHHHcCCCCCCCCCCCCHHHHHHHHHHHhhccHHHHHHHHHHHHHHCcCHHHHHCcCHHHHHHHHHcCChH
Confidence 5689999999999997 999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHhhHHhCCCCcccHHHHhcCCCCcHHHHHHHHHHhcCCccccccchHHHHHhhhcccccCcCCcccHHH
Q psy9547 90 SRVRNFQAGCRQVIEQFGGEVPRDKKQLLSIKGVGDYTAGALASICYNIPTPAVDGNVFRIYGRLFEIEDDISKGKTKVV 169 (363)
Q Consensus 90 ~rA~~l~~~a~~i~~~~~g~~p~~~~~L~~lpGIG~~tA~~il~~~~~~~~~~vD~~v~Rvl~Rl~~~~~~~~~~~~~~~ 169 (363)
+||++|+++|+.|+++|+|.+|.++++|++|||||+|||++||+|+||+++++||+||.||++|+++++..+......+.
T Consensus 84 ~RAr~L~~~A~~i~~~~~g~~p~~~~~L~~LpGIG~~TA~aIl~~af~~~~~iVD~nV~RV~~Rl~~i~~~~~~~~~~~~ 163 (350)
T PRK10880 84 ARARNLHKAAQQVATLHGGEFPETFEEVAALPGVGRSTAGAILSLSLGKHFPILDGNVKRVLARCYAVSGWPGKKEVENR 163 (350)
T ss_pred HHHHHHHHHHHHHHHHhCCCchhhHHHHhcCCCccHHHHHHHHHHHCCCCeecccHHHHHHHHHHhcccCCCChHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999988765555566677
Q ss_pred HHHHHHhcCCcccHHHHHHHHHHHhhhhCcCCCCCCCCCCCcccChhhhcCCcccCCcccCCccccceeEEEEEEEeCCc
Q psy9547 170 YETLVSKTMSQTNAREFNQALMDLGATVCLFKNPKCKECPLSRFCSAYKNNTIENFPVKLGKTKVKDVFLLTVVVKTDTN 249 (363)
Q Consensus 170 ~~~~~~~~~p~~~~~~~~~~l~~~G~~~C~~~~P~C~~Cpl~~~C~~~~~~~~~~~p~k~~k~~~~~~~v~~~ii~~~~~ 249 (363)
+++.++.++|.+.+++||++||+||+++|+|++|+|+.|||++.|.+++.+.+..+|+|++|++.+.....++++.++ |
T Consensus 164 l~~~~~~l~p~~~~~~~nqalm~lGa~vC~p~~P~C~~Cpl~~~C~~~~~~~~~~~P~k~~k~~~~~~~~~~~~~~~~-~ 242 (350)
T PRK10880 164 LWQLSEQVTPAVGVERFNQAMMDLGAMVCTRSKPKCELCPLQNGCIAYANHSWALYPGKKPKQTLPERTGYFLLLQHG-D 242 (350)
T ss_pred HHHHHHHhCChhHHHHHHHHHHHhhHHhccCCCCCCCCCccHhhhHHHHcCCHhhCCCCCCCCCCCeEEEEEEEEEEC-C
Confidence 888899999999999999999999999999999999999999999999999999999998888877777777777655 8
Q ss_pred eEEEeecCCCccccccccccccCCCCCchHHHHHHHhhCCCcccccccccccEEEEccceEEEEEEEEEEecCCCC-CCC
Q psy9547 250 KYLIQKRPTTGLLSNFYMFLSFESDTPYTSQVEFLSENLPFKVNLNEKCLGNVKHVFSHLKWNMDVYSGTAKEKTI-PAN 328 (363)
Q Consensus 250 ~vLl~~R~~~~~~~glWEFPggk~e~~~~~alrEl~Eelgl~v~~~~~~l~~v~h~~sh~~~~l~~~~~~~~~~~~-~~~ 328 (363)
++|+.|||++|+|+||||||+... ++.+++..+++|+...... .+.+++|.|||++|+|++|.+....... ...
T Consensus 243 ~~~l~~r~~~gl~~gl~~fP~~~~----~~~~~~~~~~~~~~~~~~~-~~~~~~H~fTH~~~~~~~~~~~~~~~~~~~~~ 317 (350)
T PRK10880 243 EVWLEQRPPSGLWGGLFCFPQFAD----EEELRQWLAQRGIAADNLT-QLTAFRHTFSHFHLDIVPMWLPVSSFTGCMDE 317 (350)
T ss_pred EEEEEECCccChhhccccCCCCcc----hhhHHHHHHhcCCchhhhc-ccCceEEEEeeEEEEEEEEEEEccccccccCC
Confidence 999999999999999999998632 2344444467787533334 5789999999999999999887653211 112
Q ss_pred CCCeeecccccCcCCCChHHHHHHHHHHh
Q psy9547 329 KTYKLITETQMKKYAFPVPYQKVWKLFTK 357 (363)
Q Consensus 329 ~~~~W~~~~el~~~~~~~a~~~il~~l~~ 357 (363)
.+..|++++++.+++||++++|+++.+..
T Consensus 318 ~~~~w~~~~~~~~~~~p~~~~k~l~~~~~ 346 (350)
T PRK10880 318 GNGLWYNLAQPPSVGLAAPVERLLQQLRT 346 (350)
T ss_pred cCCeEechHHhcccCCcHHHHHHHHHhcc
Confidence 34579999999999999999999987653
|
|
| >COG1194 MutY A/G-specific DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01084 mutY A/G-specific adenine glycosylase | Back alignment and domain information |
|---|
| >PRK13910 DNA glycosylase MutY; Provisional | Back alignment and domain information |
|---|
| >KOG2457|consensus | Back alignment and domain information |
|---|
| >COG0177 Nth Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10702 endonuclease III; Provisional | Back alignment and domain information |
|---|
| >TIGR01083 nth endonuclease III | Back alignment and domain information |
|---|
| >PRK13913 3-methyladenine DNA glycosylase; Provisional | Back alignment and domain information |
|---|
| >KOG1921|consensus | Back alignment and domain information |
|---|
| >COG2231 Uncharacterized protein related to Endonuclease III [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >smart00478 ENDO3c endonuclease III | Back alignment and domain information |
|---|
| >cd00056 ENDO3c endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases | Back alignment and domain information |
|---|
| >PRK01229 N-glycosylase/DNA lyase; Provisional | Back alignment and domain information |
|---|
| >TIGR00588 ogg 8-oxoguanine DNA-glycosylase (ogg) | Back alignment and domain information |
|---|
| >TIGR03252 uncharacterized HhH-GPD family protein | Back alignment and domain information |
|---|
| >TIGR00586 mutt mutator mutT protein | Back alignment and domain information |
|---|
| >PF14815 NUDIX_4: NUDIX domain; PDB: 1VRL_A 1RRQ_A 3G0Q_A 3FSQ_A 1RRS_A 3FSP_A | Back alignment and domain information |
|---|
| >PRK10776 nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10546 pyrimidine (deoxy)nucleoside triphosphate pyrophosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >cd03431 DNA_Glycosylase_C DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone | Back alignment and domain information |
|---|
| >PRK10308 3-methyl-adenine DNA glycosylase II; Provisional | Back alignment and domain information |
|---|
| >COG0122 AlkA 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03425 MutT_pyrophosphohydrolase The MutT pyrophosphohydrolase is a prototypical Nudix hydrolase that catalyzes the hydrolysis of nucleoside and deoxynucleoside triphosphates (NTPs and dNTPs) by substitution at a beta-phosphorus to yield a nucleotide monophosphate (NMP) and inorganic pyrophosphate (PPi) | Back alignment and domain information |
|---|
| >KOG2875|consensus | Back alignment and domain information |
|---|
| >PRK08999 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1918|consensus | Back alignment and domain information |
|---|
| >PF00730 HhH-GPD: HhH-GPD superfamily base excision DNA repair protein This entry corresponds to Endonuclease III This entry corresponds to Alkylbase DNA glycosidase; InterPro: IPR003265 Endonuclease III (4 | Back alignment and domain information |
|---|
| >PRK15472 nucleoside triphosphatase NudI; Provisional | Back alignment and domain information |
|---|
| >PRK15434 GDP-mannose mannosyl hydrolase NudD; Provisional | Back alignment and domain information |
|---|
| >cd04676 Nudix_Hydrolase_17 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03427 MTH1 MutT homolog-1 (MTH1) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04669 Nudix_Hydrolase_11 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04696 Nudix_Hydrolase_37 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04673 Nudix_Hydrolase_15 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03430 GDPMH GDP-mannose glycosyl hydrolase (AKA GDP-mannose mannosyl hydrolase (GDPMH)) is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04691 Nudix_Hydrolase_32 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04684 Nudix_Hydrolase_25 Contains a crystal structure of the Nudix hydrolase from Enterococcus faecalis, which has an unknown function | Back alignment and domain information |
|---|
| >PRK09438 nudB dihydroneopterin triphosphate pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04679 Nudix_Hydrolase_20 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04699 Nudix_Hydrolase_39 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04683 Nudix_Hydrolase_24 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04682 Nudix_Hydrolase_23 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03673 Ap6A_hydrolase Diadenosine hexaphosphate (Ap6A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04664 Nudix_Hydrolase_7 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04681 Nudix_Hydrolase_22 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04680 Nudix_Hydrolase_21 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd02883 Nudix_Hydrolase Nudix hydrolase is a superfamily of enzymes found in all three kingdoms of life, and it catalyzes the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02325 nudix hydrolase | Back alignment and domain information |
|---|
| >cd04695 Nudix_Hydrolase_36 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04688 Nudix_Hydrolase_29 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04671 Nudix_Hydrolase_13 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04687 Nudix_Hydrolase_28 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04678 Nudix_Hydrolase_19 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04670 Nudix_Hydrolase_12 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03675 Nudix_Hydrolase_2 Contains a crystal structure of the Nudix hydrolase from Nitrosomonas europaea, which has an unknown function | Back alignment and domain information |
|---|
| >cd04690 Nudix_Hydrolase_31 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04511 Nudix_Hydrolase_4 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK15393 NUDIX hydrolase YfcD; Provisional | Back alignment and domain information |
|---|
| >cd03674 Nudix_Hydrolase_1 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04667 Nudix_Hydrolase_10 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04700 DR1025_like DR1025 from Deinococcus radiodurans, a member of the Nudix hydrolase superfamily, show nucleoside triphosphatase and dinucleoside polyphosphate pyrophosphatase activities | Back alignment and domain information |
|---|
| >cd04697 Nudix_Hydrolase_38 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04672 Nudix_Hydrolase_14 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03426 CoAse Coenzyme A pyrophosphatase (CoAse), a member of the Nudix hydrolase superfamily, functions to catalyze the elimination of oxidized inactive CoA, which can inhibit CoA-utilizing enzymes | Back alignment and domain information |
|---|
| >cd04693 Nudix_Hydrolase_34 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04661 MRP_L46 Mitochondrial ribosomal protein L46 (MRP L46) is a component of the large subunit (39S) of the mammalian mitochondrial ribosome and a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd03429 NADH_pyrophosphatase NADH pyrophosphatase, a member of the Nudix hydrolase superfamily, catalyzes the cleavage of NADH into reduced nicotinamide mononucleotide (NMNH) and AMP | Back alignment and domain information |
|---|
| >cd03671 Ap4A_hydrolase_plant_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd03424 ADPRase_NUDT5 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose and a variety of additional ADP-sugar conjugates to AMP and ribose-5-phosphate | Back alignment and domain information |
|---|
| >cd03428 Ap4A_hydrolase_human_like Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily | Back alignment and domain information |
|---|
| >cd04689 Nudix_Hydrolase_30 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04694 Nudix_Hydrolase_35 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03672 Dcp2p mRNA decapping enzyme 2 (Dcp2p), the catalytic subunit, and Dcp1p are the two components of the decapping enzyme complex | Back alignment and domain information |
|---|
| >PF00293 NUDIX: NUDIX domain; InterPro: IPR000086 The generic name 'NUDIX hydrolases' (NUcleoside DIphosphate linked to some other moiety X) has been coined for this domain family [] | Back alignment and domain information |
|---|
| >cd02885 IPP_Isomerase Isopentenyl diphosphate (IPP) isomerase, a member of the Nudix hydrolase superfamily, is a key enzyme in the isoprenoid biosynthetic pathway | Back alignment and domain information |
|---|
| >cd04677 Nudix_Hydrolase_18 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >TIGR02150 IPP_isom_1 isopentenyl-diphosphate delta-isomerase, type 1 | Back alignment and domain information |
|---|
| >COG1051 ADP-ribose pyrophosphatase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04692 Nudix_Hydrolase_33 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04666 Nudix_Hydrolase_9 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04686 Nudix_Hydrolase_27 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK00241 nudC NADH pyrophosphatase; Reviewed | Back alignment and domain information |
|---|
| >cd04685 Nudix_Hydrolase_26 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >COG1059 Thermostable 8-oxoguanine DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00714 RNA pyrophosphohydrolase; Reviewed | Back alignment and domain information |
|---|
| >PRK03759 isopentenyl-diphosphate delta-isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04674 Nudix_Hydrolase_16 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK10707 putative NUDIX hydrolase; Provisional | Back alignment and domain information |
|---|
| >cd04663 Nudix_Hydrolase_6 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PRK11762 nudE adenosine nucleotide hydrolase NudE; Provisional | Back alignment and domain information |
|---|
| >cd04665 Nudix_Hydrolase_8 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd04662 Nudix_Hydrolase_5 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >cd03676 Nudix_hydrolase_3 Members of the Nudix hydrolase superfamily catalyze the hydrolysis of NUcleoside DIphosphates linked to other moieties, X | Back alignment and domain information |
|---|
| >PLN02709 nudix hydrolase | Back alignment and domain information |
|---|
| >PF00633 HHH: Helix-hairpin-helix motif; InterPro: IPR000445 The HhH motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins [, , ] | Back alignment and domain information |
|---|
| >TIGR02705 nudix_YtkD nucleoside triphosphatase YtkD | Back alignment and domain information |
|---|
| >PLN02552 isopentenyl-diphosphate delta-isomerase | Back alignment and domain information |
|---|
| >TIGR00052 nudix-type nucleoside diphosphatase, YffH/AdpP family | Back alignment and domain information |
|---|
| >COG0494 MutT NTP pyrophosphohydrolases including oxidative damage repair enzymes [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >cd03670 ADPRase_NUDT9 ADP-ribose pyrophosphatase (ADPRase) catalyzes the hydrolysis of ADP-ribose to AMP and ribose-5-P | Back alignment and domain information |
|---|
| >PRK10729 nudF ADP-ribose pyrophosphatase NudF; Provisional | Back alignment and domain information |
|---|
| >PLN02791 Nudix hydrolase homolog | Back alignment and domain information |
|---|
| >PRK15009 GDP-mannose pyrophosphatase NudK; Provisional | Back alignment and domain information |
|---|
| >PF10576 EndIII_4Fe-2S: Iron-sulfur binding domain of endonuclease III; InterPro: IPR003651 Endonuclease III (4 | Back alignment and domain information |
|---|
| >KOG3069|consensus | Back alignment and domain information |
|---|
| >COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PLN03143 nudix hydrolase; Provisional | Back alignment and domain information |
|---|
| >smart00525 FES FES domain | Back alignment and domain information |
|---|
| >KOG3084|consensus | Back alignment and domain information |
|---|
| >COG1443 Idi Isopentenyldiphosphate isomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG2839|consensus | Back alignment and domain information |
|---|
| >COG4119 Predicted NTP pyrophosphohydrolase [DNA replication, recombination, and repair / General function prediction only] | Back alignment and domain information |
|---|
| >smart00278 HhH1 Helix-hairpin-helix DNA-binding motif class 1 | Back alignment and domain information |
|---|
| >KOG0648|consensus | Back alignment and domain information |
|---|
| >PF14716 HHH_8: Helix-hairpin-helix domain; PDB: 2W9M_A 1HUZ_A 1HUO_A 2BPG_B 2BPF_A 1DK3_A 1BPE_A 1BNO_A 1BNP_A 1DK2_A | Back alignment and domain information |
|---|
| >PF03352 Adenine_glyco: Methyladenine glycosylase; InterPro: IPR005019 This family of methyladenine glycosylases includes DNA-3-methyladenine glycosylase I (3 | Back alignment and domain information |
|---|
| >KOG3041|consensus | Back alignment and domain information |
|---|
| >PF12826 HHH_2: Helix-hairpin-helix motif; PDB: 1X2I_B 1DGS_A 1V9P_B | Back alignment and domain information |
|---|
| >PRK10353 3-methyl-adenine DNA glycosylase I; Provisional | Back alignment and domain information |
|---|
| >PLN02839 nudix hydrolase | Back alignment and domain information |
|---|
| >TIGR00426 competence protein ComEA helix-hairpin-helix repeat region | Back alignment and domain information |
|---|
| >PRK00024 hypothetical protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00608 radc DNA repair protein radc | Back alignment and domain information |
|---|
| >PF09674 DUF2400: Protein of unknown function (DUF2400); InterPro: IPR014127 Members of this uncharacterised protein family are found sporadically, so far only among spirochetes, epsilon and delta proteobacteria, and Bacteroides | Back alignment and domain information |
|---|
| >PRK02515 psbU photosystem II complex extrinsic protein precursor U; Provisional | Back alignment and domain information |
|---|
| >PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >TIGR02757 conserved hypothetical protein TIGR02757 | Back alignment and domain information |
|---|
| >PRK13901 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >COG0353 RecR Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14606 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >TIGR00624 tag DNA-3-methyladenine glycosylase I | Back alignment and domain information |
|---|
| >TIGR00615 recR recombination protein RecR | Back alignment and domain information |
|---|
| >PRK14602 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK00076 recR recombination protein RecR; Reviewed | Back alignment and domain information |
|---|
| >PRK14603 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK14604 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >COG0632 RuvA Holliday junction resolvasome, DNA-binding subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13844 recombination protein RecR; Provisional | Back alignment and domain information |
|---|
| >PRK00116 ruvA Holliday junction DNA helicase RuvA; Reviewed | Back alignment and domain information |
|---|
| >smart00483 POLXc DNA polymerase X family | Back alignment and domain information |
|---|
| >KOG4548|consensus | Back alignment and domain information |
|---|
| >PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PF12836 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE_A 3BZK_A 3BZC_A 2DUY_A | Back alignment and domain information |
|---|
| >PRK08609 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14600 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A | Back alignment and domain information |
|---|
| >KOG4195|consensus | Back alignment and domain information |
|---|
| >PF11731 Cdd1: Pathogenicity locus; InterPro: IPR021725 Cdd1 is expressed as part of the pathogenicity locus operon in several different orders of bacteria [] | Back alignment and domain information |
|---|
| >PRK14605 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
| >PRK00116 ruvA Holliday junction DNA helicase RuvA; Reviewed | Back alignment and domain information |
|---|
| >PF12836 HHH_3: Helix-hairpin-helix motif; PDB: 2EDU_A 2OCE_A 3BZK_A 3BZC_A 2DUY_A | Back alignment and domain information |
|---|
| >TIGR01259 comE comEA protein | Back alignment and domain information |
|---|
| >COG4112 Predicted phosphoesterase (MutT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PF05559 DUF763: Protein of unknown function (DUF763); InterPro: IPR008482 This family consists of several uncharacterised bacterial and archaeal proteins of unknown function | Back alignment and domain information |
|---|
| >PRK02515 psbU photosystem II complex extrinsic protein precursor U; Provisional | Back alignment and domain information |
|---|
| >COG1555 ComEA DNA uptake protein and related DNA-binding proteins [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK07945 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2818 Tag 3-methyladenine DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01259 comE comEA protein | Back alignment and domain information |
|---|
| >PF14520 HHH_5: Helix-hairpin-helix domain; PDB: 3AUO_B 3AU6_A 3AU2_A 3B0X_A 3B0Y_A 1SZP_C 3LDA_A 1WCN_A 2JZB_B 2ZTC_A | Back alignment and domain information |
|---|
| >COG2003 RadC DNA repair proteins [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF02371 Transposase_20: Transposase IS116/IS110/IS902 family; InterPro: IPR003346 Transposases are needed for efficient transposition of the insertion sequence or transposon DNA | Back alignment and domain information |
|---|
| >PF11798 IMS_HHH: IMS family HHH motif; InterPro: IPR024728 This helix-hairpin-helix motif is found in proteins belonging to the type-Y family of DNA polymerases [] | Back alignment and domain information |
|---|
| >TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit | Back alignment and domain information |
|---|
| >KOG0142|consensus | Back alignment and domain information |
|---|
| >TIGR00575 dnlj DNA ligase, NAD-dependent | Back alignment and domain information |
|---|
| >PRK13482 DNA integrity scanning protein DisA; Provisional | Back alignment and domain information |
|---|
| >PRK07956 ligA NAD-dependent DNA ligase LigA; Validated | Back alignment and domain information |
|---|
| >PRK14601 ruvA Holliday junction DNA helicase RuvA; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 363 | ||||
| 3fsp_A | 369 | Muty Adenine Glycosylase Bound To A Transition Stat | 5e-89 | ||
| 3g0q_A | 352 | Crystal Structure Of Muty Bound To Its Inhibitor Dn | 1e-88 | ||
| 1rrs_A | 369 | Muty Adenine Glycosylase In Complex With Dna Contai | 2e-88 | ||
| 1rrq_A | 369 | Muty Adenine Glycosylase In Complex With Dna Contai | 4e-88 | ||
| 3n5n_X | 287 | Crystal Structure Analysis Of The Catalytic Domain | 2e-48 | ||
| 1kg4_A | 225 | Crystal Structure Of The K142a Mutant Of E. Coli Mu | 4e-47 | ||
| 1kg6_A | 225 | Crystal Structure Of The K142r Mutant Of E.Coli Mut | 7e-47 | ||
| 1kg5_A | 225 | Crystal Structure Of The K142q Mutant Of E.Coli Mut | 8e-47 | ||
| 1muy_A | 225 | Catalytic Domain Of Muty From Escherichia Coli Leng | 9e-47 | ||
| 1kg7_A | 225 | Crystal Structure Of The E161a Mutant Of E.coli Mut | 9e-47 | ||
| 1wef_A | 225 | Catalytic Domain Of Muty From Escherichia Coli K20a | 1e-46 | ||
| 1mud_A | 225 | Catalytic Domain Of Muty From Escherichia Coli, D13 | 3e-46 | ||
| 1kqj_A | 225 | Crystal Structure Of A Mutant Of Muty Catalytic Dom | 2e-45 | ||
| 1kea_A | 221 | Structure Of A Thermostable Thymine-Dna Glycosylase | 2e-28 | ||
| 1orn_A | 226 | Structure Of A Trapped Endonuclease Iii-Dna Covalen | 5e-16 | ||
| 1p59_A | 226 | Structure Of A Non-Covalent Endonuclease Iii-Dna Co | 1e-15 | ||
| 2abk_A | 211 | Refinement Of The Native Structure Of Endonuclease | 3e-11 |
| >pdb|3FSP|A Chain A, Muty Adenine Glycosylase Bound To A Transition State Analog (1n) Paired With Dg In Duplexed Dna Length = 369 | Back alignment and structure |
|
| >pdb|3G0Q|A Chain A, Crystal Structure Of Muty Bound To Its Inhibitor Dna Length = 352 | Back alignment and structure |
| >pdb|1RRS|A Chain A, Muty Adenine Glycosylase In Complex With Dna Containing An Abasic Site Length = 369 | Back alignment and structure |
| >pdb|1RRQ|A Chain A, Muty Adenine Glycosylase In Complex With Dna Containing An A:oxog Pair Length = 369 | Back alignment and structure |
| >pdb|3N5N|X Chain X, Crystal Structure Analysis Of The Catalytic Domain And Interdomain Connector Of Human Muty Homologue Length = 287 | Back alignment and structure |
| >pdb|1KG4|A Chain A, Crystal Structure Of The K142a Mutant Of E. Coli Muty (Core Fragment) Length = 225 | Back alignment and structure |
| >pdb|1KG6|A Chain A, Crystal Structure Of The K142r Mutant Of E.Coli Muty (Core Fragment) Length = 225 | Back alignment and structure |
| >pdb|1KG5|A Chain A, Crystal Structure Of The K142q Mutant Of E.Coli Muty (Core Fragment) Length = 225 | Back alignment and structure |
| >pdb|1MUY|A Chain A, Catalytic Domain Of Muty From Escherichia Coli Length = 225 | Back alignment and structure |
| >pdb|1KG7|A Chain A, Crystal Structure Of The E161a Mutant Of E.coli Muty (core Fragment) Length = 225 | Back alignment and structure |
| >pdb|1WEF|A Chain A, Catalytic Domain Of Muty From Escherichia Coli K20a Mutant Length = 225 | Back alignment and structure |
| >pdb|1MUD|A Chain A, Catalytic Domain Of Muty From Escherichia Coli, D138n Mutant Complexed To Adenine Length = 225 | Back alignment and structure |
| >pdb|1KQJ|A Chain A, Crystal Structure Of A Mutant Of Muty Catalytic Domain Length = 225 | Back alignment and structure |
| >pdb|1KEA|A Chain A, Structure Of A Thermostable Thymine-Dna Glycosylase Length = 221 | Back alignment and structure |
| >pdb|1ORN|A Chain A, Structure Of A Trapped Endonuclease Iii-Dna Covalent Intermediate: Estranged-Guanine Complex Length = 226 | Back alignment and structure |
| >pdb|1P59|A Chain A, Structure Of A Non-Covalent Endonuclease Iii-Dna Complex Length = 226 | Back alignment and structure |
| >pdb|2ABK|A Chain A, Refinement Of The Native Structure Of Endonuclease Iii To A Resolution Of 1.85 Angstrom Length = 211 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 363 | |||
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 1e-164 | |
| 3n5n_X | 287 | A/G-specific adenine DNA glycosylase; alpha-helice | 1e-126 | |
| 1kg2_A | 225 | A/G-specific adenine glycosylase; DNA repair, hydr | 1e-124 | |
| 1kea_A | 221 | Possible G-T mismatches repair enzyme; DNA repair, | 1e-121 | |
| 4e9f_A | 161 | Methyl-CPG-binding domain protein 4; HHH DNA glyco | 1e-41 | |
| 1x51_A | 155 | A/G-specific adenine DNA glycosylase; nudix domain | 4e-28 | |
| 2abk_A | 211 | Endonuclease III; DNA-repair, DNA glycosylase; 1.8 | 7e-20 | |
| 1orn_A | 226 | Endonuclease III; DNA repair, DNA glycosylase, [4F | 2e-19 | |
| 1pu6_A | 218 | 3-methyladenine DNA glycosylase; helix-hairpin-hel | 8e-17 | |
| 3fhg_A | 207 | Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel | 6e-07 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 1e-05 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 |
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* Length = 369 | Back alignment and structure |
|---|
Score = 461 bits (1189), Expect = e-164
Identities = 153/362 (42%), Positives = 218/362 (60%), Gaps = 4/362 (1%)
Query: 1 MASNLSAKEILAFQESILTWYKQNARQLPWRESNNPYYVWISEVMLQQTQVKTVLPYYEK 60
M FQ +L W+ + R LPWR+ +PY VW+SEVMLQQT+V+TV+PY+E+
Sbjct: 4 MTRETERFPAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQ 63
Query: 61 FIKTYPTIKDFAFDTEDNVLKMWEGLGYYSRVRNFQAGCRQVIEQFGGEVPRDKKQLLSI 120
FI +PT++ A ED VLK WEGLGYYSRVRN A ++V ++GG+VP D + +
Sbjct: 64 FIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRL 123
Query: 121 KGVGDYTAGALASICYNIPTPAVDGNVFRIYGRLFEIEDDISKGKTKVVYETLVSKTMSQ 180
KGVG YT GA+ S+ Y +P PAVDGNV R+ RLF + DDI+K T+ +E +V + M+
Sbjct: 124 KGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKPSTRKRFEQIVREIMAY 183
Query: 181 TNAREFNQALMDLGATVCLFKNPKCKECPLSRFCSAYKNNTIENFPVKLGKTKVKDVFLL 240
N FN+AL++LGA VC + P C CP+ +C A+ E PVK+ KT VK V L
Sbjct: 184 ENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLA 243
Query: 241 TVVVKTDTNKYLIQKRPTTGLLSNFYMFLSFESDTPYTSQ--VEFLSENLPFKVNLNEKC 298
V+ D + LI+KR +TGLL+N + F S E+D + + + E +V L E
Sbjct: 244 VAVLADDEGRVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTEP- 302
Query: 299 LGNVKHVFSHLKWNMDVYSGTAKEKTIPANKTYKLITETQMKKYAFPVPYQKVWKLFTKS 358
+ + +H FSHL W + V+ G P + Y+L E ++K YAFPV +Q+VW+ + +
Sbjct: 303 IVSFEHAFSHLVWQLTVFPGRLVHGG-PVEEPYRLAPEDELKAYAFPVSHQRVWREYKEW 361
Query: 359 KG 360
Sbjct: 362 AS 363
|
| >1kg2_A A/G-specific adenine glycosylase; DNA repair, hydrolase; 1.20A {Escherichia coli} SCOP: a.96.1.2 PDB: 1kg3_A 1muy_A 1kg6_A 1kg5_A 1mun_A 1mud_A 1kg4_A 1weg_A 1wei_A* 1wef_A* 1kg7_A 1kqj_A Length = 225 | Back alignment and structure |
|---|
| >1kea_A Possible G-T mismatches repair enzyme; DNA repair, DNA glycosylase, DNA mismatch, methylation; 2.00A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.96.1.2 Length = 221 | Back alignment and structure |
|---|
| >4e9f_A Methyl-CPG-binding domain protein 4; HHH DNA glycosylase family, hydrolase-DNA complex; HET: DNA 3DR; 1.79A {Homo sapiens} PDB: 4e9e_A* 4e9g_A* 4e9h_A* 4ea5_A* 4dk9_A* 1ngn_A 4ea4_A* 4ew4_A* 4evv_A* 4ew0_A* 3iho_A Length = 161 | Back alignment and structure |
|---|
| >1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 Length = 155 | Back alignment and structure |
|---|
| >2abk_A Endonuclease III; DNA-repair, DNA glycosylase; 1.85A {Escherichia coli} SCOP: a.96.1.1 Length = 211 | Back alignment and structure |
|---|
| >1orn_A Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] cluster, iron-sulfur cluster, hydrolase/DNA complex; HET: PED; 1.70A {Geobacillus stearothermophilus} SCOP: a.96.1.1 PDB: 1orp_A* 1p59_A* Length = 226 | Back alignment and structure |
|---|
| >1pu6_A 3-methyladenine DNA glycosylase; helix-hairpin-helix, base excision repair, hydrolase; HET: KCX; 1.64A {Helicobacter pylori} SCOP: a.96.1.5 PDB: 1pu7_A* 1pu8_A* Length = 218 | Back alignment and structure |
|---|
| >3fhg_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase, hydrolase; 1.90A {Sulfolobus solfataricus} Length = 207 | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} Length = 158 | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* Length = 153 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 363 | |||
| 3fsp_A | 369 | A/G-specific adenine glycosylase; protein-DNA comp | 100.0 | |
| 3n5n_X | 287 | A/G-specific adenine DNA glycosylase; alpha-helice | 100.0 | |
| 1kg2_A | 225 | A/G-specific adenine glycosylase; DNA repair, hydr | 100.0 | |
| 1kea_A | 221 | Possible G-T mismatches repair enzyme; DNA repair, | 100.0 | |
| 1orn_A | 226 | Endonuclease III; DNA repair, DNA glycosylase, [4F | 100.0 | |
| 2abk_A | 211 | Endonuclease III; DNA-repair, DNA glycosylase; 1.8 | 100.0 | |
| 1pu6_A | 218 | 3-methyladenine DNA glycosylase; helix-hairpin-hel | 100.0 | |
| 4e9f_A | 161 | Methyl-CPG-binding domain protein 4; HHH DNA glyco | 99.98 | |
| 3fhg_A | 207 | Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel | 99.97 | |
| 4b21_A | 232 | Probable DNA-3-methyladenine glycosylase 2; hydrol | 99.97 | |
| 2h56_A | 233 | DNA-3-methyladenine glycosidase; 10174367, EC 3.2. | 99.97 | |
| 3fhf_A | 214 | Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; hel | 99.97 | |
| 3n0u_A | 219 | Probable N-glycosylase/DNA lyase; structural genom | 99.96 | |
| 2yg9_A | 225 | DNA-3-methyladenine glycosidase II, putative; hydr | 99.96 | |
| 3s6i_A | 228 | DNA-3-methyladenine glycosylase 1; DNA glycosylase | 99.95 | |
| 3i0w_A | 290 | 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8- | 99.95 | |
| 2xhi_A | 360 | N-glycosylase/DNA lyase; lyase-DNA complex, lyase/ | 99.94 | |
| 1mpg_A | 282 | ALKA, 3-methyladenine DNA glycosylase II; DNA repa | 99.93 | |
| 2jhn_A | 295 | ALKA, 3-methyladenine DNA-glycosylase; DNA repair, | 99.93 | |
| 1x51_A | 155 | A/G-specific adenine DNA glycosylase; nudix domain | 99.93 | |
| 3ees_A | 153 | Probable pyrophosphohydrolase; nudix, RNA pyrophos | 99.89 | |
| 2rrk_A | 140 | ORF135, CTP pyrophosphohydrolase; NMR {Escherichia | 99.86 | |
| 1mut_A | 129 | MUTT, nucleoside triphosphate pyrophosphohydrolase | 99.86 | |
| 3r03_A | 144 | Nudix hydrolase; structural genomics, PSI2, protei | 99.85 | |
| 3gwy_A | 140 | Putative CTP pyrophosphohydrolase; structural geno | 99.85 | |
| 3hhj_A | 158 | Mutator MUTT protein; niaid, ssgcid, decode, UW, S | 99.85 | |
| 3grn_A | 153 | MUTT related protein; structural genomics, hydrola | 99.82 | |
| 3id9_A | 171 | MUTT/nudix family protein; hydrolase, protein stru | 99.76 | |
| 3exq_A | 161 | Nudix family hydrolase; protein structure initiati | 99.76 | |
| 3q93_A | 176 | 7,8-dihydro-8-oxoguanine triphosphatase; structura | 99.75 | |
| 3oga_A | 165 | Nucleoside triphosphatase NUDI; salmonella enteric | 99.73 | |
| 2pbt_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.72 | |
| 1vcd_A | 126 | NDX1; nudix protein, diadenosine polyphosphate, AP | 99.72 | |
| 2b06_A | 155 | MUTT/nudix family protein; structural genomics, P | 99.7 | |
| 4dyw_A | 157 | MUTT/nudix family protein; structural genomics, ni | 99.7 | |
| 3i7u_A | 134 | AP4A hydrolase; nudix protein, diadenosine polypho | 99.69 | |
| 2fkb_A | 180 | Putative nudix hydrolase YFCD; putative protein, M | 99.69 | |
| 3fk9_A | 188 | Mutator MUTT protein; structural genomics, hydrola | 99.67 | |
| 2azw_A | 148 | MUTT/nudix family protein; MUTT/nudix ,enterococcu | 99.66 | |
| 1rya_A | 160 | GDP-mannose mannosyl hydrolase; GDP-glucose, nudix | 99.66 | |
| 1nqz_A | 194 | COA pyrophosphatase (MUTT/nudix family protein); D | 99.66 | |
| 2o1c_A | 150 | DATP pyrophosphohydrolase; nudix NTP hydrolase NTP | 99.66 | |
| 1sjy_A | 159 | MUTT/nudix family protein; nudix fold, alpha-beta- | 99.65 | |
| 1ktg_A | 138 | Diadenosine tetraphosphate hydrolase; nudix, AMP, | 99.63 | |
| 2b0v_A | 153 | Nudix hydrolase; structural genomics, PSI, protein | 99.62 | |
| 3eds_A | 153 | MUTT/nudix family protein; MUT/nudix protein, prot | 99.58 | |
| 3f6a_A | 159 | Hydrolase, nudix family; protein structure initiat | 99.58 | |
| 1k2e_A | 156 | Nudix homolog; nudix/MUTT-like fold, mixed alpha/b | 99.58 | |
| 3cng_A | 189 | Nudix hydrolase; structural genomics, APC7497, PSI | 99.58 | |
| 1q27_A | 171 | Putative nudix hydrolase DR0079; radiation resista | 99.57 | |
| 3gg6_A | 156 | Nudix motif 18, nucleoside diphosphate-linked moie | 99.56 | |
| 3son_A | 149 | Hypothetical nudix hydrolase; structural genomics, | 99.55 | |
| 3shd_A | 153 | Phosphatase NUDJ; nudix fold, nudix motif, hydrola | 99.55 | |
| 3o8s_A | 206 | Nudix hydrolase, ADP-ribose pyrophosphatase; struc | 99.53 | |
| 3f13_A | 163 | Putative nudix hydrolase family member; structural | 99.51 | |
| 3e57_A | 211 | Uncharacterized protein TM1382; structural genomic | 99.5 | |
| 2yyh_A | 139 | MUTT domain, 8-OXO-DGTPase domain; nudix family pr | 99.49 | |
| 2pqv_A | 154 | MUTT/nudix family protein; structu genomics, PSI-2 | 99.49 | |
| 1hzt_A | 190 | Isopentenyl diphosphate delta-isomerase; dimethyla | 99.46 | |
| 1f3y_A | 165 | Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase | 99.44 | |
| 3q1p_A | 205 | Phosphohydrolase (MUTT/nudix family protein); asym | 99.44 | |
| 3i9x_A | 187 | MUTT/nudix family protein; structural genomics, hy | 99.44 | |
| 1vk6_A | 269 | NADH pyrophosphatase; 1790429, structural genomics | 99.44 | |
| 2qjt_B | 352 | Nicotinamide-nucleotide adenylyltransferase; two i | 99.43 | |
| 2qjo_A | 341 | Bifunctional NMN adenylyltransferase/nudix hydrol; | 99.43 | |
| 2yvp_A | 182 | NDX2, MUTT/nudix family protein; nudix protein, AD | 99.41 | |
| 1v8y_A | 170 | ADP-ribose pyrophosphatase; nudix motif, loop-heli | 99.41 | |
| 3u53_A | 155 | BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; | 99.41 | |
| 2w4e_A | 145 | MUTT/nudix family protein; ADP-ribose pyrophosphat | 99.38 | |
| 3fcm_A | 197 | Hydrolase, nudix family; protein structure initiat | 99.36 | |
| 2fb1_A | 226 | Conserved hypothetical protein; structural genomic | 99.34 | |
| 2jvb_A | 146 | Protein PSU1, mRNA-decapping enzyme subunit 2; DCP | 99.32 | |
| 3gz5_A | 240 | MUTT/nudix family protein; DNA binding protein, nu | 99.31 | |
| 1vhz_A | 198 | ADP compounds hydrolase NUDE; structural genomics; | 99.29 | |
| 1mk1_A | 207 | ADPR pyrophosphatase; nudix hydrolase, adprase, ad | 99.29 | |
| 3h95_A | 199 | Nucleoside diphosphate-linked moiety X motif 6; NU | 99.25 | |
| 1u20_A | 212 | U8 snoRNA-binding protein X29; modified nudix hydr | 99.25 | |
| 2kdv_A | 164 | RNA pyrophosphohydrolase; nudix family, magnesium, | 99.21 | |
| 3fjy_A | 364 | Probable MUTT1 protein; dimer, protein structure i | 99.2 | |
| 2a6t_A | 271 | SPAC19A8.12; alpha/beta/alpha, RNA binding protein | 99.17 | |
| 2dho_A | 235 | Isopentenyl-diphosphate delta-isomerase 1; alpha/b | 99.14 | |
| 2fvv_A | 194 | Diphosphoinositol polyphosphate phosphohydrolase 1 | 99.13 | |
| 3kvh_A | 214 | Protein syndesmos; NUDT16-like, NUDT16L1, nudix, R | 99.1 | |
| 2pny_A | 246 | Isopentenyl-diphosphate delta-isomerase 2; caroten | 99.09 | |
| 1g0s_A | 209 | Hypothetical 23.7 kDa protein in ICC-TOLC intergen | 99.08 | |
| 3o6z_A | 191 | GDP-mannose pyrophosphatase NUDK; nudix, hydrolase | 99.08 | |
| 2fml_A | 273 | MUTT/nudix family protein; structural genomics, PS | 99.07 | |
| 2dsc_A | 212 | ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP | 98.95 | |
| 3q91_A | 218 | Uridine diphosphate glucose pyrophosphatase; struc | 98.92 | |
| 3qsj_A | 232 | Nudix hydrolase; structural genomics, PSI-biology, | 98.86 | |
| 3rh7_A | 321 | Hypothetical oxidoreductase; FMN-binding split bar | 98.85 | |
| 1q33_A | 292 | Pyrophosphatase, ADP-ribose pyrophosphatase; nudix | 98.78 | |
| 2xsq_A | 217 | U8 snoRNA-decapping enzyme; hydrolase, mRNA decapp | 98.65 | |
| 3bho_A | 208 | Cleavage and polyadenylation specificity factor su | 98.42 | |
| 3dup_A | 300 | MUTT/nudix family protein; nudix superfamily hydro | 98.37 | |
| 2jg6_A | 186 | DNA-3-methyladenine glycosidase; 3-methyladenine-D | 95.1 | |
| 2ofk_A | 183 | 3-methyladenine DNA glycosylase I, constitutive; D | 94.4 | |
| 3vdp_A | 212 | Recombination protein RECR; zinc finger, DNA repai | 91.8 | |
| 2edu_A | 98 | Kinesin-like protein KIF22; kinesin-like DNA bindi | 91.08 | |
| 1x2i_A | 75 | HEF helicase/nuclease; alpha helix, helix-hairpin- | 90.5 | |
| 2fmp_A | 335 | DNA polymerase beta; nucleotidyl transferase, tran | 90.5 | |
| 1vdd_A | 228 | Recombination protein RECR; helix-hairpin-helix, z | 90.04 | |
| 4glx_A | 586 | DNA ligase; inhibitor, ligase-ligase inhibitor-DNA | 89.89 | |
| 2ztd_A | 212 | Holliday junction ATP-dependent DNA helicase RUVA; | 89.54 | |
| 2duy_A | 75 | Competence protein comea-related protein; helix-ha | 89.27 | |
| 1z00_A | 89 | DNA excision repair protein ERCC-1; helix-hairpin- | 89.17 | |
| 1kft_A | 78 | UVRC, excinuclease ABC subunit C; helix-hairpin-he | 89.11 | |
| 2a1j_B | 91 | DNA excision repair protein ERCC-1; XPF, xeroderma | 89.1 | |
| 2a1j_A | 63 | DNA repair endonuclease XPF; XPF, xeroderma pigmen | 88.98 | |
| 1ixr_A | 191 | Holliday junction DNA helicase RUVA; heterooligome | 88.8 | |
| 1cuk_A | 203 | RUVA protein; DNA repair, SOS response, DNA-bindin | 87.91 | |
| 2fmp_A | 335 | DNA polymerase beta; nucleotidyl transferase, tran | 87.61 | |
| 2bcq_A | 335 | DNA polymerase lambda; misalignment, extrahelical, | 86.9 | |
| 3b0x_A | 575 | DNA polymerase beta family (X family); structural | 86.7 | |
| 2ihm_A | 360 | POL MU, DNA polymerase MU; helix-turn-helix, trans | 86.56 | |
| 2ihm_A | 360 | POL MU, DNA polymerase MU; helix-turn-helix, trans | 86.3 | |
| 1dgs_A | 667 | DNA ligase; AMP complex, NAD+-dependent; HET: DNA | 86.06 | |
| 1jms_A | 381 | Terminal deoxynucleotidyltransferase; polymerase; | 84.96 | |
| 1s5l_U | 134 | Photosystem II 12 kDa extrinsic protein; photosynt | 84.79 | |
| 2i5h_A | 205 | Hypothetical protein AF1531; PFAM:DUF655, PSI-2, s | 84.22 | |
| 3arc_U | 97 | Photosystem II 12 kDa extrinsic protein; PSII, mem | 83.93 | |
| 1s5l_U | 134 | Photosystem II 12 kDa extrinsic protein; photosynt | 83.92 | |
| 1jms_A | 381 | Terminal deoxynucleotidyltransferase; polymerase; | 83.8 | |
| 2a1j_A | 63 | DNA repair endonuclease XPF; XPF, xeroderma pigmen | 83.67 | |
| 3arc_U | 97 | Photosystem II 12 kDa extrinsic protein; PSII, mem | 83.67 | |
| 1z00_B | 84 | DNA repair endonuclease XPF; helix-hairpin-helix, | 83.57 | |
| 2duy_A | 75 | Competence protein comea-related protein; helix-ha | 83.1 | |
| 2owo_A | 671 | DNA ligase; protein-DNA complex, ligase-DNA comple | 82.42 | |
| 2kp7_A | 87 | Crossover junction endonuclease MUS81; helix-hairp | 81.93 |
| >3fsp_A A/G-specific adenine glycosylase; protein-DNA complex, DNA glycosylase, transition state analog, DNA repair; HET: NRI; 2.20A {Geobacillus stearothermophilus} PDB: 3fsq_A* 1rrs_A* 1vrl_A* 1rrq_A* 3g0q_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.2e-85 Score=636.66 Aligned_cols=348 Identities=44% Similarity=0.842 Sum_probs=331.7
Q ss_pred HHHHHHHHHHHHhhcCCCCCCCCCCChHHHHHHHHHhhhcchhhHHHHHHHHHHhCCCHHHHhcCCHHHHHHHHhccCch
Q psy9547 10 ILAFQESILTWYKQNARQLPWRESNNPYYVWISEVMLQQTQVKTVLPYYEKFIKTYPTIKDFAFDTEDNVLKMWEGLGYY 89 (363)
Q Consensus 10 ~~~~~~~l~~~~~~~~~~lpw~~~~dp~~~lv~~il~qqt~~~~v~~~~~~l~~~~pt~~~la~a~~~el~~~~~~lG~~ 89 (363)
...|.+.|++||+.++|++|||..+|||++||++||+|||++++|.+++.+|+++||||++|+++++++|.++|+++|||
T Consensus 13 ~~~~~~~l~~w~~~~~r~lpw~~~~~p~~~lv~~il~qqt~~~~~~~~~~~l~~~~pt~~~la~a~~~~l~~~i~~~G~~ 92 (369)
T 3fsp_A 13 AREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYY 92 (369)
T ss_dssp HHHHHHHHHHHHHHHCCCCGGGSCCCHHHHHHHHHHTTTSCHHHHHHHHHHHHHHCCSHHHHHTSCHHHHHHTTTTSSCT
T ss_pred HHHHHHHHHHHHHHhCCCCCCCCCCChHHHHHHHHHhccCcHHHHHHHHHHHHHHCCCHHHHHCCCHHHHHHHHHhcChH
Confidence 45699999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHhhHHhCCCCcccHHHHhcCCCCcHHHHHHHHHHhcCCccccccchHHHHHhhhcccccCcCCcccHHH
Q psy9547 90 SRVRNFQAGCRQVIEQFGGEVPRDKKQLLSIKGVGDYTAGALASICYNIPTPAVDGNVFRIYGRLFEIEDDISKGKTKVV 169 (363)
Q Consensus 90 ~rA~~l~~~a~~i~~~~~g~~p~~~~~L~~lpGIG~~tA~~il~~~~~~~~~~vD~~v~Rvl~Rl~~~~~~~~~~~~~~~ 169 (363)
+||++|+++|+.++++|+|++|+++++|++|||||+|||++||+|+||+|+++||+||.|+++|+|+++.++....+++.
T Consensus 93 ~ra~~l~~~a~~~~~~~~g~~p~~~~~L~~l~GIG~~tA~~il~~~~~~~~~~vD~~v~Rv~~rl~~~~~~~~~~~~~~~ 172 (369)
T 3fsp_A 93 SRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVDGNVMRVLSRLFLVTDDIAKPSTRKR 172 (369)
T ss_dssp HHHHHHHHHHHHHHHHHTTCCCCSHHHHHTSTTCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHTTCCSCTTSHHHHHH
T ss_pred HHHHHHHHHHHHHHHHcCCCChhHHHHHhcCCCcCHHHHHHHHHHHCCCCcccccHHHHHHHHHHcCcccCccccchHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999998876666678899
Q ss_pred HHHHHHhcCCcccHHHHHHHHHHHhhhhCcCCCCCCCCCCCcccChhhhcCCcccCCcccCCccccceeEEEEEEEeCCc
Q psy9547 170 YETLVSKTMSQTNAREFNQALMDLGATVCLFKNPKCKECPLSRFCSAYKNNTIENFPVKLGKTKVKDVFLLTVVVKTDTN 249 (363)
Q Consensus 170 ~~~~~~~~~p~~~~~~~~~~l~~~G~~~C~~~~P~C~~Cpl~~~C~~~~~~~~~~~p~k~~k~~~~~~~v~~~ii~~~~~ 249 (363)
+++.++.++|.+.+++||++||+||+++|+|++|+|+.|||++.|.++..+.+..+|+|++|++++.+.+++++|.+++|
T Consensus 173 ~~~~~~~~~p~~~~~~~~~~l~~~G~~~C~~~~P~C~~Cpl~~~C~~~~~~~~~~~PvK~~kk~~~~~~~~~~vi~~~~g 252 (369)
T 3fsp_A 173 FEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKMKKTAVKQVPLAVAVLADDEG 252 (369)
T ss_dssp HHHHHHHHCCSSSHHHHHHHHHHHHHHTSCSSSCCTTTCTTGGGCHHHHHTCGGGCSCCCCCCCCEEEEEEEEEEECSSS
T ss_pred HHHHHHHhCChhhHHHHHHHHHHHHHHhcCCCCCCCCCCCChhhhHHHhcCCcccCCccccccCcceEEEEEEEEEeCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999998889999999987779
Q ss_pred eEEEeecCCCccccccccccccCCCC-CchHHH-HHHHhhCCCcccccccccccEEEEccceEEEEEEEEEEecCCCCCC
Q psy9547 250 KYLIQKRPTTGLLSNFYMFLSFESDT-PYTSQV-EFLSENLPFKVNLNEKCLGNVKHVFSHLKWNMDVYSGTAKEKTIPA 327 (363)
Q Consensus 250 ~vLl~~R~~~~~~~glWEFPggk~e~-~~~~al-rEl~Eelgl~v~~~~~~l~~v~h~~sh~~~~l~~~~~~~~~~~~~~ 327 (363)
+||+.||+.+|+|+|+|+||||++|. ++++++ ||+.||+|+++.... .++.+.|.|+|+++++++|.++...+ ..+
T Consensus 253 ~vLL~rR~~~g~~~GlWefPGG~ve~gt~~~al~REl~EE~Gl~v~~~~-~l~~~~h~~~h~~~~~~~~~~~~~~~-~~e 330 (369)
T 3fsp_A 253 RVLIRKRDSTGLLANLWEFPSCETDGADGKEKLEQMVGEQYGLQVELTE-PIVSFEHAFSHLVWQLTVFPGRLVHG-GPV 330 (369)
T ss_dssp EEEEEECCSSSTTTTCEECCEEECSSSCTHHHHHHHHTTSSSCCEEECC-CCCEEEEECSSEEEEEEEEEEEECCS-SCC
T ss_pred EEEEEECCCCCCcCCcccCCCcccCCCCcHHHHHHHHHHHhCCceeeec-ccccEEEEcceEEEEEEEEEEEEcCC-CCC
Confidence 99999999999999999999999998 788999 999999999998888 89999999999999999999998763 557
Q ss_pred CCCCeeecccccCcCCCChHHHHHHHHHHhhh
Q psy9547 328 NKTYKLITETQMKKYAFPVPYQKVWKLFTKSK 359 (363)
Q Consensus 328 ~~~~~W~~~~el~~~~~~~a~~~il~~l~~~~ 359 (363)
+++++|++++++.++++|++++++++.+.+..
T Consensus 331 ~~~~~Wv~~~el~~~~l~~~~~~il~~l~~~~ 362 (369)
T 3fsp_A 331 EEPYRLAPEDELKAYAFPVSHQRVWREYKEWA 362 (369)
T ss_dssp CTTEEEEEGGGGGGSCCCHHHHHHHHHHHHHT
T ss_pred ccccEEeeHHHhhhCCCCHHHHHHHHHHHHHh
Confidence 78899999999999999999999999987654
|
| >3n5n_X A/G-specific adenine DNA glycosylase; alpha-helices, helix-hairpin-helix motif, iron-sulfur cluste hydrolase; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1kg2_A A/G-specific adenine glycosylase; DNA repair, hydrolase; 1.20A {Escherichia coli} SCOP: a.96.1.2 PDB: 1kg3_A 1muy_A 1kg6_A 1kg5_A 1mun_A 1mud_A 1kg4_A 1weg_A 1wei_A* 1wef_A* 1kg7_A 1kqj_A | Back alignment and structure |
|---|
| >1kea_A Possible G-T mismatches repair enzyme; DNA repair, DNA glycosylase, DNA mismatch, methylation; 2.00A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: a.96.1.2 | Back alignment and structure |
|---|
| >1orn_A Endonuclease III; DNA repair, DNA glycosylase, [4Fe-4S] cluster, iron-sulfur cluster, hydrolase/DNA complex; HET: PED; 1.70A {Geobacillus stearothermophilus} SCOP: a.96.1.1 PDB: 1orp_A* 1p59_A* | Back alignment and structure |
|---|
| >2abk_A Endonuclease III; DNA-repair, DNA glycosylase; 1.85A {Escherichia coli} SCOP: a.96.1.1 | Back alignment and structure |
|---|
| >1pu6_A 3-methyladenine DNA glycosylase; helix-hairpin-helix, base excision repair, hydrolase; HET: KCX; 1.64A {Helicobacter pylori} SCOP: a.96.1.5 PDB: 1pu7_A* 1pu8_A* | Back alignment and structure |
|---|
| >4e9f_A Methyl-CPG-binding domain protein 4; HHH DNA glycosylase family, hydrolase-DNA complex; HET: DNA 3DR; 1.79A {Homo sapiens} PDB: 4e9e_A* 4e9g_A* 4e9h_A* 4ea5_A* 4dk9_A* 1ngn_A 4ea4_A* 4ew4_A* 4evv_A* 4ew0_A* 3iho_A | Back alignment and structure |
|---|
| >3fhg_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase, hydrolase; 1.90A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4b21_A Probable DNA-3-methyladenine glycosylase 2; hydrolase-DNA complex, helix-hairpin-helix; HET: BGC 3DR; 1.45A {Schizosaccharomyces pombe} PDB: 4b22_A* 4b23_A* 4b24_A* | Back alignment and structure |
|---|
| >2h56_A DNA-3-methyladenine glycosidase; 10174367, EC 3.2.2.-, struc genomics, PSI-2, protein structure initiative, joint center structural genomics; 2.55A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3fhf_A Mjogg, N-glycosylase/DNA lyase, DNA-(apurinic; helix-hairpin-helix, 8-oxoguanine, 8-OXOG, DNA damage, DNA repair, glycosidase; 2.00A {Methanocaldococcus jannaschii} PDB: 3knt_A* | Back alignment and structure |
|---|
| >3n0u_A Probable N-glycosylase/DNA lyase; structural genomics, ISFI, DNA repair, 8-oxoguanine, base EX repair, PSI-2, protein structure initiative; 1.50A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2yg9_A DNA-3-methyladenine glycosidase II, putative; hydrolase, DNA repair; 1.95A {Deinococcus radiodurans} PDB: 2yg8_A | Back alignment and structure |
|---|
| >3s6i_A DNA-3-methyladenine glycosylase 1; DNA glycosylase, DNA repair, helix-hairpin-helix (HHH), ABAS tetrahydrofuran (THF); HET: 3DR; 2.28A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3i0w_A 8-oxoguanine-DNA-glycosylase; OGG, cacogg, DNA, 8-OXOG, 8OXOG, glycosylase, cytosine, hydrolase,lyase/DNA complex; HET: 8OG; 1.73A {Clostridium acetobutylicum} PDB: 3i0x_A* 3f10_A* 3f0z_A | Back alignment and structure |
|---|
| >2xhi_A N-glycosylase/DNA lyase; lyase-DNA complex, lyase/DNA complex, separation-OF-function helix-hairpin-helix, DNA repair; HET: 8OG; 1.55A {Homo sapiens} PDB: 1ko9_A 1lwy_A* 1hu0_A* 1lwv_A* 1lww_A* 2noe_A* 2noh_A* 2nol_A* 1n3c_A* 1fn7_A* 2noz_A* 1yqk_A 1yqr_A* 1yql_A* 1yqm_A* 2noi_A 1ebm_A* 1m3q_A* 1m3h_A* 1n39_A* ... | Back alignment and structure |
|---|
| >1mpg_A ALKA, 3-methyladenine DNA glycosylase II; DNA repair, base excision, methylation, ALK hydrolase; 1.80A {Escherichia coli} SCOP: a.96.1.3 d.129.1.2 PDB: 1diz_A 1pvs_A* 3cvs_A* 3cvt_A* 3cw7_A* 3cwa_A* 3cws_A* 3cwt_A* 3cwu_A* 3d4v_A* 3ogd_A* 3oh9_A* 3oh6_A* | Back alignment and structure |
|---|
| >2jhn_A ALKA, 3-methyladenine DNA-glycosylase; DNA repair, N1-methyladenine, N3-methylcytosine, hyperthermophiles, hydrolase; HET: MBO MES; 1.8A {Archaeoglobus fulgidus} PDB: 2jhj_A | Back alignment and structure |
|---|
| >1x51_A A/G-specific adenine DNA glycosylase; nudix domain, DNA repair, alpha-3 isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.113.1.3 | Back alignment and structure |
|---|
| >3ees_A Probable pyrophosphohydrolase; nudix, RNA pyrophosphohydrolase; 1.90A {Bdellovibrio bacteriovorus} PDB: 3eeu_A 3ef5_A* 3ffu_A* | Back alignment and structure |
|---|
| >2rrk_A ORF135, CTP pyrophosphohydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >1mut_A MUTT, nucleoside triphosphate pyrophosphohydrolase; DNA repair; NMR {Escherichia coli} SCOP: d.113.1.1 PDB: 1ppx_A* 1pun_A* 1puq_A* 1pus_A* 1tum_A* 3a6s_A* 3a6t_A* 3a6u_A* 3a6v_A* | Back alignment and structure |
|---|
| >3r03_A Nudix hydrolase; structural genomics, PSI2, protein structure INIT NEW YORK SGX research center for structural genomics, nysgx; HET: ADP; 2.49A {Rhodospirillum rubrum} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >3gwy_A Putative CTP pyrophosphohydrolase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Bacteroides fragilis} SCOP: d.113.1.0 | Back alignment and structure |
|---|
| >3hhj_A Mutator MUTT protein; niaid, ssgcid, decode, UW, SBRI, infectious diseases, hydrol structural genomics; 2.10A {Bartonella henselae} | Back alignment and structure |
|---|
| >3grn_A MUTT related protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 1.70A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3id9_A MUTT/nudix family protein; hydrolase, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.55A {Bacillus thuringiensis str} | Back alignment and structure |
|---|
| >3exq_A Nudix family hydrolase; protein structure initiative II(PSI II), NYSGXRC, 11180K, structural genomics; 2.00A {Lactobacillus brevis atcc 367} | Back alignment and structure |
|---|
| >3q93_A 7,8-dihydro-8-oxoguanine triphosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 1.80A {Homo sapiens} PDB: 1iry_A 3zr0_A* 3zr1_A | Back alignment and structure |
|---|
| >3oga_A Nucleoside triphosphatase NUDI; salmonella enterica subsp. enterica serovar typhimurium STR. unknown function; HET: PO4; 1.75A {Salmonella enterica subsp} PDB: 3n77_A | Back alignment and structure |
|---|
| >1vcd_A NDX1; nudix protein, diadenosine polyphosphate, AP6A, thermus THER HB8, hydrolase, riken structural genomics/proteomics initia RSGI; 1.70A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1vc8_A 1vc9_A* | Back alignment and structure |
|---|
| >2b06_A MUTT/nudix family protein; structural genomics, P protein structure initiative, midwest center for structural genomics, MCSG; 1.40A {Streptococcus pneumoniae} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >4dyw_A MUTT/nudix family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3i7u_A AP4A hydrolase; nudix protein, diadenosine polyphosphate, S genomics, NPPSFA, national project on protein structural AN functional analyses; HET: PGE PG4; 1.80A {Aquifex aeolicus} PDB: 3i7v_A* | Back alignment and structure |
|---|
| >2fkb_A Putative nudix hydrolase YFCD; putative protein, MAD, structural genomics, escherichia coli putative nudix hydrolase, PSI; HET: MSE; 2.00A {Escherichia coli K12} SCOP: d.113.1.2 | Back alignment and structure |
|---|
| >3fk9_A Mutator MUTT protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.50A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2azw_A MUTT/nudix family protein; MUTT/nudix ,enterococcus faecalis, structural genomics, PSI, structure initiative; HET: 1PE; 1.90A {Enterococcus faecalis} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >1rya_A GDP-mannose mannosyl hydrolase; GDP-glucose, nudix, nudix Mg-complex; HET: GDP; 1.30A {Escherichia coli} SCOP: d.113.1.5 PDB: 2gt2_A 2gt4_A* 2i8t_A* 2i8u_A* | Back alignment and structure |
|---|
| >1nqz_A COA pyrophosphatase (MUTT/nudix family protein); D.radiodurans, hydrolase; 1.70A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1nqy_A | Back alignment and structure |
|---|
| >2o1c_A DATP pyrophosphohydrolase; nudix NTP hydrolase NTP pyrophosphohydrolase MUTT dihydroneo triphosphate pyrophosphohydrolase folate biosynthesis; 1.80A {Escherichia coli} PDB: 2o5w_A | Back alignment and structure |
|---|
| >1sjy_A MUTT/nudix family protein; nudix fold, alpha-beta-alpha sandwich, structural genomics, BSGC structure funded by NIH; 1.39A {Deinococcus radiodurans} SCOP: d.113.1.1 PDB: 1soi_A 1su2_A* 1sz3_A* | Back alignment and structure |
|---|
| >1ktg_A Diadenosine tetraphosphate hydrolase; nudix, AMP, magnesium cluster; HET: AMP; 1.80A {Caenorhabditis elegans} SCOP: d.113.1.1 PDB: 1kt9_A* | Back alignment and structure |
|---|
| >2b0v_A Nudix hydrolase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, U function; 1.55A {Nitrosomonas europaea} SCOP: d.113.1.1 | Back alignment and structure |
|---|
| >3f6a_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.02A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1k2e_A Nudix homolog; nudix/MUTT-like fold, mixed alpha/beta, dimer, putative NUDI hydrolase, structural genomics, unknown function; 1.80A {Pyrobaculum aerophilum} SCOP: d.113.1.1 PDB: 1jrk_A 1k26_A | Back alignment and structure |
|---|
| >3cng_A Nudix hydrolase; structural genomics, APC7497, PSI-2, protei structure initiative; 2.00A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >1q27_A Putative nudix hydrolase DR0079; radiation resistance; NMR {Deinococcus radiodurans} SCOP: d.113.1.2 PDB: 2o5f_A | Back alignment and structure |
|---|
| >3gg6_A Nudix motif 18, nucleoside diphosphate-linked moiety X motif 18; NUDT18, NXR1, nucleotide hydrolase, hydrolase, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3son_A Hypothetical nudix hydrolase; structural genomics, joint center for structural GENO JCSG, protein structure initiative, PSI-biology; HET: MSE; 1.71A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3shd_A Phosphatase NUDJ; nudix fold, nudix motif, hydrolase, (D)NDP/(D)NTP binding, dephosphorylation; 2.50A {Escherichia coli} PDB: 3dku_A | Back alignment and structure |
|---|
| >3o8s_A Nudix hydrolase, ADP-ribose pyrophosphatase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.27A {Streptococcus suis} | Back alignment and structure |
|---|
| >3f13_A Putative nudix hydrolase family member; structural genomics, PSI-2, protein structure initiative; 1.70A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3e57_A Uncharacterized protein TM1382; structural genomics, nudix hydrolase, PSI-2, protein structure initiative; 1.89A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2yyh_A MUTT domain, 8-OXO-DGTPase domain; nudix family protein, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2pqv_A MUTT/nudix family protein; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 1.63A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1hzt_A Isopentenyl diphosphate delta-isomerase; dimethylallyl, isoprenoids; 1.45A {Escherichia coli} SCOP: d.113.1.2 PDB: 1hx3_A 1r67_A 1x84_A* 1x83_A* 1ppv_A* 1nfz_A* 1nfs_A* 1ppw_A* 1pvf_A 2veh_A* 2vej_A 2vnp_A* 2vnq_A 2g74_A 2g73_A* 2b2k_A 1i9a_A 1q54_A* 1ow2_A* 3hyq_A* | Back alignment and structure |
|---|
| >1f3y_A Diadenosine 5',5'''-P1,P4-tetraphosphate hydrolase; enzyme,mixed 4-stranded beta sheet, 2-stranded antiparallel sheet; NMR {Lupinus angustifolius} SCOP: d.113.1.1 PDB: 1jkn_A* | Back alignment and structure |
|---|
| >3q1p_A Phosphohydrolase (MUTT/nudix family protein); asymmetric dimer, RNA exonuclease, CDP-CHO pyrophosphatase; 1.80A {Bacillus cereus} PDB: 3q4i_A | Back alignment and structure |
|---|
| >3i9x_A MUTT/nudix family protein; structural genomics, hydrolase, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics; 2.20A {Listeria innocua} | Back alignment and structure |
|---|
| >1vk6_A NADH pyrophosphatase; 1790429, structural genomics, JCSG, PS protein structure initiative, joint center for structural G hydrolase; HET: MSE; 2.20A {Escherichia coli} SCOP: d.113.1.4 d.113.1.4 g.41.14.1 PDB: 2gb5_A | Back alignment and structure |
|---|
| >2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B | Back alignment and structure |
|---|
| >2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrol; two individual domains, hydrolase; HET: APR NAD; 2.60A {Synechocystis SP} | Back alignment and structure |
|---|
| >2yvp_A NDX2, MUTT/nudix family protein; nudix protein, ADP-ribose, FAD, hydrol structural genomics, NPPSFA; HET: RBY; 1.66A {Thermus thermophilus} PDB: 2yvn_A 2yvm_A* 2yvo_A* | Back alignment and structure |
|---|
| >1v8y_A ADP-ribose pyrophosphatase; nudix motif, loop-helix-loop, MUTT family, riken structural genomics/proteomics initiative, RSGI; HET: APR; 1.65A {Thermus thermophilus} SCOP: d.113.1.1 PDB: 1v8v_A* 1v8n_A 1v8l_A* 1v8m_A* 1v8i_A 1v8r_A* 1v8s_A* 1v8t_A* 1v8w_A 1v8u_A | Back alignment and structure |
|---|
| >3u53_A BIS(5'-nucleosyl)-tetraphosphatase [asymmetrical]; hydrolase; 2.71A {Homo sapiens} PDB: 1xsa_A 1xsb_A 1xsc_A* | Back alignment and structure |
|---|
| >2w4e_A MUTT/nudix family protein; ADP-ribose pyrophosphatase, hydrolase; 2.00A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3fcm_A Hydrolase, nudix family; protein structure initiative II(PSI II), NYSGXRC, 11180J, structural genomics; 2.20A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2fb1_A Conserved hypothetical protein; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG; 2.50A {Bacteroides thetaiotaomicron} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >2jvb_A Protein PSU1, mRNA-decapping enzyme subunit 2; DCP2, mRNA decay, cytoplasm, hydrolase, manganese, metal-binding, mRNA processing; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gz5_A MUTT/nudix family protein; DNA binding protein, nudix domain, WHTH domain; 2.20A {Shewanella oneidensis} PDB: 3gz6_A* 3gz8_A* | Back alignment and structure |
|---|
| >1vhz_A ADP compounds hydrolase NUDE; structural genomics; HET: APR; 2.32A {Escherichia coli} SCOP: d.113.1.1 PDB: 1vhg_A* | Back alignment and structure |
|---|
| >1mk1_A ADPR pyrophosphatase; nudix hydrolase, adprase, adenosine DI ribose, RV1700, hydrolase; HET: APR; 2.00A {Mycobacterium tuberculosis} SCOP: d.113.1.1 PDB: 1mp2_A 1mqe_A* 1mqw_A* 1mr2_A* | Back alignment and structure |
|---|
| >3h95_A Nucleoside diphosphate-linked moiety X motif 6; NUDT6, nudix, hydrolase, GFG, GFG-1, FGF2AS, structural GENO structural genomics consortium, SGC; HET: FLC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1u20_A U8 snoRNA-binding protein X29; modified nudix hydrolase fold, hydrolase; 2.10A {Xenopus laevis} SCOP: d.113.1.1 PDB: 2a8t_A* 2a8q_A* 2a8p_A* 2a8r_A* 2a8s_A* | Back alignment and structure |
|---|
| >2kdv_A RNA pyrophosphohydrolase; nudix family, magnesium, manganese, zinc; NMR {Escherichia coli} PDB: 2kdw_A | Back alignment and structure |
|---|
| >3fjy_A Probable MUTT1 protein; dimer, protein structure initiative II), NYSGXRC, 11181H, structural genomics; 2.15A {Bifidobacterium adolescentis atcc 1570ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2a6t_A SPAC19A8.12; alpha/beta/alpha, RNA binding protein,hydrolase; 2.50A {Schizosaccharomyces pombe} SCOP: a.242.1.1 d.113.1.7 PDB: 2qkm_B* | Back alignment and structure |
|---|
| >2dho_A Isopentenyl-diphosphate delta-isomerase 1; alpha/beta protein; 1.60A {Homo sapiens} PDB: 2i6k_A* 2icj_A 2ick_A* | Back alignment and structure |
|---|
| >2fvv_A Diphosphoinositol polyphosphate phosphohydrolase 1; nudix, inositol polyphosphate metabolism, structural genomics, structural genomics consortium; HET: IHP; 1.25A {Homo sapiens} SCOP: d.113.1.1 PDB: 2q9p_A* 2duk_A 3mcf_A* | Back alignment and structure |
|---|
| >3kvh_A Protein syndesmos; NUDT16-like, NUDT16L1, nudix, RNA regulation, RNA structural genomics consortium, SGC, RNA degradation, RNA B protein; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pny_A Isopentenyl-diphosphate delta-isomerase 2; carotenoid biosynthesis, cholesterol biosynthesis, isomerase isoprene biosynthesis, lipid synthesis; HET: GOL; 1.81A {Homo sapiens} | Back alignment and structure |
|---|
| >1g0s_A Hypothetical 23.7 kDa protein in ICC-TOLC intergenic region; nudix fold, hydrolase; 1.90A {Escherichia coli} SCOP: d.113.1.1 PDB: 1g9q_A* 1ga7_A 1khz_A* 1viq_A | Back alignment and structure |
|---|
| >3o6z_A GDP-mannose pyrophosphatase NUDK; nudix, hydrolase, biofilm; 2.05A {Escherichia coli} SCOP: d.113.1.1 PDB: 3o52_A* 1viu_A 3o69_A 3o61_A | Back alignment and structure |
|---|
| >2fml_A MUTT/nudix family protein; structural genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; 2.26A {Enterococcus faecalis} SCOP: a.4.5.68 d.113.1.6 | Back alignment and structure |
|---|
| >2dsc_A ADP-sugar pyrophosphatase; nudix domain, ADPR, ADP-ribose pyrophosphatase, NUDT5, hydrolase; HET: APR; 2.00A {Homo sapiens} PDB: 2dsd_A* 3bm4_A* 2dsb_A 3aca_A* 3ac9_A* 3l85_A* | Back alignment and structure |
|---|
| >3q91_A Uridine diphosphate glucose pyrophosphatase; structural genomics, structural genomics consortium, SGC, NU MUTT-like, hydrolase, magnesium binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3qsj_A Nudix hydrolase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3rh7_A Hypothetical oxidoreductase; FMN-binding split barrel, nudix, structural genomics, joint for structural genomics, JCSG; HET: FMN; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1q33_A Pyrophosphatase, ADP-ribose pyrophosphatase; nudix fold, hydrolase; HET: BGC; 1.81A {Homo sapiens} SCOP: d.113.1.1 PDB: 1qvj_A* | Back alignment and structure |
|---|
| >2xsq_A U8 snoRNA-decapping enzyme; hydrolase, mRNA decapping, mRNA turnover, structural genomic consortium, SGC; HET: IMP; 1.72A {Homo sapiens} PDB: 3cou_A 3mgm_A | Back alignment and structure |
|---|
| >3bho_A Cleavage and polyadenylation specificity factor subunit 5; CPSF5, RNA processing, cleavage factor, diadenosine tetraphosphate, mRNA processing; HET: B4P; 1.80A {Homo sapiens} PDB: 3bap_A 3mdg_A 3mdi_A 2cl3_A 3n9u_A 3q2s_A 3q2t_A 2j8q_A 3p5t_A 3p6y_A | Back alignment and structure |
|---|
| >3dup_A MUTT/nudix family protein; nudix superfamily hydrolase, hydrolase 3 family, structural protein structure initiative, PSI; HET: MSE; 1.80A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >2jg6_A DNA-3-methyladenine glycosidase; 3-methyladenine-DNA-glycosylase-I, hydrolase; 1.70A {Staphylococcus aureus} PDB: 4aia_A* 4ai5_A* 4ai4_A | Back alignment and structure |
|---|
| >2ofk_A 3-methyladenine DNA glycosylase I, constitutive; DNA repair, base excision, helix-hairpin-helix, hydrolase; HET: PGE; 1.50A {Salmonella typhi} PDB: 2ofi_A* 1lmz_A 1nku_A 1p7m_A* | Back alignment and structure |
|---|
| >3vdp_A Recombination protein RECR; zinc finger, DNA repair, DNA binding; 2.45A {Thermoanaerobacter tengcongensis} PDB: 3vdu_A 3ve5_D | Back alignment and structure |
|---|
| >2edu_A Kinesin-like protein KIF22; kinesin-like DNA binding domain, helix turn helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.60.2.7 | Back alignment and structure |
|---|
| >1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >2fmp_A DNA polymerase beta; nucleotidyl transferase, transferase/DNA complex; HET: DNA DOC DCT; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1bpx_A* 1bpz_A* 1mq2_A* 1mq3_A* 1bpy_A* 1tva_A* 1zjm_A* 1zjn_A* 1zqa_A* 1zqb_A* 1zqc_A* 1zqd_A* 1zqe_A* 1zqf_A* 1zqg_A* 1zqh_A* 1zqi_A* 1zqj_A* 1zqk_A* 1zql_A* ... | Back alignment and structure |
|---|
| >1vdd_A Recombination protein RECR; helix-hairpin-helix, zinc finger, toprim, walker B ATP binding motif; 2.50A {Deinococcus radiodurans} SCOP: e.49.1.1 PDB: 2v1c_A | Back alignment and structure |
|---|
| >4glx_A DNA ligase; inhibitor, ligase-ligase inhibitor-DNA complex; HET: DNA 0XS; 1.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2ztd_A Holliday junction ATP-dependent DNA helicase RUVA; recombination, branch migration, DNA BIND oligomerization, acidic PIN; 2.40A {Mycobacterium tuberculosis} PDB: 2ztc_A 2zte_A 2h5x_A 1bvs_A | Back alignment and structure |
|---|
| >2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} SCOP: a.60.2.7 | Back alignment and structure |
|---|
| >1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 | Back alignment and structure |
|---|
| >2a1j_B DNA excision repair protein ERCC-1; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 | Back alignment and structure |
|---|
| >2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* | Back alignment and structure |
|---|
| >1ixr_A Holliday junction DNA helicase RUVA; heterooligomeric complex, octameric RUVA, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.30A {Thermus thermophilus} SCOP: a.60.2.1 b.40.4.2 | Back alignment and structure |
|---|
| >1cuk_A RUVA protein; DNA repair, SOS response, DNA-binding, DNA recombination; 1.90A {Escherichia coli} SCOP: a.5.1.1 a.60.2.1 b.40.4.2 PDB: 1hjp_A 1bdx_A* 1c7y_A 1d8l_A | Back alignment and structure |
|---|
| >2fmp_A DNA polymerase beta; nucleotidyl transferase, transferase/DNA complex; HET: DNA DOC DCT; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1bpx_A* 1bpz_A* 1mq2_A* 1mq3_A* 1bpy_A* 1tva_A* 1zjm_A* 1zjn_A* 1zqa_A* 1zqb_A* 1zqc_A* 1zqd_A* 1zqe_A* 1zqf_A* 1zqg_A* 1zqh_A* 1zqi_A* 1zqj_A* 1zqk_A* 1zql_A* ... | Back alignment and structure |
|---|
| >2bcq_A DNA polymerase lambda; misalignment, extrahelical, mutagenesis, mutation, deletion, streisinger, slippage, transferase, lyase/DNA complex; HET: DNA; 1.65A {Homo sapiens} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1xsl_A* 2bcr_A* 2bcs_A* 2bcu_A* 2bcv_A* 2gws_A* 3c5g_A* 3c5f_A* 2pfn_A* 1xsp_A* 1xsn_A* 2pfo_A* 2pfp_A* 2pfq_A* 3hw8_A* 3hwt_A* 1rzt_A* 3hx0_A* 3mdc_A* 3mda_A* ... | Back alignment and structure |
|---|
| >3b0x_A DNA polymerase beta family (X family); structural genomics, riken structural genomics/proteomics in RSGI, polxc, PHP, DRP lyase; HET: DNA DGT; 1.36A {Thermus thermophilus} PDB: 3au2_A* 3au6_A* 3auo_A* 3b0y_A* | Back alignment and structure |
|---|
| >2ihm_A POL MU, DNA polymerase MU; helix-turn-helix, transferase/DNA complex; HET: DNA D3T; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2ihm_A POL MU, DNA polymerase MU; helix-turn-helix, transferase/DNA complex; HET: DNA D3T; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >1dgs_A DNA ligase; AMP complex, NAD+-dependent; HET: DNA AMP; 2.90A {Thermus filiformis} SCOP: a.60.2.2 b.40.4.6 d.142.2.2 PDB: 1v9p_A* | Back alignment and structure |
|---|
| >1jms_A Terminal deoxynucleotidyltransferase; polymerase; 2.36A {Mus musculus} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1kdh_A* 1kej_A* | Back alignment and structure |
|---|
| >1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} | Back alignment and structure |
|---|
| >2i5h_A Hypothetical protein AF1531; PFAM:DUF655, PSI-2, structural genomics, protein structure initiative; 1.74A {Archaeoglobus fulgidus} SCOP: e.71.1.1 | Back alignment and structure |
|---|
| >3arc_U Photosystem II 12 kDa extrinsic protein; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 3bz1_U* 2axt_U* 3bz2_U* 3kzi_U* 3prq_U* 3prr_U* 3a0b_U* 3a0h_U* | Back alignment and structure |
|---|
| >1s5l_U Photosystem II 12 kDa extrinsic protein; photosynthesis, oxygen-evolving, tetra- manganese, membrane; HET: CL1 PHO HEM PL9 LMT BCR; 3.50A {Thermosynechococcus elongatus} | Back alignment and structure |
|---|
| >1jms_A Terminal deoxynucleotidyltransferase; polymerase; 2.36A {Mus musculus} SCOP: a.60.6.1 a.60.12.1 d.218.1.2 PDB: 1kdh_A* 1kej_A* | Back alignment and structure |
|---|
| >2a1j_A DNA repair endonuclease XPF; XPF, xeroderma pigmentosum, DNA repair, endonuclease, helix-hairpin-helix, DNA binding protein; HET: DNA; 2.70A {Homo sapiens} SCOP: a.60.2.5 PDB: 2kn7_A* | Back alignment and structure |
|---|
| >3arc_U Photosystem II 12 kDa extrinsic protein; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 3bz1_U* 2axt_U* 3bz2_U* 3kzi_U* 3prq_U* 3prr_U* 3a0b_U* 3a0h_U* | Back alignment and structure |
|---|
| >1z00_B DNA repair endonuclease XPF; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 PDB: 2aq0_A* | Back alignment and structure |
|---|
| >2duy_A Competence protein comea-related protein; helix-hairpin-helix, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} SCOP: a.60.2.7 | Back alignment and structure |
|---|
| >2owo_A DNA ligase; protein-DNA complex, ligase-DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2kp7_A Crossover junction endonuclease MUS81; helix-hairpin-helix, tumour suppressor, DNA damage, DNA recombination, DNA repair, hydrolase, magnesium; NMR {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 363 | ||||
| d1rrqa1 | 221 | a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacil | 3e-58 | |
| d1kg2a_ | 224 | a.96.1.2 (A:) Catalytic domain of MutY {Escherichi | 5e-52 | |
| d1keaa_ | 217 | a.96.1.2 (A:) Thymine-DNA glycosylase {Archaeon Me | 2e-46 | |
| d1orna_ | 214 | a.96.1.1 (A:) Endonuclease III {Escherichia coli [ | 7e-43 | |
| d2abka_ | 211 | a.96.1.1 (A:) Endonuclease III {Escherichia coli [ | 1e-35 | |
| d1pu6a_ | 217 | a.96.1.5 (A:) 3-Methyladenine DNA glycosylase III | 5e-31 | |
| d1ngna_ | 144 | a.96.1.2 (A:) Mismatch-specific thymine glycosylas | 1e-28 | |
| d2noha1 | 190 | a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Hum | 5e-16 | |
| d1rrqa2 | 127 | d.113.1.3 (A:234-360) Adenine glycosylase MutY, C- | 4e-15 | |
| d1x51a1 | 142 | d.113.1.3 (A:8-149) A/G-specific adenine DNA glyco | 3e-12 |
| >d1rrqa1 a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]} Length = 221 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA-glycosylase superfamily: DNA-glycosylase family: Mismatch glycosylase domain: Catalytic domain of MutY species: Bacillus stearothermophilus [TaxId: 1422]
Score = 186 bits (473), Expect = 3e-58
Identities = 105/217 (48%), Positives = 146/217 (67%)
Query: 13 FQESILTWYKQNARQLPWRESNNPYYVWISEVMLQQTQVKTVLPYYEKFIKTYPTIKDFA 72
FQ +L W+ + R LPWR+ +PY VW+SEVMLQQT+V+TV+PY+E+FI +PT++ A
Sbjct: 5 FQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALA 64
Query: 73 FDTEDNVLKMWEGLGYYSRVRNFQAGCRQVIEQFGGEVPRDKKQLLSIKGVGDYTAGALA 132
ED VLK WEGLGYYSRVRN A ++V ++GG+VP D + +KGVG YT GA+
Sbjct: 65 DADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVL 124
Query: 133 SICYNIPTPAVDGNVFRIYGRLFEIEDDISKGKTKVVYETLVSKTMSQTNAREFNQALMD 192
S+ Y +P PAV+GNV R+ RLF + DDI+K T+ +E +V + M+ N FN+AL++
Sbjct: 125 SLAYGVPEPAVNGNVMRVLSRLFLVTDDIAKCSTRKRFEQIVREIMAYENPGAFNEALIE 184
Query: 193 LGATVCLFKNPKCKECPLSRFCSAYKNNTIENFPVKL 229
LGA VC + P C CP+ +C A+ E PVK+
Sbjct: 185 LGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVKM 221
|
| >d1kg2a_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]} Length = 224 | Back information, alignment and structure |
|---|
| >d1keaa_ a.96.1.2 (A:) Thymine-DNA glycosylase {Archaeon Methanobacterium thermoformicicum [TaxId: 145262]} Length = 217 | Back information, alignment and structure |
|---|
| >d1orna_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} Length = 214 | Back information, alignment and structure |
|---|
| >d2abka_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} Length = 211 | Back information, alignment and structure |
|---|
| >d1pu6a_ a.96.1.5 (A:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori [TaxId: 210]} Length = 217 | Back information, alignment and structure |
|---|
| >d1ngna_ a.96.1.2 (A:) Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 144 | Back information, alignment and structure |
|---|
| >d2noha1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} Length = 190 | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Length = 127 | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 363 | |||
| d1rrqa1 | 221 | Catalytic domain of MutY {Bacillus stearothermophi | 100.0 | |
| d1kg2a_ | 224 | Catalytic domain of MutY {Escherichia coli [TaxId: | 100.0 | |
| d1keaa_ | 217 | Thymine-DNA glycosylase {Archaeon Methanobacterium | 100.0 | |
| d1orna_ | 214 | Endonuclease III {Escherichia coli [TaxId: 562]} | 100.0 | |
| d2abka_ | 211 | Endonuclease III {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1pu6a_ | 217 | 3-Methyladenine DNA glycosylase III (MagIII) {Heli | 100.0 | |
| d1rrqa2 | 127 | Adenine glycosylase MutY, C-terminal domain {Bacil | 99.96 | |
| d1ngna_ | 144 | Mismatch-specific thymine glycosylase domain of th | 99.96 | |
| d2noha1 | 190 | 8-oxoguanine glycosylase {Human (Homo sapiens) [Ta | 99.94 | |
| d1x51a1 | 142 | A/G-specific adenine DNA glycosylase {Human (Homo | 99.93 | |
| d1puna_ | 129 | Nucleoside triphosphate pyrophosphorylase (MutT) { | 99.93 | |
| d1mpga1 | 183 | 3-Methyladenine DNA glycosylase II (gene alkA or a | 99.9 | |
| d1irya_ | 156 | 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Hum | 99.69 | |
| d2b06a1 | 155 | Hypothetical protein SP1235 (spr1115) {Streptococc | 99.68 | |
| d1vcda1 | 126 | AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: | 99.64 | |
| d1vk6a2 | 131 | NADH pyrophosphatase {Escherichia coli [TaxId: 562 | 99.59 | |
| d2b0va1 | 146 | Hypothetical protein NE0184 {Nitrosomonas europaea | 99.52 | |
| d1sjya_ | 158 | Hypothetical protein DR1025 {Deinococcus radiodura | 99.46 | |
| d1k2ea_ | 152 | Hypothetical protein PAE3301 {Archaeon Pyrobaculum | 99.46 | |
| d2fkba1 | 161 | Hypothetical protein YfcD {Escherichia coli [TaxId | 99.46 | |
| d1ryaa_ | 160 | GDP-mannose mannosyl hydrolase NudD {Escherichia c | 99.44 | |
| d2fb1a2 | 147 | Hypothetical protein BT0354, N-terminal domain {Ba | 99.4 | |
| d1jkna_ | 165 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.39 | |
| d2azwa1 | 147 | Hypothetical protein EF1141 {Enterococcus faecalis | 99.38 | |
| d2a6ta2 | 151 | mRNA decapping enzyme Dcp2p catalytic domain {Schi | 99.36 | |
| d1hzta_ | 153 | Isopentenyl diphosphate isomerase {Escherichia col | 99.31 | |
| d1ktga_ | 137 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.31 | |
| d1nqza_ | 187 | Coenzyme A pyrophosphatase {Deinococcus radioduran | 99.31 | |
| d2o5fa1 | 162 | Hypothetical protein DR0079 {Deinococcus radiodura | 99.29 | |
| d2fvva1 | 135 | Diphosphoinositol polyphosphate phosphohydrolase { | 99.29 | |
| d1xsba_ | 153 | Diadenosine tetraphosphate hydrolase (Ap4A hydrola | 99.25 | |
| d2fmla2 | 202 | Hypothetical protein EF2700, N-terminal domain {En | 99.14 | |
| d1v8ya_ | 158 | ADP-ribose pyrophosphatase {Thermus thermophilus [ | 99.03 | |
| d1vhza_ | 186 | ADP compounds hydrolase NudE {Escherichia coli [Ta | 98.87 | |
| d1mqea_ | 202 | ADP-ribose pyrophosphatase {Mycobacterium tubercul | 98.81 | |
| d1u20a1 | 196 | U8 snorna-binding protein x29 {African clawed frog | 98.73 | |
| d1g0sa_ | 209 | ADP-ribose pyrophosphatase {Escherichia coli [TaxI | 98.33 | |
| d1q33a_ | 292 | NUDT9 (mitochondrial ADP-ribose pyrophosphatase) { | 98.27 | |
| d1viua_ | 189 | ADP-ribose pyrophosphatase homologue YffH {Escheri | 97.81 | |
| d2fmpa1 | 82 | DNA polymerase beta, N-terminal (8 kD)-domain {Hum | 95.45 | |
| d1bvsa2 | 71 | DNA helicase RuvA subunit, middle domain {Mycobact | 95.02 | |
| d2bcqa1 | 76 | DNA polymerase lambda {Human (Homo sapiens) [TaxId | 94.9 | |
| d1cuka2 | 78 | DNA helicase RuvA subunit, middle domain {Escheric | 94.54 | |
| d1ixra1 | 73 | DNA helicase RuvA subunit, middle domain {Thermus | 94.54 | |
| d2i1qa1 | 60 | DNA repair protein Rad51, N-terminal domain {Archa | 94.49 | |
| d1x2ia1 | 68 | ATP-dependent RNA helicase PF2015 {Pyrococcus furi | 94.27 | |
| d1kfta_ | 56 | Excinuclease UvrC C-terminal domain {Escherichia c | 94.27 | |
| d1nkua_ | 187 | 3-Methyladenine DNA glycosylase I (Tag) {Escherich | 94.05 | |
| d1jmsa1 | 95 | Terminal deoxynucleotidyl transferase {Mouse (Mus | 93.52 | |
| d1dgsa1 | 181 | NAD+-dependent DNA ligase, domain 3 {Thermus filif | 93.29 | |
| d2bgwa1 | 70 | DNA repair endonuclease XPF {Aeropyrum pernix [Tax | 92.92 | |
| d1pzna1 | 61 | DNA repair protein Rad51, N-terminal domain {Archa | 92.41 | |
| d2a1ja1 | 62 | DNA repair endonuclease XPF {Human (Homo sapiens) | 92.18 | |
| d1bvsa2 | 71 | DNA helicase RuvA subunit, middle domain {Mycobact | 91.75 | |
| d1vdda_ | 199 | Recombination protein RecR {Deinococcus radioduran | 90.66 | |
| d2duya1 | 65 | Uncharacterized protein TTHA1967 {Thermus thermoph | 90.31 | |
| d2edua1 | 91 | KIF22, C-terminal domain {Human (Homo sapiens) [Ta | 89.92 | |
| d2a1jb1 | 78 | DNA excision repair protein ERCC-1 {Human (Homo sa | 89.29 | |
| d1ixra1 | 73 | DNA helicase RuvA subunit, middle domain {Thermus | 88.77 | |
| d1cuka2 | 78 | DNA helicase RuvA subunit, middle domain {Escheric | 88.67 | |
| d1pzna1 | 61 | DNA repair protein Rad51, N-terminal domain {Archa | 88.03 | |
| d2a1ja1 | 62 | DNA repair endonuclease XPF {Human (Homo sapiens) | 87.72 | |
| d3bzka1 | 90 | Transcriptional accessory factor Tex {Pseudomonas | 86.96 | |
| d2edua1 | 91 | KIF22, C-terminal domain {Human (Homo sapiens) [Ta | 86.47 | |
| d2axtu1 | 98 | Photosystem II 12 kDa extrinsic protein PsbU {Ther | 85.37 | |
| d2i1qa1 | 60 | DNA repair protein Rad51, N-terminal domain {Archa | 84.84 | |
| d1szpa1 | 64 | DNA repair protein Rad51, N-terminal domain {Baker | 84.7 | |
| d2bgwa1 | 70 | DNA repair endonuclease XPF {Aeropyrum pernix [Tax | 84.24 | |
| d3bzka1 | 90 | Transcriptional accessory factor Tex {Pseudomonas | 83.57 | |
| d1kfta_ | 56 | Excinuclease UvrC C-terminal domain {Escherichia c | 83.56 | |
| d1jmsa3 | 60 | Terminal deoxynucleotidyl transferase {Mouse (Mus | 82.83 | |
| d2axtu1 | 98 | Photosystem II 12 kDa extrinsic protein PsbU {Ther | 82.65 | |
| d2fmpa2 | 57 | DNA polymerase beta {Human (Homo sapiens) [TaxId: | 82.57 | |
| d1wuda1 | 77 | HRDC domain from RecQ helicase {Escherichia coli [ | 82.52 | |
| d2a1jb1 | 78 | DNA excision repair protein ERCC-1 {Human (Homo sa | 80.67 |
| >d1rrqa1 a.96.1.2 (A:9-229) Catalytic domain of MutY {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA-glycosylase superfamily: DNA-glycosylase family: Mismatch glycosylase domain: Catalytic domain of MutY species: Bacillus stearothermophilus [TaxId: 1422]
Probab=100.00 E-value=1.3e-60 Score=429.39 Aligned_cols=218 Identities=48% Similarity=0.967 Sum_probs=211.5
Q ss_pred HHHHHHHHHHHhhcCCCCCCCCCCChHHHHHHHHHhhhcchhhHHHHHHHHHHhCCCHHHHhcCCHHHHHHHHhccCchH
Q psy9547 11 LAFQESILTWYKQNARQLPWRESNNPYYVWISEVMLQQTQVKTVLPYYEKFIKTYPTIKDFAFDTEDNVLKMWEGLGYYS 90 (363)
Q Consensus 11 ~~~~~~l~~~~~~~~~~lpw~~~~dp~~~lv~~il~qqt~~~~v~~~~~~l~~~~pt~~~la~a~~~el~~~~~~lG~~~ 90 (363)
++|++.|+.||..++|+||||..+|||++||++||||||++++|.+++.+|+++|||+++|+++++++|+++|+++|||+
T Consensus 3 k~~~~~l~~wy~~~~r~lpWr~~~dp~~vLV~~iLsqqT~~~~v~~~~~~L~~~~~t~~~la~a~~~~l~~~i~~~G~~~ 82 (221)
T d1rrqa1 3 REFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIPYFEQFIDRFPTLEALADADEDEVLKAWEGLGYYS 82 (221)
T ss_dssp HHHHHHHHHHHHHHCCCCGGGSCCCHHHHHHHHHHHTTSCHHHHHHHHHHHHHHSCSHHHHHHSCHHHHHHHHTTSSCTH
T ss_pred HHHHHHHHHHHHhcCCCCCCCCCCCHHHHHHHHHHHhhCcHHHHHHHHHHHHHhcchHHHHHhhcHHHHHhhhccchhhh
Confidence 57999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHhhHHhCCCCcccHHHHhcCCCCcHHHHHHHHHHhcCCccccccchHHHHHhhhcccccCcCCcccHHHH
Q psy9547 91 RVRNFQAGCRQVIEQFGGEVPRDKKQLLSIKGVGDYTAGALASICYNIPTPAVDGNVFRIYGRLFEIEDDISKGKTKVVY 170 (363)
Q Consensus 91 rA~~l~~~a~~i~~~~~g~~p~~~~~L~~lpGIG~~tA~~il~~~~~~~~~~vD~~v~Rvl~Rl~~~~~~~~~~~~~~~~ 170 (363)
||+++++.+..++++|+|.+|.++++|++|||||+|||++||+|+||+|+++||+||.||++|+++++.+.....+.+.+
T Consensus 83 ra~~l~~~~~~~~~~~~G~vp~~~~~Ll~LpGIG~kTA~~il~~a~~~p~~~VDt~v~Rv~~Rl~~~~~~~~~~~~~~~~ 162 (221)
T d1rrqa1 83 RVRNLHAAVKEVKTRYGGKVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVNGNVMRVLSRLFLVTDDIAKCSTRKRF 162 (221)
T ss_dssp HHHHHHHHHHHHHHHHTTCCCCSHHHHHTSTTCCHHHHHHHHHHHTCCCCCCCCHHHHHHHHHHTTCCSCTTSTTHHHHH
T ss_pred hhHHHHHHHHHHhhhcCCCCchHHHHHHHHHHhhhHHHHHHHHHHhcCcccccCccHHHHHHHhhccCCCchhhhHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999988776666778888
Q ss_pred HHHHHhcCCcccHHHHHHHHHHHhhhhCcCCCCCCCCCCCcccChhhhcCCcccCCcc
Q psy9547 171 ETLVSKTMSQTNAREFNQALMDLGATVCLFKNPKCKECPLSRFCSAYKNNTIENFPVK 228 (363)
Q Consensus 171 ~~~~~~~~p~~~~~~~~~~l~~~G~~~C~~~~P~C~~Cpl~~~C~~~~~~~~~~~p~k 228 (363)
+..+..++|.+.++++|++||+||+.+|+|++|+|+.|||++.|++|+.+.++.+|+|
T Consensus 163 ~~~~~~~~~~~~~~~~~~~l~~~G~~iC~~~~P~C~~Cpl~~~C~~~~~~~~~~~P~k 220 (221)
T d1rrqa1 163 EQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLCPVQAYCQAFAEGVAEELPVK 220 (221)
T ss_dssp HHHHHHHCCTTCHHHHHHHHHHHHHHTSCSSSCCGGGCTTGGGCHHHHTTCTTTCSCC
T ss_pred HHhhhhhhhcccchHHHHHHHHHHHHHcCCCCCCCCCCcChhhCHHhhcCCchhcCCC
Confidence 9999999999999999999999999999999999999999999999999999999986
|
| >d1kg2a_ a.96.1.2 (A:) Catalytic domain of MutY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1keaa_ a.96.1.2 (A:) Thymine-DNA glycosylase {Archaeon Methanobacterium thermoformicicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1orna_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2abka_ a.96.1.1 (A:) Endonuclease III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pu6a_ a.96.1.5 (A:) 3-Methyladenine DNA glycosylase III (MagIII) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1rrqa2 d.113.1.3 (A:234-360) Adenine glycosylase MutY, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ngna_ a.96.1.2 (A:) Mismatch-specific thymine glycosylase domain of the methyl-GpG binding protein mbd4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2noha1 a.96.1.3 (A:136-325) 8-oxoguanine glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x51a1 d.113.1.3 (A:8-149) A/G-specific adenine DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puna_ d.113.1.1 (A:) Nucleoside triphosphate pyrophosphorylase (MutT) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mpga1 a.96.1.3 (A:100-282) 3-Methyladenine DNA glycosylase II (gene alkA or aidA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1irya_ d.113.1.1 (A:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b06a1 d.113.1.1 (A:1-155) Hypothetical protein SP1235 (spr1115) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1vcda1 d.113.1.1 (A:1-126) AP6A hydrolase Ndx1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vk6a2 d.113.1.4 (A:126-256) NADH pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b0va1 d.113.1.1 (A:4-149) Hypothetical protein NE0184 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1sjya_ d.113.1.1 (A:) Hypothetical protein DR1025 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1k2ea_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2fkba1 d.113.1.2 (A:8-168) Hypothetical protein YfcD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ryaa_ d.113.1.5 (A:) GDP-mannose mannosyl hydrolase NudD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fb1a2 d.113.1.6 (A:3-149) Hypothetical protein BT0354, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1jkna_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Narrow-leaved blue lupine (Lupinus angustifolius) [TaxId: 3871]} | Back information, alignment and structure |
|---|
| >d2azwa1 d.113.1.1 (A:2-148) Hypothetical protein EF1141 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2a6ta2 d.113.1.7 (A:95-245) mRNA decapping enzyme Dcp2p catalytic domain {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1hzta_ d.113.1.2 (A:) Isopentenyl diphosphate isomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ktga_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nqza_ d.113.1.1 (A:) Coenzyme A pyrophosphatase {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2o5fa1 d.113.1.2 (A:7-168) Hypothetical protein DR0079 {Deinococcus radiodurans str. R1 (Deinococcus radiodurans R1) [TaxId: 243230]} | Back information, alignment and structure |
|---|
| >d2fvva1 d.113.1.1 (A:8-142) Diphosphoinositol polyphosphate phosphohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xsba_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fmla2 d.113.1.6 (A:3-204) Hypothetical protein EF2700, N-terminal domain {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1v8ya_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vhza_ d.113.1.1 (A:) ADP compounds hydrolase NudE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mqea_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u20a1 d.113.1.1 (A:14-209) U8 snorna-binding protein x29 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1g0sa_ d.113.1.1 (A:) ADP-ribose pyrophosphatase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q33a_ d.113.1.1 (A:) NUDT9 (mitochondrial ADP-ribose pyrophosphatase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viua_ d.113.1.1 (A:) ADP-ribose pyrophosphatase homologue YffH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fmpa1 a.60.6.1 (A:10-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d2bcqa1 a.60.6.1 (A:252-327) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1x2ia1 a.60.2.5 (A:2-69) ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nkua_ a.96.1.4 (A:) 3-Methyladenine DNA glycosylase I (Tag) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jmsa1 a.60.6.1 (A:148-242) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1dgsa1 a.60.2.2 (A:401-581) NAD+-dependent DNA ligase, domain 3 {Thermus filiformis [TaxId: 276]} | Back information, alignment and structure |
|---|
| >d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bvsa2 a.60.2.1 (A:64-134) DNA helicase RuvA subunit, middle domain {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d1vdda_ e.49.1.1 (A:) Recombination protein RecR {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2duya1 a.60.2.7 (A:11-75) Uncharacterized protein TTHA1967 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixra1 a.60.2.1 (A:63-135) DNA helicase RuvA subunit, middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cuka2 a.60.2.1 (A:65-142) DNA helicase RuvA subunit, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna1 a.60.4.1 (A:35-95) DNA repair protein Rad51, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2edua1 a.60.2.7 (A:8-98) KIF22, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} | Back information, alignment and structure |
|---|
| >d2i1qa1 a.60.4.1 (A:5-64) DNA repair protein Rad51, N-terminal domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1szpa1 a.60.4.1 (A:81-144) DNA repair protein Rad51, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bgwa1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d3bzka1 a.60.2.6 (A:474-563) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kfta_ a.60.2.3 (A:) Excinuclease UvrC C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jmsa3 a.60.12.1 (A:243-302) Terminal deoxynucleotidyl transferase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2axtu1 a.60.12.2 (U:37-134) Photosystem II 12 kDa extrinsic protein PsbU {Thermosynechococcus elongatus [TaxId: 146786]} | Back information, alignment and structure |
|---|
| >d2fmpa2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wuda1 a.60.8.1 (A:530-606) HRDC domain from RecQ helicase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|