Psyllid ID: psy9679


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MLVNPNGKMIHYVPRPVDAVVSESSSSTQHNHRKSNSLDASSASSPVASDPNNRKPKPQPVPTVRERFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVESF
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccEEEEEEEccccEEEEEEcccccEEEEccccEEEc
ccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccHEEcccccEEEEEEEcccccEEEcccccccEEEccccHEEcc
mlvnpngkmihyvprpvdavvsesssstqhnhrksnsldassasspvasdpnnrkpkpqpvptvrerfrcivpyppnseyeLELRVGDLIYVhkkrddgwykgtlqrtgrtglfpasfvesf
mlvnpngkmihyvprPVDAVVSESSsstqhnhrksnsldassasspvasdpnnrkpkpqpvptvrerfRCIVpyppnseyeleLRVGDLIYVHkkrddgwykgtlqrtgrtglfpasfvesf
MLVNPNGKMIHYVPRPVDAVVSESSSSTQHNHRKsnsldassasspvasdpnnRKPKPQPVPTVRERFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVESF
****************************************************************RERFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFP*******
*******************************************************************FRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVESF
MLVNPNGKMIHYVPRPVDA******************************************PTVRERFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVESF
******GKMIHY**************************************************TVRERFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVESF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVNPNGKMIHYVPRPVDAVVSESSSSTQHNHRKSNSLDASSASSPVASDPNNRKPKPQPVPTVRERFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVESF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query122 2.2.26 [Sep-21-2011]
Q8C120878 SH3 domain-containing RIN yes N/A 0.729 0.101 0.563 6e-25
Q8TEJ3882 SH3 domain-containing RIN yes N/A 0.672 0.092 0.571 1e-24
Q5RBR0888 E3 ubiquitin-protein liga yes N/A 0.852 0.117 0.491 1e-23
Q7Z6J0888 E3 ubiquitin-protein liga no N/A 0.852 0.117 0.491 1e-23
Q69ZI1892 E3 ubiquitin-protein liga no N/A 0.721 0.098 0.541 6e-23
Q71F54894 E3 ubiquitin-protein liga no N/A 0.721 0.098 0.541 8e-23
A5D7F8840 E3 ubiquitin-protein liga no N/A 0.745 0.108 0.521 1e-21
A5D8S5867 E3 ubiquitin-protein liga yes N/A 0.418 0.058 0.688 1e-21
Q28E95861 E3 ubiquitin-protein liga no N/A 0.885 0.125 0.445 3e-21
Q6NRD3826 E3 ubiquitin-protein liga N/A N/A 0.762 0.112 0.467 2e-20
>sp|Q8C120|SH3R3_MOUSE SH3 domain-containing RING finger protein 3 OS=Mus musculus GN=Sh3rf3 PE=2 SV=2 Back     alignment and function desciption
 Score =  112 bits (280), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 70/94 (74%), Gaps = 5/94 (5%)

Query: 32  HRKSNSLDASSASSP---VASDPNNRKPKPQPVPTVRERFRCIVPYPPNSEYELELRVGD 88
           HRK+ SLD + + SP         + +P+P+P+P  RER+R +V YPP SE E+EL+ GD
Sbjct: 787 HRKAGSLDLNFSLSPSRQATLSMASIRPEPKPLP--RERYRVVVSYPPQSEAEIELKEGD 844

Query: 89  LIYVHKKRDDGWYKGTLQRTGRTGLFPASFVESF 122
           +++VHKK +DGW+KGTLQR GRTGLFP SFVESF
Sbjct: 845 IVFVHKKHEDGWFKGTLQRNGRTGLFPGSFVESF 878





Mus musculus (taxid: 10090)
>sp|Q8TEJ3|SH3R3_HUMAN SH3 domain-containing RING finger protein 3 OS=Homo sapiens GN=SH3RF3 PE=1 SV=2 Back     alignment and function description
>sp|Q5RBR0|SH3R1_PONAB E3 ubiquitin-protein ligase SH3RF1 OS=Pongo abelii GN=SH3RF1 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z6J0|SH3R1_HUMAN E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens GN=SH3RF1 PE=1 SV=2 Back     alignment and function description
>sp|Q69ZI1|SH3R1_MOUSE E3 ubiquitin-protein ligase SH3RF1 OS=Mus musculus GN=Sh3rf1 PE=1 SV=2 Back     alignment and function description
>sp|Q71F54|SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus GN=Sh3rf1 PE=1 SV=1 Back     alignment and function description
>sp|A5D7F8|SH3R1_BOVIN E3 ubiquitin-protein ligase SH3RF1 OS=Bos taurus GN=SH3RF1 PE=2 SV=1 Back     alignment and function description
>sp|A5D8S5|SH3R1_DANRE E3 ubiquitin-protein ligase SH3RF1 OS=Danio rerio GN=sh3rf1 PE=2 SV=2 Back     alignment and function description
>sp|Q28E95|SH3R1_XENTR E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus tropicalis GN=sh3rf1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NRD3|SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis GN=sh3rf1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
427788663 905 Putative e3 ubiquitin-protein ligase [Rh 0.754 0.101 0.653 2e-30
157110169 771 Plenty of SH3s, putative [Aedes aegypti] 0.704 0.111 0.707 3e-29
350415760 894 PREDICTED: SH3 domain-containing RING fi 0.655 0.089 0.673 6e-29
350415763 888 PREDICTED: SH3 domain-containing RING fi 0.655 0.090 0.673 6e-29
340728739 894 PREDICTED: LOW QUALITY PROTEIN: putative 0.655 0.089 0.673 6e-29
350415757 838 PREDICTED: SH3 domain-containing RING fi 0.655 0.095 0.673 7e-29
345487941 908 PREDICTED: SH3 domain-containing RING fi 0.721 0.096 0.643 2e-28
383851890 894 PREDICTED: SH3 domain-containing RING fi 0.655 0.089 0.673 2e-28
383851892 888 PREDICTED: SH3 domain-containing RING fi 0.655 0.090 0.673 2e-28
307195492 917 SH3 domain-containing RING finger protei 0.680 0.090 0.673 5e-28
>gi|427788663|gb|JAA59783.1| Putative e3 ubiquitin-protein ligase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 77/101 (76%), Gaps = 9/101 (8%)

Query: 22  SESSSSTQHNHRKSNSLDASSASSPVASDPNNRKPKPQPVPTVRERFRCIVPYPPNSEYE 81
           SE   S Q  H+K++SLD +        D    +PK QP P VRERFRCIVPYPPNSEYE
Sbjct: 814 SEVLGSQQALHKKTSSLDGN--------DSLKARPK-QPAPLVRERFRCIVPYPPNSEYE 864

Query: 82  LELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVESF 122
           LEL+ GD++YVHKKR+DGW+KGTLQRTG+TGLFP SFVESF
Sbjct: 865 LELKQGDVVYVHKKREDGWFKGTLQRTGKTGLFPGSFVESF 905




Source: Rhipicephalus pulchellus

Species: Rhipicephalus pulchellus

Genus: Rhipicephalus

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157110169|ref|XP_001650981.1| Plenty of SH3s, putative [Aedes aegypti] gi|108883932|gb|EAT48157.1| AAEL000763-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|350415760|ref|XP_003490742.1| PREDICTED: SH3 domain-containing RING finger protein 3-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|350415763|ref|XP_003490743.1| PREDICTED: SH3 domain-containing RING finger protein 3-like isoform 3 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340728739|ref|XP_003402674.1| PREDICTED: LOW QUALITY PROTEIN: putative E3 ubiquitin-protein ligase SH3RF1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350415757|ref|XP_003490741.1| PREDICTED: SH3 domain-containing RING finger protein 3-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|345487941|ref|XP_001606578.2| PREDICTED: SH3 domain-containing RING finger protein 3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383851890|ref|XP_003701464.1| PREDICTED: SH3 domain-containing RING finger protein 3-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383851892|ref|XP_003701465.1| PREDICTED: SH3 domain-containing RING finger protein 3-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307195492|gb|EFN77378.1| SH3 domain-containing RING finger protein 3 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
UNIPROTKB|F1PBV0882 SH3RF3 "Uncharacterized protei 0.540 0.074 0.696 3.8e-23
UNIPROTKB|F1N2S5844 SH3RF3 "Uncharacterized protei 0.540 0.078 0.691 6.6e-23
UNIPROTKB|Q8TEJ3882 SH3RF3 "SH3 domain-containing 0.540 0.074 0.676 5.5e-22
MGI|MGI:2444637878 Sh3rf3 "SH3 domain containing 0.540 0.075 0.661 2e-21
UNIPROTKB|F1NYR2892 SH3RF1 "Uncharacterized protei 0.491 0.067 0.683 2.6e-19
RGD|735154894 Sh3rf1 "SH3 domain containing 0.491 0.067 0.683 2.7e-19
UNIPROTKB|Q71F54894 Sh3rf1 "E3 ubiquitin-protein l 0.491 0.067 0.683 2.7e-19
ZFIN|ZDB-GENE-030131-6288880 sh3rf1 "SH3 domain containing 0.491 0.068 0.7 4.5e-19
FB|FBgn0040294838 POSH "Plenty of SH3s" [Drosoph 0.5 0.072 0.688 5.8e-19
UNIPROTKB|G5E517709 SH3RF1 "E3 ubiquitin-protein l 0.491 0.084 0.683 1.4e-18
UNIPROTKB|F1PBV0 SH3RF3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 269 (99.8 bits), Expect = 3.8e-23, Sum P(2) = 3.8e-23
 Identities = 46/66 (69%), Positives = 56/66 (84%)

Query:    57 KPQPVPTVRERFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPA 116
             +P+P P  RER+R +V YPP SE E+EL+ GD+++VHKKR+DGWYKGTLQR GRTGLFP 
Sbjct:   817 RPEPKPLSRERYRVVVSYPPQSEAEIELKEGDIVFVHKKREDGWYKGTLQRNGRTGLFPG 876

Query:   117 SFVESF 122
             SFVESF
Sbjct:   877 SFVESF 882


GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|F1N2S5 SH3RF3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TEJ3 SH3RF3 "SH3 domain-containing RING finger protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2444637 Sh3rf3 "SH3 domain containing ring finger 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NYR2 SH3RF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|735154 Sh3rf1 "SH3 domain containing ring finger 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q71F54 Sh3rf1 "E3 ubiquitin-protein ligase SH3RF1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6288 sh3rf1 "SH3 domain containing ring finger 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0040294 POSH "Plenty of SH3s" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|G5E517 SH3RF1 "E3 ubiquitin-protein ligase SH3RF1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8C120SH3R3_MOUSENo assigned EC number0.56380.72950.1013yesN/A
A5D8S5SH3R1_DANRE6, ., 3, ., 2, ., -0.68850.41800.0588yesN/A
Q8TEJ3SH3R3_HUMANNo assigned EC number0.57140.67210.0929yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.4.1.68LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
cd1178555 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homo 6e-36
cd1178055 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Ho 4e-20
smart0032656 smart00326, SH3, Src homology 3 domains 5e-17
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 1e-16
cd1182353 cd11823, SH3_Nostrin, Src homology 3 domain of Nit 9e-15
cd1179159 cd11791, SH3_UBASH3, Src homology 3 domain of Ubiq 1e-14
cd1187555 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do 1e-13
cd1183958 cd11839, SH3_Intersectin_4, Fourth Src homology 3 2e-13
cd1182652 cd11826, SH3_Abi, Src homology 3 domain of Abl Int 2e-13
cd1187453 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d 8e-13
cd1197261 cd11972, SH3_Abi2, Src homology 3 domain of Abl In 4e-12
cd1179255 cd11792, SH3_Fut8, Src homology 3 domain of Alpha1 8e-12
cd1192655 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain 1e-11
cd1178355 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain 1e-11
cd1191659 cd11916, SH3_Sorbs1_3, Third (or C-terminal) Src H 1e-11
cd1181954 cd11819, SH3_Cortactin_like, Src homology 3 domain 1e-11
cd1193459 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do 2e-11
cd1191761 cd11917, SH3_Sorbs2_3, Third (or C-terminal) Src H 2e-11
cd1205455 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain 4e-11
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 6e-11
pfam0001847 pfam00018, SH3_1, SH3 domain 7e-11
cd1187353 cd11873, SH3_CD2AP-like_1, First Src Homology 3 do 7e-11
cd1193358 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 1e-10
cd1205553 cd12055, SH3_CIN85_2, Second Src Homology 3 domain 1e-10
cd1193558 cd11935, SH3_Nebulette_C, C-terminal Src Homology 1e-10
cd1178153 cd11781, SH3_Sorbs_1, First Src Homology 3 domain 2e-10
cd1179355 cd11793, SH3_ephexin1_like, Src homology 3 domain 2e-10
cd1180155 cd11801, SH3_JIP1_like, Src homology 3 domain of J 2e-10
cd1191858 cd11918, SH3_Vinexin_3, Third (or C-terminal) Src 2e-10
cd1214255 cd12142, SH3_D21-like, Src Homology 3 domain of SH 3e-10
cd1178455 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain 3e-10
cd1178955 cd11789, SH3_Nebulin_family_C, C-terminal Src Homo 4e-10
cd1197159 cd11971, SH3_Abi1, Src homology 3 domain of Abl In 4e-10
cd1177253 cd11772, SH3_OSTF1, Src Homology 3 domain of metaz 4e-10
cd1192557 cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain 9e-10
cd1205253 cd12052, SH3_CIN85_1, First Src Homology 3 domain 1e-09
cd1179651 cd11796, SH3_DNMBP_N3, Third N-terminal Src homolo 1e-09
cd1178859 cd11788, SH3_RasGAP, Src Homology 3 domain of Ras 2e-09
cd1192155 cd11921, SH3_Vinexin_1, First Src Homology 3 domai 4e-09
cd1176653 cd11766, SH3_Nck_2, Second Src Homology 3 domain o 5e-09
cd1180355 cd11803, SH3_Endophilin_A, Src homology 3 domain o 6e-09
cd1182753 cd11827, SH3_MyoIe_If_like, Src homology 3 domain 8e-09
cd1186954 cd11869, SH3_p40phox, Src Homology 3 domain of the 1e-08
cd1206058 cd12060, SH3_alphaPIX, Src Homology 3 domain of al 1e-08
cd1187753 cd11877, SH3_PIX, Src Homology 3 domain of Pak Int 1e-08
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 1e-08
cd1188254 cd11882, SH3_GRAF-like, Src Homology 3 domain of G 2e-08
cd1188655 cd11886, SH3_BOI, Src Homology 3 domain of fungal 2e-08
cd1178253 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain 4e-08
cd1194255 cd11942, SH3_JIP2, Src homology 3 domain of JNK-in 7e-08
cd1192456 cd11924, SH3_Vinexin_2, Second Src Homology 3 doma 1e-07
cd1191955 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain 1e-07
cd1177160 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain 1e-07
cd1187256 cd11872, SH3_DOCK_AB, Src Homology 3 domain of Cla 1e-07
cd1178653 cd11786, SH3_SH3RF_1, First Src Homology 3 domain 1e-07
cd1188355 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 1e-07
cd1206154 cd12061, SH3_betaPIX, Src Homology 3 domain of bet 1e-07
cd1179451 cd11794, SH3_DNMBP_N1, First N-terminal Src homolo 2e-07
cd1192357 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domai 3e-07
cd1179064 cd11790, SH3_Amphiphysin, Src Homology 3 domain of 3e-07
cd1194055 cd11940, SH3_ARHGEF5_19, Src homology 3 domain of 4e-07
cd1182054 cd11820, SH3_STAM, Src homology 3 domain of Signal 5e-07
cd1205756 cd12057, SH3_CIN85_3, Third Src Homology 3 domain 5e-07
cd1192055 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain 5e-07
cd1205958 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixe 6e-07
cd1184053 cd11840, SH3_Intersectin_5, Fifth Src homology 3 d 8e-07
cd1196254 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src h 9e-07
cd1183655 cd11836, SH3_Intersectin_1, First Src homology 3 d 1e-06
cd1181750 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain 1e-06
cd1179750 cd11797, SH3_DNMBP_N4, Fourth N-terminal Src homol 1e-06
cd1205657 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain 1e-06
cd1205356 cd12053, SH3_CD2AP_1, First Src Homology 3 domain 1e-06
cd1201361 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain 1e-06
cd1205858 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed 2e-06
cd1185162 cd11851, SH3_RIM-BP, Src homology 3 domains of Rab 2e-06
cd1184353 cd11843, SH3_PACSIN, Src homology 3 domain of Prot 2e-06
cd1194355 cd11943, SH3_JIP1, Src homology 3 domain of JNK-in 2e-06
cd1199756 cd11997, SH3_PACSIN3, Src homology 3 domain of Pro 2e-06
cd1188953 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of 2e-06
cd1205056 cd12050, SH3_DOCK2_A, Src Homology 3 domain of Cla 3e-06
cd1181552 cd11815, SH3_Eve1_2, Second Src homology 3 domain 3e-06
cd1196054 cd11960, SH3_Abp1_eu, Src homology 3 domain of eum 3e-06
cd1205156 cd12051, SH3_DOCK1_5_A, Src Homology 3 domain of C 3e-06
cd1193855 cd11938, SH3_ARHGEF16_26, Src homology 3 domain of 3e-06
cd1183054 cd11830, SH3_VAV_2, C-terminal (or second) Src hom 4e-06
cd1177957 cd11779, SH3_Irsp53_BAIAP2L, Src Homology 3 domain 4e-06
cd1182153 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP 5e-06
cd1197654 cd11976, SH3_VAV1_2, C-terminal (or second) Src ho 5e-06
cd1183353 cd11833, SH3_Stac_1, First C-terminal Src homology 5e-06
cd1176257 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain 6e-06
cd1202153 cd12021, SH3_p47phox_1, First or N-terminal Src ho 6e-06
cd1197758 cd11977, SH3_VAV2_2, C-terminal (or second) Src ho 6e-06
cd1183852 cd11838, SH3_Intersectin_3, Third Src homology 3 d 7e-06
cd1193955 cd11939, SH3_ephexin1, Src homology 3 domain of th 7e-06
cd1182453 cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro 8e-06
cd1207355 cd12073, SH3_HS1, Src homology 3 domain of Hematop 8e-06
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 1e-05
cd1199856 cd11998, SH3_PACSIN1-2, Src homology 3 domain of P 1e-05
cd1195953 cd11959, SH3_Cortactin, Src homology 3 domain of C 1e-05
cd1199654 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 1e-05
cd1188760 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 a 1e-05
cd1192258 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domai 1e-05
cd1184154 cd11841, SH3_SH3YL1_like, Src homology 3 domain of 1e-05
cd1199365 cd11993, SH3_Intersectin1_4, Fourth Src homology 3 2e-05
cd1195053 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do 2e-05
cd1193662 cd11936, SH3_UBASH3B, Src homology 3 domain of Ubi 2e-05
cd1176355 cd11763, SH3_SNX9_like, Src Homology 3 domain of S 2e-05
cd1201262 cd12012, SH3_RIM-BP_2, Second Src homology 3 domai 2e-05
cd1197856 cd11978, SH3_VAV3_2, C-terminal (or second) Src ho 3e-05
cd1184255 cd11842, SH3_Ysc84p_like, Src homology 3 domain of 3e-05
cd1186555 cd11865, SH3_Nbp2-like, Src Homology 3 domain of S 3e-05
cd1204653 cd12046, SH3_p67phox_C, C-terminal (or second) Src 3e-05
cd1192854 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain 4e-05
cd1201462 cd12014, SH3_RIM-BP_1, First Src homology 3 domain 4e-05
cd1199152 cd11991, SH3_Intersectin1_3, Third Src homology 3 5e-05
cd1185653 cd11856, SH3_p47phox_like, Src homology 3 domains 5e-05
cd1181252 cd11812, SH3_AHI-1, Src Homology 3 domain of Abels 6e-05
cd1191075 cd11910, SH3_PI3K_p85alpha, Src Homology 3 domain 7e-05
cd1193760 cd11937, SH3_UBASH3A, Src homology 3 domain of Ubi 7e-05
cd1182952 cd11829, SH3_GAS7, Src homology 3 domain of Growth 7e-05
cd1177672 cd11776, SH3_PI3K_p85, Src Homology 3 domain of th 7e-05
cd1181651 cd11816, SH3_Eve1_3, Third Src homology 3 domain o 8e-05
cd1177557 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain 9e-05
cd1179554 cd11795, SH3_DNMBP_N2, Second N-terminal Src homol 1e-04
cd1196357 cd11963, SH3_STAM2, Src homology 3 domain of Signa 1e-04
cd1199459 cd11994, SH3_Intersectin2_4, Fourth Src homology 3 2e-04
cd1192954 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain 2e-04
cd1189655 cd11896, SH3_SNX33, Src Homology 3 domain of Sorti 2e-04
cd1182853 cd11828, SH3_ARHGEF9_like, Src homology 3 domain o 2e-04
cd1198553 cd11985, SH3_Stac2_C, C-terminal Src homology 3 do 2e-04
cd1180953 cd11809, SH3_srGAP, Src homology 3 domain of Slit- 3e-04
cd1199956 cd11999, SH3_PACSIN_like, Src homology 3 domain of 3e-04
cd1177851 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain 3e-04
cd1187053 cd11870, SH3_p67phox-like_C, C-terminal Src Homolo 3e-04
cd1199554 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 3e-04
cd1195153 cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom 3e-04
cd1198755 cd11987, SH3_Intersectin1_1, First Src homology 3 3e-04
cd1181850 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain o 4e-04
cd1198452 cd11984, SH3_Shank3, Src homology 3 domain of SH3 4e-04
cd1196455 cd11964, SH3_STAM1, Src homology 3 domain of Signa 5e-04
cd1196153 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src 6e-04
cd1206554 cd12065, SH3_GRAF2, Src Homology 3 domain of GTPas 6e-04
cd1177357 cd11773, SH3_Sla1p_1, First Src Homology 3 domain 8e-04
cd1177054 cd11770, SH3_Nephrocystin, Src Homology 3 domain o 9e-04
cd1190155 cd11901, SH3_Nck1_2, Second Src Homology 3 domain 9e-04
cd1206262 cd12062, SH3_Caskin1, Src Homology 3 domain of CAS 0.001
cd1207654 cd12076, SH3_Tks4_2, Second Src homology 3 domain 0.001
cd1188456 cd11884, SH3_MYO15, Src Homology 3 domain of Myosi 0.001
cd1183753 cd11837, SH3_Intersectin_2, Second Src homology 3 0.002
cd1176957 cd11769, SH3_CSK, Src Homology 3 domain of C-termi 0.002
cd1191255 cd11912, SH3_Bzz1_1, First Src Homology 3 domain o 0.002
cd1181353 cd11813, SH3_SGSM3, Src Homology 3 domain of Small 0.002
cd1182554 cd11825, SH3_PLCgamma, Src homology 3 domain of Ph 0.003
cd1189755 cd11897, SH3_SNX18, Src Homology 3 domain of Sorti 0.003
cd1186653 cd11866, SH3_SKAP1-like, Src Homology 3 domain of 0.003
cd1188061 cd11880, SH3_Caskin, Src Homology 3 domain of CASK 0.004
cd1190255 cd11902, SH3_Nck2_2, Second Src Homology 3 domain 0.004
cd1192754 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain 0.004
cd1187154 cd11871, SH3_p67phox_N, N-terminal (or first) Src 0.004
>gnl|CDD|212719 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains Back     alignment and domain information
 Score =  116 bits (293), Expect = 6e-36
 Identities = 42/55 (76%), Positives = 50/55 (90%)

Query: 67  RFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVES 121
           R+R IVPYPP SE ELEL+ GD+++VHKKR+DGW+KGTLQRTG+TGLFP SFVES
Sbjct: 1   RYRVIVPYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRTGKTGLFPGSFVES 55


SH3RF1 (or POSH) and SH3RF3 (or POSH2) are scaffold proteins that function as E3 ubiquitin-protein ligases. They contain an N-terminal RING finger domain and four SH3 domains. This model represents the fourth SH3 domain, located at the C-terminus of SH3RF1 and SH3RF3, and similar domains. SH3RF1 plays a role in calcium homeostasis through the control of the ubiquitin domain protein Herp. It may also have a role in regulating death receptor mediated and JNK mediated apoptosis. SH3RF3 interacts with p21-activated kinase 2 (PAK2) and GTP-loaded Rac1. It may play a role in regulating JNK mediated apoptosis in certain conditions. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 55

>gnl|CDD|212714 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer Back     alignment and domain information
>gnl|CDD|212725 cd11791, SH3_UBASH3, Src homology 3 domain of Ubiquitin-associated and SH3 domain-containing proteins, also called TULA (T cell Ubiquitin LigAnd) family of proteins Back     alignment and domain information
>gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212773 cd11839, SH3_Intersectin_4, Fourth Src homology 3 domain (or SH3D) of Intersectin Back     alignment and domain information
>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins Back     alignment and domain information
>gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 Back     alignment and domain information
>gnl|CDD|212726 cd11792, SH3_Fut8, Src homology 3 domain of Alpha1,6-fucosyltransferase (Fut8) Back     alignment and domain information
>gnl|CDD|212859 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains Back     alignment and domain information
>gnl|CDD|212849 cd11916, SH3_Sorbs1_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin Back     alignment and domain information
>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins Back     alignment and domain information
>gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 Back     alignment and domain information
>gnl|CDD|212850 cd11917, SH3_Sorbs2_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin Back     alignment and domain information
>gnl|CDD|212988 cd12055, SH3_CIN85_2, Second Src Homology 3 domain (SH3B) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of Nebulette and LIM-nebulette (or Lasp2) Back     alignment and domain information
>gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212727 cd11793, SH3_ephexin1_like, Src homology 3 domain of ephexin-1-like SH3 domain containing Rho guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212735 cd11801, SH3_JIP1_like, Src homology 3 domain of JNK-interacting proteins 1 and 2, and similar domains Back     alignment and domain information
>gnl|CDD|212851 cd11918, SH3_Vinexin_3, Third (or C-terminal) Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) Back     alignment and domain information
>gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins Back     alignment and domain information
>gnl|CDD|212718 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins Back     alignment and domain information
>gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1 Back     alignment and domain information
>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 Back     alignment and domain information
>gnl|CDD|212858 cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212985 cd12052, SH3_CIN85_1, First Src Homology 3 domain (SH3A) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212722 cd11788, SH3_RasGAP, Src Homology 3 domain of Ras GTPase-Activating Protein 1 Back     alignment and domain information
>gnl|CDD|212854 cd11921, SH3_Vinexin_1, First Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) Back     alignment and domain information
>gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A Back     alignment and domain information
>gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins Back     alignment and domain information
>gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase and similar proteins Back     alignment and domain information
>gnl|CDD|212819 cd11886, SH3_BOI, Src Homology 3 domain of fungal BOI-like proteins Back     alignment and domain information
>gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212875 cd11942, SH3_JIP2, Src homology 3 domain of JNK-interacting protein 2 Back     alignment and domain information
>gnl|CDD|212857 cd11924, SH3_Vinexin_2, Second Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) Back     alignment and domain information
>gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin Back     alignment and domain information
>gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p Back     alignment and domain information
>gnl|CDD|212805 cd11872, SH3_DOCK_AB, Src Homology 3 domain of Class A and B Dedicator of Cytokinesis proteins Back     alignment and domain information
>gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins Back     alignment and domain information
>gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212728 cd11794, SH3_DNMBP_N1, First N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212724 cd11790, SH3_Amphiphysin, Src Homology 3 domain of Amphiphysin and related domains Back     alignment and domain information
>gnl|CDD|212873 cd11940, SH3_ARHGEF5_19, Src homology 3 domain of the Rho guanine nucleotide exchange factors ARHGEF5 and ARHGEF19 Back     alignment and domain information
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules Back     alignment and domain information
>gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases 1, 2, and 3 Back     alignment and domain information
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin Back     alignment and domain information
>gnl|CDD|212895 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A) of Intersectin Back     alignment and domain information
>gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212731 cd11797, SH3_DNMBP_N4, Fourth N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212986 cd12053, SH3_CD2AP_1, First Src Homology 3 domain (SH3A) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212946 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212991 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed Lineage Kinase 4 Back     alignment and domain information
>gnl|CDD|212785 cd11851, SH3_RIM-BP, Src homology 3 domains of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>gnl|CDD|212876 cd11943, SH3_JIP1, Src homology 3 domain of JNK-interacting protein 1 Back     alignment and domain information
>gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) Back     alignment and domain information
>gnl|CDD|212822 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of Cytokinesis protein 3 and similar proteins Back     alignment and domain information
>gnl|CDD|212983 cd12050, SH3_DOCK2_A, Src Homology 3 domain of Class A Dedicator of Cytokinesis protein 2 Back     alignment and domain information
>gnl|CDD|212749 cd11815, SH3_Eve1_2, Second Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212984 cd12051, SH3_DOCK1_5_A, Src Homology 3 domain of Class A Dedicator of Cytokinesis proteins 1 and 5 Back     alignment and domain information
>gnl|CDD|212871 cd11938, SH3_ARHGEF16_26, Src homology 3 domain of the Rho guanine nucleotide exchange factors ARHGEF16 and ARHGEF26 Back     alignment and domain information
>gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins Back     alignment and domain information
>gnl|CDD|212713 cd11779, SH3_Irsp53_BAIAP2L, Src Homology 3 domain of Insulin Receptor tyrosine kinase Substrate p53, Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2 (BAIAP2)-Like proteins, and similar proteins Back     alignment and domain information
>gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing proteins Back     alignment and domain information
>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein Back     alignment and domain information
>gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins Back     alignment and domain information
>gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and double SH3 domains proteins Back     alignment and domain information
>gnl|CDD|212954 cd12021, SH3_p47phox_1, First or N-terminal Src homology 3 domain of the p47phox subunit of NADPH oxidase, also called Neutrophil Cytosolic Factor 1 Back     alignment and domain information
>gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein Back     alignment and domain information
>gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin Back     alignment and domain information
>gnl|CDD|212872 cd11939, SH3_ephexin1, Src homology 3 domain of the Rho guanine nucleotide exchange factor, ephexin-1 (also called NGEF or ARHGEF27) Back     alignment and domain information
>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212931 cd11998, SH3_PACSIN1-2, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) and PACSIN 2 Back     alignment and domain information
>gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin Back     alignment and domain information
>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212820 cd11887, SH3_Bbc1, Src Homology 3 domain of Bbc1 and similar domains Back     alignment and domain information
>gnl|CDD|212855 cd11922, SH3_Sorbs1_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin Back     alignment and domain information
>gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein Back     alignment and domain information
>gnl|CDD|212926 cd11993, SH3_Intersectin1_4, Fourth Src homology 3 domain (or SH3D) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|212869 cd11936, SH3_UBASH3B, Src homology 3 domain of Ubiquitin-associated and SH3 domain-containing protein B Back     alignment and domain information
>gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins Back     alignment and domain information
>gnl|CDD|212945 cd12012, SH3_RIM-BP_2, Second Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain of VAV3 protein Back     alignment and domain information
>gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins Back     alignment and domain information
>gnl|CDD|212799 cd11865, SH3_Nbp2-like, Src Homology 3 domain of Saccharomyces cerevisiae Nap1-binding protein 2 and similar fungal proteins Back     alignment and domain information
>gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212861 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212947 cd12014, SH3_RIM-BP_1, First Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or SH3C) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains Back     alignment and domain information
>gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) Back     alignment and domain information
>gnl|CDD|212843 cd11910, SH3_PI3K_p85alpha, Src Homology 3 domain of the p85alpha regulatory subunit of Class IA Phosphatidylinositol 3-kinases Back     alignment and domain information
>gnl|CDD|212870 cd11937, SH3_UBASH3A, Src homology 3 domain of Ubiquitin-associated and SH3 domain-containing protein A Back     alignment and domain information
>gnl|CDD|212763 cd11829, SH3_GAS7, Src homology 3 domain of Growth Arrest Specific protein 7 Back     alignment and domain information
>gnl|CDD|212710 cd11776, SH3_PI3K_p85, Src Homology 3 domain of the p85 regulatory subunit of Class IA Phosphatidylinositol 3-kinases Back     alignment and domain information
>gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212729 cd11795, SH3_DNMBP_N2, Second N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 Back     alignment and domain information
>gnl|CDD|212927 cd11994, SH3_Intersectin2_4, Fourth Src homology 3 domain (or SH3D) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212862 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212829 cd11896, SH3_SNX33, Src Homology 3 domain of Sorting Nexin 33 Back     alignment and domain information
>gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 2 (Stac2) Back     alignment and domain information
>gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins Back     alignment and domain information
>gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown subfamily of proteins with similarity to Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and similar domains Back     alignment and domain information
>gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of the p67phox subunit of NADPH oxidase and similar proteins Back     alignment and domain information
>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212920 cd11987, SH3_Intersectin1_1, First Src homology 3 domain (or SH3A) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212917 cd11984, SH3_Shank3, Src homology 3 domain of SH3 and multiple ankyrin repeat domains protein 3 Back     alignment and domain information
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 Back     alignment and domain information
>gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212998 cd12065, SH3_GRAF2, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase 2 Back     alignment and domain information
>gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) Back     alignment and domain information
>gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor protein Back     alignment and domain information
>gnl|CDD|212995 cd12062, SH3_Caskin1, Src Homology 3 domain of CASK interacting protein 1 Back     alignment and domain information
>gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains Back     alignment and domain information
>gnl|CDD|212817 cd11884, SH3_MYO15, Src Homology 3 domain of Myosin XV Back     alignment and domain information
>gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin Back     alignment and domain information
>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and similar domains Back     alignment and domain information
>gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein Signaling Modulator 3 Back     alignment and domain information
>gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C (PLC) gamma Back     alignment and domain information
>gnl|CDD|212830 cd11897, SH3_SNX18, Src Homology 3 domain of Sorting nexin 18 Back     alignment and domain information
>gnl|CDD|212800 cd11866, SH3_SKAP1-like, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 and similar proteins Back     alignment and domain information
>gnl|CDD|212813 cd11880, SH3_Caskin, Src Homology 3 domain of CASK interacting protein Back     alignment and domain information
>gnl|CDD|212835 cd11902, SH3_Nck2_2, Second Src Homology 3 domain of Nck2 adaptor protein Back     alignment and domain information
>gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212804 cd11871, SH3_p67phox_N, N-terminal (or first) Src Homology 3 domain of the p67phox subunit of NADPH oxidase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 122
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.76
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 99.67
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 99.65
KOG1118|consensus366 99.64
KOG0162|consensus1106 99.63
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 99.56
KOG2199|consensus 462 99.55
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 99.52
KOG2070|consensus 661 99.52
KOG1029|consensus1118 99.49
KOG4225|consensus489 99.43
KOG4226|consensus 379 99.42
KOG4225|consensus 489 99.38
KOG4348|consensus 627 99.31
KOG2996|consensus865 99.29
KOG4348|consensus 627 99.27
KOG2856|consensus472 99.24
KOG4226|consensus 379 99.2
KOG2546|consensus483 99.18
KOG4792|consensus 293 99.18
KOG1702|consensus264 99.15
KOG1029|consensus 1118 99.12
KOG1264|consensus 1267 99.08
KOG3655|consensus484 99.06
KOG3523|consensus695 99.0
KOG0515|consensus752 99.0
KOG3875|consensus362 98.94
KOG3601|consensus222 98.79
KOG1843|consensus473 98.69
KOG3775|consensus 482 98.62
KOG4278|consensus 1157 98.56
KOG2528|consensus 490 98.42
KOG3632|consensus 1335 98.35
KOG4773|consensus 386 98.33
KOG4792|consensus293 98.29
KOG2222|consensus 848 98.2
KOG3557|consensus 721 98.17
KOG0197|consensus 468 98.12
KOG3771|consensus460 98.1
KOG4429|consensus421 98.07
KOG1451|consensus812 98.0
KOG0609|consensus 542 98.0
KOG3725|consensus375 97.84
KOG4575|consensus 874 97.84
KOG3632|consensus 1335 97.47
KOG3601|consensus 222 97.43
KOG3565|consensus640 97.22
PF1460389 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. 97.19
KOG0199|consensus 1039 97.17
PF0823955 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S 96.94
smart0028763 SH3b Bacterial SH3 domain homologues. 96.41
KOG3812|consensus 475 96.03
KOG3705|consensus580 95.89
PRK10884 206 SH3 domain-containing protein; Provisional 95.44
KOG0040|consensus 2399 95.04
KOG2996|consensus 865 94.66
PF0634755 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 S 94.65
PRK13914 481 invasion associated secreted endopeptidase; Provis 92.49
COG3103 205 SH3 domain protein [Signal transduction mechanisms 91.9
smart0074361 Agenet Tudor-like domain present in plant sequence 91.77
PF1130275 DUF3104: Protein of unknown function (DUF3104); In 90.03
KOG4384|consensus 361 86.72
PF1291354 SH3_6: SH3 domain of the SH3b1 type; PDB: 3M1U_B. 81.65
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
Probab=99.76  E-value=1e-18  Score=94.55  Aligned_cols=49  Identities=49%  Similarity=0.892  Sum_probs=45.1

Q ss_pred             EeeeCCCCCCCceecCCCCEEEEEEeCCCCeEEEEEcCCCcEEEecCCCeE
Q psy9679          70 CIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVE  120 (122)
Q Consensus        70 al~dy~~~~~~eL~~~~gd~i~v~~~~~~gW~~g~~~~~g~~G~~P~~yv~  120 (122)
                      |+|+|.++.++||+|++||+|.|+.+.+++||.|++  +|+.|+||++||+
T Consensus         1 Al~~y~~~~~dELs~~~Gd~i~v~~~~~~~W~~g~~--~g~~G~~P~~yV~   49 (49)
T PF14604_consen    1 ALYDYEAQDPDELSFKKGDVITVLEKSDDGWWYGRN--TGRTGLFPANYVE   49 (49)
T ss_dssp             ESSCBCSSSTTB-EB-TTEEEEEEEESSTSEEEEEE--TTEEEEEEGGGEE
T ss_pred             CCccCCCCCcCEeeEcCCCEEEEEEeCCCCEEEEEE--CCEEEEECHHhCC
Confidence            789999999999999999999999999999999998  9999999999986



...

>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG3565|consensus Back     alignment and domain information
>PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>smart00287 SH3b Bacterial SH3 domain homologues Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>KOG3705|consensus Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>PF06347 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PRK13914 invasion associated secreted endopeptidase; Provisional Back     alignment and domain information
>COG3103 SH3 domain protein [Signal transduction mechanisms] Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>PF11302 DUF3104: Protein of unknown function (DUF3104); InterPro: IPR021453 This family of proteins with unknown function appears to be restricted to Cyanobacteria Back     alignment and domain information
>KOG4384|consensus Back     alignment and domain information
>PF12913 SH3_6: SH3 domain of the SH3b1 type; PDB: 3M1U_B Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
2ed0_A78 Solution Structure Of The Sh3 Domain Of Abl Interac 6e-09
4f14_A64 Structure Of The Sh3 Domain Of Human Nebulette In C 8e-09
3i35_A60 Human Sh3 Domain Of Protein Lasp1 Length = 60 8e-09
3u23_A65 Atomic Resolution Crystal Structure Of The 2nd Sh3 1e-08
1ark_A60 Sh3 Domain From Human Nebulin, Nmr, 15 Structures L 2e-08
2lj1_A64 The Third Sh3 Domain Of R85fl With Ataxin-7 Prr Len 3e-08
2lj0_A65 The Third Sh3 Domain Of R85fl Length = 65 3e-08
2fei_A65 Solution Structure Of The Second Sh3 Domain Of Huma 5e-08
1wi7_A68 Solution Structure Of The Sh3 Domain Of Sh3-Domain 9e-08
2ct3_A70 Solution Structure Of The Sh3 Domain Of The Vinexin 1e-07
2o2o_A92 Solution Structure Of Domain B From Human Cin85 Pro 2e-07
2krn_A60 High Resolution Structure Of The Second Sh3 Domain 3e-07
3ehq_A 222 Crystal Structure Of Human Osteoclast Stimulating F 3e-06
2yun_A79 Solution Structure Of The Sh3 Domain Of Human Nostr 4e-06
2nwm_A65 Solution Structure Of The First Sh3 Domain Of Human 5e-06
2dlm_A68 Solution Structure Of The First Sh3 Domain Of Human 6e-06
1x2k_A68 Solution Structure Of The Sh3 Domain Of Human Osteo 8e-06
1zlm_A58 Crystal Structure Of The Sh3 Domain Of Human Osteoc 9e-06
1ujy_A76 Solution Structure Of Sh3 Domain In RacCDC42 GUANIN 9e-06
1zsg_A65 Beta Pix-Sh3 Complexed With An Atypical Peptide Fro 2e-05
1z9q_A79 Solution Structure Of Sh3 Domain Of P40phox Length 2e-05
1w6x_A60 Sh3 Domain Of P40phox, Component Of The Nadph Oxida 2e-05
2yup_A90 Solution Structure Of The Second Sh3 Domain Of Huma 2e-05
2dyb_A 341 The Crystal Structure Of Human P40(Phox) Length = 3 2e-05
3iql_A71 Crystal Structure Of The Rat Endophilin-A1 Sh3 Doma 3e-05
2cuc_A70 Solution Structure Of The Sh3 Domain Of The Mouse H 3e-05
2fpf_A71 Crystal Structure Of The Ib1 Sh3 Dimer At Low Resol 4e-05
2e5k_A94 Solution Structure Of Sh3 Domain In Suppressor Of T 4e-05
2dbm_A73 Solution Structures Of The Sh3 Domain Of Human Sh3- 5e-05
3c0c_A73 X-Ray Crystal Structure Of The Rat Endophilin A2 Sh 5e-05
1wlp_B138 Solution Structure Of The P22phox-P47phox Complex L 5e-05
1uec_A 193 Crystal Structure Of Autoinhibited Form Of Tandem S 5e-05
2fpd_A62 Sad Structure Determination: Crystal Structure Of T 6e-05
2dl3_A68 Solution Structure Of The First Sh3 Domain Of Human 7e-05
2dil_A69 Solution Structure Of The Sh3 Domain Of The Human P 7e-05
2ak5_A64 Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length 9e-05
2dl4_A68 Solution Structure Of The First Sh3 Domain Of Stac 1e-04
2esw_A61 Atomic Structure Of The N-Terminal Sh3 Domain Of Mo 1e-04
3gf9_A 295 Crystal Structure Of Human Intersectin 2 Rhogef Dom 2e-04
2df6_A59 Crystal Structure Of The Sh3 Domain Of Betapix In C 2e-04
1gri_A217 Grb2 Length = 217 2e-04
1ov3_A138 Structure Of The P22phox-P47phox Complex Length = 1 2e-04
2bz8_A58 N-Terminal Sh3 Domain Of Cin85 Bound To Cbl-B Pepti 2e-04
1ng2_A 193 Structure Of Autoinhibited P47phox Length = 193 2e-04
1udl_A98 The Solution Structure Of The Fifth Sh3 Domain Of I 2e-04
2vwf_A58 Grb2 Sh3c (2) Length = 58 2e-04
4glm_A72 Crystal Structure Of The Sh3 Domain Of Dnmbp Protei 2e-04
1gcq_A61 Crystal Structure Of Vav And Grb2 Sh3 Domains Lengt 2e-04
2vvk_A56 Grb2 Sh3c (1) Length = 56 2e-04
1io6_A59 Growth Factor Receptor-Bound Protein 2 (Grb2) C-Ter 3e-04
2lcs_A73 Yeast Nbp2p Sh3 Domain In Complex With A Peptide Fr 3e-04
2jt4_A71 Solution Structure Of The Sla1 Sh3-3-Ubiquitin Comp 4e-04
2ew3_A68 Solution Structure Of The Sh3 Domain Of Human Sh3gl 4e-04
2m0y_A74 Solution Structure Of The Sh3 Domain Of Dock180 Len 4e-04
2k9g_A73 Solution Structure Of The Third Sh3 Domain Of The C 4e-04
2k6d_A62 Cin85 Sh3-C Domain In Complex With Ubiquitin Length 5e-04
2djq_A68 The Solution Structure Of The First Sh3 Domain Of M 7e-04
2da9_A70 Solution Structure Of The Third Sh3 Domain Of Sh3-D 7e-04
2ydl_A69 Crystal Structure Of Sh3c From Cin85 Length = 69 8e-04
2drk_A59 Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L 8e-04
1z9z_A60 Crystal Structure Of Yeast Sla1 Sh3 Domain 3 Length 9e-04
2drm_A58 Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L 9e-04
>pdb|2ED0|A Chain A, Solution Structure Of The Sh3 Domain Of Abl Interactor 2 (Abelson Interactor 2) Length = 78 Back     alignment and structure

Iteration: 1

Score = 55.8 bits (133), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 27/57 (47%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Query: 66 ERFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVESF 122 E+ I Y + E EL + G +IYV KK DDGWY+G + G TGLFP ++VES Sbjct: 18 EKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMN--GVTGLFPGNYVESI 72
>pdb|4F14|A Chain A, Structure Of The Sh3 Domain Of Human Nebulette In Complex With A Peptide Of Xirp2 Length = 64 Back     alignment and structure
>pdb|3I35|A Chain A, Human Sh3 Domain Of Protein Lasp1 Length = 60 Back     alignment and structure
>pdb|3U23|A Chain A, Atomic Resolution Crystal Structure Of The 2nd Sh3 Domain From Human Cd2ap (Cms) In Complex With A Proline-Rich Peptide From Human Rin3 Length = 65 Back     alignment and structure
>pdb|1ARK|A Chain A, Sh3 Domain From Human Nebulin, Nmr, 15 Structures Length = 60 Back     alignment and structure
>pdb|2LJ1|A Chain A, The Third Sh3 Domain Of R85fl With Ataxin-7 Prr Length = 64 Back     alignment and structure
>pdb|2LJ0|A Chain A, The Third Sh3 Domain Of R85fl Length = 65 Back     alignment and structure
>pdb|2FEI|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Cms Protein Length = 65 Back     alignment and structure
>pdb|1WI7|A Chain A, Solution Structure Of The Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 Length = 68 Back     alignment and structure
>pdb|2CT3|A Chain A, Solution Structure Of The Sh3 Domain Of The Vinexin Protein Length = 70 Back     alignment and structure
>pdb|2O2O|A Chain A, Solution Structure Of Domain B From Human Cin85 Protein Length = 92 Back     alignment and structure
>pdb|2KRN|A Chain A, High Resolution Structure Of The Second Sh3 Domain Of Cd2ap Length = 60 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|2YUN|A Chain A, Solution Structure Of The Sh3 Domain Of Human Nostrin Length = 79 Back     alignment and structure
>pdb|2NWM|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Vinexin And Its Interaction With The Peptides From Vinculin Length = 65 Back     alignment and structure
>pdb|2DLM|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Vinexin Length = 68 Back     alignment and structure
>pdb|1X2K|A Chain A, Solution Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor 1 (Ostf1) Length = 68 Back     alignment and structure
>pdb|1ZLM|A Chain A, Crystal Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor Length = 58 Back     alignment and structure
>pdb|1UJY|A Chain A, Solution Structure Of Sh3 Domain In RacCDC42 GUANINE Nucleotide Exchange Factor(Gef) 6 Length = 76 Back     alignment and structure
>pdb|1ZSG|A Chain A, Beta Pix-Sh3 Complexed With An Atypical Peptide From Alpha- Pak Length = 65 Back     alignment and structure
>pdb|1Z9Q|A Chain A, Solution Structure Of Sh3 Domain Of P40phox Length = 79 Back     alignment and structure
>pdb|1W6X|A Chain A, Sh3 Domain Of P40phox, Component Of The Nadph Oxidase Length = 60 Back     alignment and structure
>pdb|2YUP|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Vinexin Length = 90 Back     alignment and structure
>pdb|2DYB|A Chain A, The Crystal Structure Of Human P40(Phox) Length = 341 Back     alignment and structure
>pdb|3IQL|A Chain A, Crystal Structure Of The Rat Endophilin-A1 Sh3 Domain Length = 71 Back     alignment and structure
>pdb|2CUC|A Chain A, Solution Structure Of The Sh3 Domain Of The Mouse Hypothetical Protein Sh3rf2 Length = 70 Back     alignment and structure
>pdb|2FPF|A Chain A, Crystal Structure Of The Ib1 Sh3 Dimer At Low Resolution Length = 71 Back     alignment and structure
>pdb|2E5K|A Chain A, Solution Structure Of Sh3 Domain In Suppressor Of T-Cell Receptor Signaling 1 Length = 94 Back     alignment and structure
>pdb|2DBM|A Chain A, Solution Structures Of The Sh3 Domain Of Human Sh3- Containing Grb2-Like Protein 2 Length = 73 Back     alignment and structure
>pdb|3C0C|A Chain A, X-Ray Crystal Structure Of The Rat Endophilin A2 Sh3 Domain Length = 73 Back     alignment and structure
>pdb|1WLP|B Chain B, Solution Structure Of The P22phox-P47phox Complex Length = 138 Back     alignment and structure
>pdb|1UEC|A Chain A, Crystal Structure Of Autoinhibited Form Of Tandem Sh3 Domain Of P47phox Length = 193 Back     alignment and structure
>pdb|2FPD|A Chain A, Sad Structure Determination: Crystal Structure Of The Intrinsic Dimerization Sh3 Domain Of The Ib1 Scaffold Protein Length = 62 Back     alignment and structure
>pdb|2DL3|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Sorbin And Sh3 Domain-Containing Protein 1 Length = 68 Back     alignment and structure
>pdb|2DIL|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Proline- Serine-Threonine Phosphatase-Interacting Protein 1 Length = 69 Back     alignment and structure
>pdb|2AK5|A Chain A, Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length = 64 Back     alignment and structure
>pdb|2DL4|A Chain A, Solution Structure Of The First Sh3 Domain Of Stac Protein Length = 68 Back     alignment and structure
>pdb|2ESW|A Chain A, Atomic Structure Of The N-Terminal Sh3 Domain Of Mouse Beta Pix,P21-Activated Kinase (Pak)-Interacting Exchange Factor Length = 61 Back     alignment and structure
>pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 Back     alignment and structure
>pdb|2DF6|A Chain A, Crystal Structure Of The Sh3 Domain Of Betapix In Complex With A High Affinity Peptide From Pak2 Length = 59 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|1OV3|A Chain A, Structure Of The P22phox-P47phox Complex Length = 138 Back     alignment and structure
>pdb|2BZ8|A Chain A, N-Terminal Sh3 Domain Of Cin85 Bound To Cbl-B Peptide Length = 58 Back     alignment and structure
>pdb|1NG2|A Chain A, Structure Of Autoinhibited P47phox Length = 193 Back     alignment and structure
>pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 Back     alignment and structure
>pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 Back     alignment and structure
>pdb|4GLM|A Chain A, Crystal Structure Of The Sh3 Domain Of Dnmbp Protein [homo Sapiens] Length = 72 Back     alignment and structure
>pdb|1GCQ|A Chain A, Crystal Structure Of Vav And Grb2 Sh3 Domains Length = 61 Back     alignment and structure
>pdb|2VVK|A Chain A, Grb2 Sh3c (1) Length = 56 Back     alignment and structure
>pdb|1IO6|A Chain A, Growth Factor Receptor-Bound Protein 2 (Grb2) C-Terminal Sh3 Domain Complexed With A Ligand Peptide (Nmr, Minimized Mean Structure) Length = 59 Back     alignment and structure
>pdb|2LCS|A Chain A, Yeast Nbp2p Sh3 Domain In Complex With A Peptide From Ste20p Length = 73 Back     alignment and structure
>pdb|2JT4|A Chain A, Solution Structure Of The Sla1 Sh3-3-Ubiquitin Complex Length = 71 Back     alignment and structure
>pdb|2EW3|A Chain A, Solution Structure Of The Sh3 Domain Of Human Sh3gl3 Length = 68 Back     alignment and structure
>pdb|2M0Y|A Chain A, Solution Structure Of The Sh3 Domain Of Dock180 Length = 74 Back     alignment and structure
>pdb|2K9G|A Chain A, Solution Structure Of The Third Sh3 Domain Of The Cin85 Adapter Protein Length = 73 Back     alignment and structure
>pdb|2K6D|A Chain A, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 62 Back     alignment and structure
>pdb|2DJQ|A Chain A, The Solution Structure Of The First Sh3 Domain Of Mouse Sh3 Domain Containing Ring Finger 2 Length = 68 Back     alignment and structure
>pdb|2DA9|A Chain A, Solution Structure Of The Third Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 (Regulator Of Ubiquitous Kinase, Ruk) Length = 70 Back     alignment and structure
>pdb|2YDL|A Chain A, Crystal Structure Of Sh3c From Cin85 Length = 69 Back     alignment and structure
>pdb|2DRK|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 59 Back     alignment and structure
>pdb|1Z9Z|A Chain A, Crystal Structure Of Yeast Sla1 Sh3 Domain 3 Length = 60 Back     alignment and structure
>pdb|2DRM|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 58 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 2e-26
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 3e-26
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 7e-26
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 1e-24
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 7e-24
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 7e-23
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 1e-22
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 1e-21
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 2e-21
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 8e-21
3u23_A65 CD2-associated protein; structural genomics, struc 8e-20
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 2e-19
2cuc_A70 SH3 domain containing ring finger 2; structural ge 4e-19
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 4e-19
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 7e-19
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 2e-18
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 4e-18
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 5e-18
2dil_A69 Proline-serine-threonine phosphatase-interacting p 7e-18
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 8e-18
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 8e-18
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 1e-17
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} Length 1e-17
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 1e-17
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 2e-17
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 2e-17
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 3e-17
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 4e-17
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 4e-17
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 4e-17
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 5e-17
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 5e-17
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 7e-17
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 7e-17
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 8e-17
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 8e-17
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 8e-17
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 8e-17
1ng2_A 193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 1e-16
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 3e-11
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 1e-16
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 1e-16
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 1e-16
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 2e-16
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 2e-16
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 2e-16
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 2e-16
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 3e-16
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 3e-16
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 3e-16
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 4e-16
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 4e-16
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 5e-16
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 5e-16
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 6e-16
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 7e-16
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 7e-16
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 8e-16
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 9e-16
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 9e-16
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 9e-16
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 9e-16
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 1e-15
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 1e-15
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 1e-15
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 1e-15
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 1e-15
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 1e-15
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 1e-15
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 2e-15
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 3e-15
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 3e-15
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 3e-15
1uti_A58 GRB2-related adaptor protein 2; signaling protein 4e-15
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 4e-15
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 4e-15
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 4e-15
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 5e-15
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 5e-15
2eyz_A 304 V-CRK sarcoma virus CT10 oncogene homolog isoform 6e-10
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 7e-15
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 7e-15
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 8e-15
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 8e-15
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 1e-14
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 1e-14
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 1e-14
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 1e-14
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 1e-14
2j6f_A62 CD2-associated protein; metal-binding, immune resp 2e-14
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 2e-14
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 2e-14
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 2e-14
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 2e-14
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 2e-14
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 3e-14
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 3e-14
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 3e-14
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 3e-14
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 3e-14
2da9_A70 SH3-domain kinase binding protein 1; structural ge 3e-14
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 5e-14
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 5e-14
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 5e-14
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 5e-14
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 5e-14
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 5e-14
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 6e-14
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 6e-14
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 6e-14
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 9e-14
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 1e-13
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 1e-13
3qwy_A 308 Cell death abnormality protein 2; cell engulfment, 3e-11
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 1e-13
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 1e-13
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 1e-13
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 2e-13
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 2e-13
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 2e-13
2lqn_A 303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 3e-09
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 2e-13
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 3e-13
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 3e-13
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 3e-13
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 4e-13
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 7e-13
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 7e-13
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 7e-13
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 8e-13
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 9e-13
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 1e-12
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 1e-12
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 1e-12
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 1e-12
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 1e-12
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 2e-12
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 2e-12
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 3e-12
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 4e-12
1gri_A 217 Growth factor bound protein 2; SH2, SH3, signal tr 3e-07
3a98_A 184 DOCK2, dedicator of cytokinesis protein 2; protein 5e-12
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 7e-12
2dyb_A 341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 7e-12
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 7e-12
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 1e-11
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 1e-11
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 1e-11
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 1e-11
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 1e-11
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 2e-11
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 2e-11
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 2e-11
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 3e-11
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 4e-11
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 5e-11
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 6e-11
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 7e-11
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 8e-11
1wxb_A68 Epidermal growth factor receptor pathway substrate 8e-11
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 9e-11
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 1e-10
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 2e-10
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 3e-10
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 3e-10
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 4e-10
1awj_A77 ITK; transferase, regulatory intramolecular comple 5e-10
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 5e-10
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 9e-10
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 9e-10
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 1e-09
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 2e-09
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 3e-09
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 7e-09
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 1e-08
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 1e-08
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 4e-08
1i07_A60 Epidermal growth factor receptor kinase substrate 5e-08
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 6e-08
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 6e-08
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 6e-08
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 1e-07
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 2e-07
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 7e-07
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 1e-06
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-06
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 2e-05
4d8k_A 175 Tyrosine-protein kinase LCK; protein kinases, SH2 3e-05
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 4e-05
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 4e-05
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 6e-05
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 7e-05
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-04
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
 Score = 92.2 bits (230), Expect = 2e-26
 Identities = 16/55 (29%), Positives = 27/55 (49%)

Query: 66  ERFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVE 120
           +R   +  + P ++ EL L  GD++++  K   GW     +   +TGL P  FV 
Sbjct: 2   QRAVALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVS 56


>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Length = 83 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Length = 655 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.86
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.85
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.81
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.8
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.8
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.8
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.8
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.8
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.79
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.79
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.79
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.79
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 99.79
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.79
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.79
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.79
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.78
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.78
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.78
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.78
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.78
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.78
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.78
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.78
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.78
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.78
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.78
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.78
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.78
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.78
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.78
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.78
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 99.78
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.78
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 99.78
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.78
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.78
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.78
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.78
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.78
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 99.78
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.77
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.77
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.77
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.77
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.77
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.77
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.77
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.77
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 99.77
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.77
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.77
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.77
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.77
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.77
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.77
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.77
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 99.77
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.77
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.77
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.77
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.77
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.77
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 99.77
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.77
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 99.77
3u23_A65 CD2-associated protein; structural genomics, struc 99.77
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.77
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 99.77
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.77
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 99.77
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.77
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 99.77
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.77
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 99.77
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 99.77
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 99.76
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.76
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.76
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.76
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.76
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 99.76
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.76
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 99.76
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 99.76
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.76
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.76
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.76
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.76
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 99.76
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 99.76
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.76
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 99.76
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 99.76
2cuc_A70 SH3 domain containing ring finger 2; structural ge 99.76
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.76
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.76
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.76
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 99.76
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.76
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.76
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 99.76
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.76
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 99.75
2da9_A70 SH3-domain kinase binding protein 1; structural ge 99.75
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.75
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 99.75
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.75
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.75
2dil_A69 Proline-serine-threonine phosphatase-interacting p 99.75
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 99.75
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.75
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 99.75
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 99.75
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 99.75
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.75
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 99.75
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.75
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 99.75
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.75
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 99.75
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 99.75
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.74
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 99.74
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 99.74
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 99.74
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.74
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 99.74
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.74
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 99.74
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 99.74
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 99.74
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 99.74
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 99.74
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 99.74
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 99.74
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 99.74
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 99.74
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 99.73
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 99.73
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 99.73
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.73
1i07_A60 Epidermal growth factor receptor kinase substrate 99.73
1wxb_A68 Epidermal growth factor receptor pathway substrate 99.73
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 99.73
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.73
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.73
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 99.72
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 99.72
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 99.72
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 99.72
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 99.72
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 99.72
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 99.71
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 99.71
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 99.7
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 99.7
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 99.7
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 99.7
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 99.7
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.69
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 99.69
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.69
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 99.68
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 99.67
1awj_A77 ITK; transferase, regulatory intramolecular comple 99.67
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 99.67
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 99.66
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 99.64
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 99.63
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.62
4d8k_A 175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.61
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.6
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.59
1ng2_A 193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.59
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.57
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 99.57
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.55
2eyz_A 304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.54
2dyb_A 341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 99.53
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.52
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 99.52
3a98_A 184 DOCK2, dedicator of cytokinesis protein 2; protein 99.5
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 99.5
3qwy_A 308 Cell death abnormality protein 2; cell engulfment, 99.48
1u3o_A82 Huntingtin-associated protein-interacting protein; 99.48
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.48
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 99.48
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.48
2lqn_A 303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 99.2
1gri_A 217 Growth factor bound protein 2; SH2, SH3, signal tr 99.44
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 99.16
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.43
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 99.42
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.42
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.39
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 99.35
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 99.32
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 99.32
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 99.26
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 99.24
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 99.09
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 99.05
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 98.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.96
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.94
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.92
3kfv_A 308 Tight junction protein ZO-3; structural genomics c 98.89
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.83
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 98.82
3tvt_A 292 Disks large 1 tumor suppressor protein; DLG, SRC-h 98.73
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 98.6
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 98.28
3r6n_A 450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 98.09
1wfw_A74 Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex 96.61
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_058 96.59
2kt8_A76 Probable surface protein; SH3 family, structural g 96.38
2kq8_A70 Cell WALL hydrolase; GFT protein structure, NESG, 96.06
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 95.13
3npf_A 306 Putative dipeptidyl-peptidase VI; structural genom 92.87
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 92.84
2hbw_A 235 NLP/P60 protein; NLP/P60 family protein, structura 88.67
3h41_A 311 NLP/P60 family protein; NLPC/P60 family protein, s 84.2
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
Probab=99.86  E-value=1.9e-21  Score=110.33  Aligned_cols=58  Identities=40%  Similarity=0.769  Sum_probs=54.5

Q ss_pred             ccEEEEeeeCCCCCCCceecCCCCEEEEEEeCCCCeEEEEEcCCCcEEEecCCCeEEC
Q psy9679          65 RERFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVESF  122 (122)
Q Consensus        65 ~~~~~al~dy~~~~~~eL~~~~gd~i~v~~~~~~gW~~g~~~~~g~~G~~P~~yv~~~  122 (122)
                      ...++|+|||.++.++||+|++||+|.|+++.++|||.|++.++|++||||++||++|
T Consensus         6 ~~~~~Alydy~a~~~~ELs~~~Gd~i~v~~~~~~gWw~g~~~~~g~~G~~P~nyVe~l   63 (65)
T 2lj0_A            6 LFSYQALYSYIPQNDDELELRDGDIVDVMEKCDDGWFVGTSRRTKQFGTFPGNYVKPL   63 (65)
T ss_dssp             SCEEEESSCBCCSSTTBCCBCTTCEEEEEEECTTSEEEEEETTTCCEEEEETTSEEEC
T ss_pred             CEEEEEceeECCCCcCCcCCCCCCEEEEeEeCCCCEEEEEECCCCCEEEEehhHeEEE
Confidence            4579999999999999999999999999999999999999977899999999999985



>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
>2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>3npf_A Putative dipeptidyl-peptidase VI; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: CSA GOL; 1.72A {Bacteroides ovatus} PDB: 3pvq_A Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>2hbw_A NLP/P60 protein; NLP/P60 family protein, structural genomics, joint center FO structural genomics, JCSG, protein structure initiative; HET: UNL; 1.05A {Anabaena variabilis} PDB: 2evr_A 2fg0_A Back     alignment and structure
>3h41_A NLP/P60 family protein; NLPC/P60 family protein, structural genomics, joint center F structural genomics, JCSG; HET: DGL PG4; 1.79A {Bacillus cereus atcc 10987} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 122
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 5e-18
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 2e-17
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 8e-17
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 9e-17
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 1e-16
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 2e-16
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 2e-16
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 2e-16
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 3e-16
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 4e-16
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 9e-16
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 1e-15
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 1e-15
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 7e-15
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-14
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 2e-14
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 4e-14
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 5e-14
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 7e-14
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 1e-13
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 1e-13
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 2e-13
d2v1ra167 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe 2e-13
d1phta_83 b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a 3e-13
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 6e-13
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 7e-13
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-12
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 2e-12
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 2e-12
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 2e-12
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 3e-12
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 3e-12
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 5e-12
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 8e-12
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 8e-12
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 1e-11
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 1e-11
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 5e-11
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 1e-10
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 1e-10
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 6e-10
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 2e-09
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 1e-08
d1wfwa_74 b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta 3e-07
d1i1ja_106 b.34.2.1 (A:) Melanoma inhibitory activity protein 4e-07
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 9e-06
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 5e-05
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 2e-04
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: SH3 domain from nebulin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 69.8 bits (171), Expect = 5e-18
 Identities = 23/55 (41%), Positives = 33/55 (60%)

Query: 66  ERFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVE 120
           + FR +  Y      E+  + GD I   +  D+GW  GT+QRTGRTG+ PA++VE
Sbjct: 4   KIFRAMYDYMAADADEVSFKDGDAIINVQAIDEGWMYGTVQRTGRTGMLPANYVE 58


>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.84
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.84
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.84
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.83
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.83
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.82
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.82
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.81
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.81
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.81
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.81
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.8
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 99.8
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.8
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.8
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.8
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.8
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.79
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.79
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.78
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.78
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.78
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.77
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.77
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.77
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.76
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.76
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.76
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.76
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.76
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 99.76
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.76
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.75
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.75
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 99.75
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.75
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.75
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.74
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 99.73
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.73
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.73
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.68
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 99.66
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.65
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 99.52
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 99.36
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 97.55
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: Actin binding protein ABP1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.84  E-value=1.7e-21  Score=106.87  Aligned_cols=57  Identities=28%  Similarity=0.464  Sum_probs=53.9

Q ss_pred             cEEEEeeeCCCCCCCceecCCCCEEEEEEeCCCCeEEEEEcCCCcEEEecCCCeEEC
Q psy9679          66 ERFRCIVPYPPNSEYELELRVGDLIYVHKKRDDGWYKGTLQRTGRTGLFPASFVESF  122 (122)
Q Consensus        66 ~~~~al~dy~~~~~~eL~~~~gd~i~v~~~~~~gW~~g~~~~~g~~G~~P~~yv~~~  122 (122)
                      ++|+|+|||.++.++||+|++||+|.|+++.+++||.|++.++|++|+||++||+.+
T Consensus         1 P~~~Alydy~~~~~~eLs~~~Gd~i~v~~~~~~~Ww~~~~~~~g~~G~~P~~yVe~i   57 (58)
T d1jo8a_           1 PWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYVSLG   57 (58)
T ss_dssp             CCEEESSCBCCCSTTBCCBCTTCEEEEEECCSSSEEEEEETTTCCEEEEEGGGEEEC
T ss_pred             CEEEEccCCCCCCcCCcCCCCCCEEEEEEEcCCCEEEEEECCCCCEEEEchHHEEEc
Confidence            369999999999999999999999999999999999999987899999999999975



>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure