Psyllid ID: psy9685

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------98
MTALVMHCILLFVAINSSHLVLAANEEQTIYPINPITQFEQPTSLSQSQTSFPTTTNFTFVTSPDFTAATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVVRNVTLVQVKLNGTEYFRKTISSTGILDVQVLYLGGIPETVHHHRSIRSPYQPSRSYPSGGHCTDLWRDFSCSCVRPFLGHTCQYNFTAATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQTISSTGILDVQVLYLGGIPETVHHHRSIRSPYQPSRSYPRWATYDEMENYTTARRRYSRQTAGEKQFSPLPNFKGIIHDVQIYFISGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVGPGFDFQRIDHPFTKKHVIVCVLNAHQLSGISDQADLVRCTSEAYLNLIIYISWLLSPHDSDPLTSYACKCPAGYSSETCAVDIDECVTHNCQNGARCIDGVARYSCECTPGWEGALCEKEIDECLSNPCMNGGQCEDRLAGFVCNCSEEYVGERCESLRQISCADQPCYFGAVCQDTKISPYFPQGPICDCPPGYRGSRCEINIDECASGPCKNSGQCIDDVNAFICNCTNTATGASMGCLGEVRLGDLLLPYFTWEQLGYTDTLSCPECFSLDSGPGGPGLADSGPGVQTTPILGYTGEMCEIDINECELSSDMCGNNGECINQPGDYKCACQFDTCGYLCNFPDPCKDEPCQNGGTCHEDCRHQADYKCDCLPGWTGKNCTEVPEYLPSRVVDLALLIIGPILAILLLGGLISMAVLCLMARQKRGRRGTYSPSSQEYCNPRVEMNNVLKPPPEERLI
ccHHHHHHEEEEEEEccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccccccEEEEEEEccccEEEEEEcccccccccccccccccccEEEEEEEcccEEEEEEEccccccccccccEEccccccEEEccccccccEEEEcccccccccccccEEEEccccEEEcccccccccccccccccccccccccccEEEEccccEEEEcccccccccccccccccccccccccccccccccccEEcccccccEEccccccccccccccccccccccccccccccccccccccEEEEccccEEEEEEccccccccccccccEEEccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccEEcccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEEccccEEEEcccccccccccccccccccccccccccEEcccccccccccccEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccEEcccccccEEEcccccccccccccccccccccccccEEcccccEEEEccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccEEcccccccccEEEEcccccccccccccccccccccccccEEEEccccEEEccccEEEccccEEEEEcccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHccHHEEEccccccEcccccccccccccccccccccccccccccccEEEcccccccccccccccEEEEEEccccccccEcEEEEEEEEEEccccccEEEEcccccccccccccccccccEEEEEEEEcccEEEEEEccccccEEEEcccccccccccEEEEEEEcEEEEEEEccccEEEEcccccccccccEEEccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccEEccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccEccccccEEEEcccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccEEccccccccccccEEEEccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccEEEEccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccEEEccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccc
MTALVMHCILLFVAINSSHLvlaaneeqtiypinpitqfeqptslsqsqtsfptttnftfvtspdftaatfghenttnsLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYlggsgdrsspssngagseetSYIAAEMEAGELFVRLQfnstpesynvggvkladgnnhLIQVVRNVTLVQVKLNGTEYFRKTISSTGILDVQVLYlggipetvhhhrsirspyqpsrsypsgghctdlwrdfscscvrpflghtcqynftaatfghenttnsLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYlggsgdrsspssngagseetSYIAAEMEAGELFVRLQfnstpesynvggvkladgnnhliQTISSTGILDVQVLYlggipetvhhhrsirspyqpsrsyprwatydemeNYTTARRRYSrqtagekqfsplpnfkgiiHDVQIYFisgsgdrsspssngagseetSYIAAEMEAGELFVRLQfnstpesynvggvkladgnnhliqvgpgfdfqridhpftkKHVIVCVLNahqlsgisdqadLVRCTSEAYLNLIIYISWllsphdsdpltsyackcpagyssetcavdidecvthncqngarcidgvaryscectpgwegalCEKEIdeclsnpcmnggqcedrlagfvcncseeyvgerceslrqiscadqpcyfgavcqdtkispyfpqgpicdcppgyrgsrceinidecasgpcknsgqciddVNAFICNctntatgasmgclgevrlgdlllpyftweqlgytdtlscpecfsldsgpggpgladsgpgvqttpilgytgemceidinecelssdmcgnngecinqpgdykcacqfdtcgylcnfpdpckdepcqnggtchedcrhqadykcdclpgwtgknctevpeylpsrVVDLALLIIGPILAILLLGGLISMAVLCLMARqkrgrrgtyspssqeycnprvemnnvlkpppeerli
MTALVMHCILLFVAINSSHLVLAANEEQTIYPINPITQFEQPTSLSQSQTSFPTTTNFTFVTSPDFTAAtfghenttnslVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGgsgdrsspssngAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVVRNVTLVQVKLNGTEYFRktisstgiLDVQVLYLGGIPETVHHHRSIRSPYQPSRSYPSGGHCTDLWRDFSCSCVRPFLGHTCQYNFTAATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGgsgdrsspssngAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQTISSTGILDVQVLYLGGIPETVhhhrsirspyqpsrsyprwatyDEMENYTTARRRYSRqtagekqfsplpnfkgiIHDVQIYFISGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVGPGFDFQRIDHPFTKKHVIVCVLNAHQLSGISDQADLVRCTSEAYLNLIIYISWLLSPHDSDPLTSYACKCPAGYSSETCAVDIDECVTHNCQNGARCIDGVARYSCECTPGWEGALCEKEIDECLSNPCMNGGQCEDRLAGFVCNCSEEYVGERCESLRQISCADQPCYFGAVCQDTKISPYFPQGPICDCPPGYRGSRCEINIDECASGPCKNSGQCIDDVNAFICNCTNTATGASMGCLGEVRLGDLLLPYFTWEQLGYTDTLSCPECFSLDSGPGGPGLADSGPGVQTTPILGYTGEMCEIDINECELSSDMCGNNGECINQPGDYKCACQFDTCGYLCNFPDPCKDEPCQNGGTCHEDCRHQADYKCDCLPGWTGKNCTEVPEYLPSRVVDLALLIIGPILAILLLGGLISMAVLCLMARqkrgrrgtyspssqeycnprvemnnvlkpppeerli
MTALVMHCILLFVAINSSHLVLAANEEQTIYPINPITQFEQPTSLSQSQTSFPTTTNFTFVTSPDFTAATFGHENTTNSLVTvavggvarravrNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVVRNVTLVQVKLNGTEYFRKTISSTGILDVQVLYLGGIPETVHHHrsirspyqpsrsypsGGHCTDLWRDFSCSCVRPFLGHTCQYNFTAATFGHENTTNSLVTvavggvarravrNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQTISSTGILDVQVLYLGGIPETVHHHRSIRSPYQPSRSYPRWATYDEMENYTTARRRYSRQTAGEKQFSPLPNFKGIIHDVQIYFIsgsgdrsspssngAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVGPGFDFQRIDHPFTKKHVIVCVLNAHQLSGISDQADLVRCTSEAYLNLIIYISWLLSPHDSDPLTSYACKCPAGYSSETCAVDIDECVTHNCQNGARCIDGVARYSCECTPGWEGALCEKEIDECLSNPCMNGGQCEDRLAGFVCNCSEEYVGERCESLRQISCADQPCYFGAVCQDTKISPYFPQGPICDCPPGYRGSRCEINIDECASGPCKNSGQCIDDVNAFICNCTNTATGASMGCLGEVRLGDLLLPYFTWEQLGYTDTLSCPECFSLDSGPGGPGLADSGPGVQTTPILGYTGEMCEIDINECELSSDMCGNNGECINQPGDYKCACQFDTCGYLCNFPDPCKDEPCQNGGTCHEDCRHQADYKCDCLPGWTGKNCTEVPEYLPSRVVDlalliigpilailllggliSMAVLCLMARQKRGRRGTYSPSSQEYCNPRVEMNNVLKPPPEERLI
**ALVMHCILLFVAINSSHLVLAANEEQTIYPINPITQF**************TTTNFTFVTSPDFTAATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLG********************IAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVVRNVTLVQVKLNGTEYFRKTISSTGILDVQVLYLGGIPETVHHHRS************SGGHCTDLWRDFSCSCVRPFLGHTCQYNFTAATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLG********************IAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQTISSTGILDVQVLYLGGIPETVHHHRSI*********YPRWATYDEMENY******************PLPNFKGIIHDVQIYFIS********************IAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVGPGFDFQRIDHPFTKKHVIVCVLNAHQLSGISDQADLVRCTSEAYLNLIIYISWLLSPHDSDPLTSYACKCPAGYSSETCAVDIDECVTHNCQNGARCIDGVARYSCECTPGWEGALCEKEIDECLSNPCMNGGQCEDRLAGFVCNCSEEYVGERCESLRQISCADQPCYFGAVCQDTKISPYFPQGPICDCPPGYRGSRCEINIDECASGPCKNSGQCIDDVNAFICNCTNTATGASMGCLGEVRLGDLLLPYFTWEQLGYTDTLSCPECFSLD**************VQTTPILGYTGEMCEIDINECELSSDMCGNNGECINQPGDYKCACQFDTCGYLCNFPDPCKDEPCQNGGTCHEDCRHQADYKCDCLPGWTGKNCTEVPEYLPSRVVDLALLIIGPILAILLLGGLISMAVLCLMAR************************************
*TALVMHCILLFVAINSSHLVLAANEEQTIYPINPITQFEQPTSLSQSQTSFPTTTNFTFVTSPDFTAATFGHENTTNSLVTVA***V**RAVRNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVVRNVTLVQVKLNGTEYFRKTISSTGILDVQVLYLGGIPETVHHHRSIRSPYQPSRSYPSGGHCTDLWRDFSCSCVRPFLGHTCQYNFTAATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQTISSTGILDVQVLYLGGIPETVHHHRSIRSPYQPSRSYPRWATYDEMENYTTARRRYSRQTAGEKQFSPLPNFKGIIHDVQIYFISGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVGPGFDFQRIDHPFTKKHVIVCVLNAHQLSGISDQADLVRCTSEAYLNLIIYISWLLSPHDSDPLTSYACKCPAGYSSETCAVDIDECVTHNCQNGARCIDGVARYSCECTPGWEGALCEKEIDECLSNPCMNGGQCEDRLAGFVCNCSEEYVGERCESLRQISCADQPCYFGAVCQDTKISPYFPQGPICDCPPGYRGSRCEINIDECASGPCKNSGQCIDDVNAFICNCTNTATGASMGCLGEVRLGDLLLPYFTWEQLGYTDTLSCPECFSLDSGPGGPGLADSGPGVQTTPILGYTGEMCEIDINECELSSDMCGNNGECINQPGDYKCACQFDTCGYLCNFPDPCKDEPCQNGGTCHEDCRHQADYKCDCLPGWTGKNCTEVPEYLPSRVVDLALLIIGPILAILLLGGLISMAVLCLMARQKRGRRGTYSPSSQEYCNPRVEMNNVLKPPPEERLI
MTALVMHCILLFVAINSSHLVLAANEEQTIYPINPITQFE***********FPTTTNFTFVTSPDFTAATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGS****************SYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVVRNVTLVQVKLNGTEYFRKTISSTGILDVQVLYLGGIPETVHHH***************GGHCTDLWRDFSCSCVRPFLGHTCQYNFTAATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGS****************SYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQTISSTGILDVQVLYLGGIPETVHHHRSIRSPYQPSRSYPRWATYDEMENYTTARRRYSRQTAGEKQFSPLPNFKGIIHDVQIYFISGS***************TSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVGPGFDFQRIDHPFTKKHVIVCVLNAHQLSGISDQADLVRCTSEAYLNLIIYISWLLSPHDSDPLTSYACKCPAGYSSETCAVDIDECVTHNCQNGARCIDGVARYSCECTPGWEGALCEKEIDECLSNPCMNGGQCEDRLAGFVCNCSEEYVGERCESLRQISCADQPCYFGAVCQDTKISPYFPQGPICDCPPGYRGSRCEINIDECASGPCKNSGQCIDDVNAFICNCTNTATGASMGCLGEVRLGDLLLPYFTWEQLGYTDTLSCPECFSLDSGPGGPGLADSGPGVQTTPILGYTGEMCEIDINECELSSDMCGNNGECINQPGDYKCACQFDTCGYLCNFPDPCKDEPCQNGGTCHEDCRHQADYKCDCLPGWTGKNCTEVPEYLPSRVVDLALLIIGPILAILLLGGLISMAVLCLMARQ************QEYCNPRVEMNNVLKPPPEERLI
*TALVMHCILLFVAINSSHLVLAANEEQTIYPINPITQFE*********TSFPTTTNFTFVTSPDFTAATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVVRNVTLVQVKLNGTEYFRKTISSTGILDVQVLYLGGIPETVHHHRSIRSPYQPSRSYPSGGHCTDLWRDFSCSCVRPFLGHTCQYNFTAATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQTISSTGILDVQVLYLGGIPETVHHHRSIRSPYQPSRSYPRWATYDEMENYTTARRRYSRQTAGEKQFSPLPNFKGIIHDVQIYFISGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVGPGFDFQRIDHPFTKKHVIVCVLNAHQLSGISDQADLVRCTSEAYLNLIIYISWLLSPHDSDPLTSYACKCPAGYSSETCAVDIDECVTHNCQNGARCIDGVARYSCECTPGWEGALCEKEIDECLSNPCMNGGQCEDRLAGFVCNCSEEYVGERCESLRQISCADQPCYFGAVCQDTKISPYFPQGPICDCPPGYRGSRCEINIDECASGPCKNSGQCIDDVNAFICNCTNTATGASMGCLGEVRLGDLLLPYFTWEQLGYTDTLSCPECFSLDSGPGGPGLADSGPGVQTTPILGYTGEMCEIDINECELSSDMCGNNGECINQPGDYKCACQFDTCGYLCNFPDPCKDEPCQNGGTCHEDCRHQADYKCDCLPGWTGKNCTEVPEYLPSRVVDLALLIIGPILAILLLGGLISMAVLCLMARQKRGRRGTYSPSSQEYCNPRVEMNNVLKPPP*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTALVMHCILLFVAINSSHLVLAANEEQTIYPINPITQFEQPTSLSQSQTSFPTTTNFTFVTSPDFTAATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVVRNVTLVQVKLNGTEYFRKTISSTGILDVQVLYLGGIPETVHHHRSIRSPYQPSRSYPSGGHCTDLWRDFSCSCVRPFLGHTCQYNFTAATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQTISSTGILDVQVLYLGGIPETVHHHRSIRSPYQPSRSYPRWATYDEMENYTTARRRYSRQTAGEKQFSPLPNFKGIIHDVQIYFISGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVGPGFDFQRIDHPFTKKHVIVCVLNAHQLSGISDQADLVRCTSEAYLNLIIYISWLLSPHDSDPLTSYACKCPAGYSSETCAVDIDECVTHNCQNGARCIDGVARYSCECTPGWEGALCEKEIDECLSNPCMNGGQCEDRLAGFVCNCSEEYVGERCESLRQISCADQPCYFGAVCQDTKISPYFPQGPICDCPPGYRGSRCEINIDECASGPCKNSGQCIDDVNAFICNCTNTATGASMGCLGEVRLGDLLLPYFTWEQLGYTDTLSCPECFSLDSGPGGPGLADSGPGVQTTPILGYTGEMCEIDINECELSSDMCGNNGECINQPGDYKCACQFDTCGYLCNFPDPCKDEPCQNGGTCHEDCRHQADYKCDCLPGWTGKNCTEVPEYLPSRVVDLALLIIGPILAILLLGGLISMAVLCLMARQKRGRRGTYSPSSQEYCNPRVEMNNVLKPPPEERLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query979 2.2.26 [Sep-21-2011]
P10079 1064 Fibropellin-1 OS=Strongyl no N/A 0.403 0.371 0.348 1e-50
P100402146 Protein crumbs OS=Drosoph yes N/A 0.332 0.151 0.337 5e-50
P07207 2703 Neurogenic locus Notch pr no N/A 0.319 0.115 0.370 3e-49
P46530 2437 Neurogenic locus notch ho yes N/A 0.318 0.128 0.356 1e-46
P82279 1406 Protein crumbs homolog 1 yes N/A 0.274 0.191 0.364 1e-43
Q8VHS2 1405 Protein crumbs homolog 1 yes N/A 0.316 0.220 0.358 5e-41
P21783 2524 Neurogenic locus notch pr N/A N/A 0.314 0.122 0.357 7e-41
Q5T1H1 3165 Protein eyes shut homolog no N/A 0.355 0.109 0.333 1e-40
Q01705 2531 Neurogenic locus notch ho no N/A 0.322 0.124 0.344 2e-40
Q9UM47 2321 Neurogenic locus notch ho no N/A 0.287 0.121 0.313 2e-39
>sp|P10079|FBP1_STRPU Fibropellin-1 OS=Strongylocentrotus purpuratus GN=EGF1 PE=1 SV=2 Back     alignment and function desciption
 Score =  202 bits (514), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 156/447 (34%), Positives = 207/447 (46%), Gaps = 52/447 (11%)

Query: 505 GVKLADG-NNHLIQVGPGFDF----QRIDHPFTK--KHVIVCVLNAHQL--------SGI 549
           G    DG N ++    PGFD       ID   ++  ++  VCV   +          +G+
Sbjct: 416 GGDCVDGVNGYVCICAPGFDGLNCENNIDECASRPCQNGAVCVDGVNGFVCTCSAGYTGV 475

Query: 550 SDQADLVRCTSEAYLNLIIYISWLLSPHDSDPLTSYACKCPAGYSSETCAVDIDECVTHN 609
             + D+  C S   LN  +          +D +  Y C C AG+    C  D DEC +  
Sbjct: 476 LCETDINECASMPCLNGGVC---------TDLVNGYICTCAAGFEGTNCETDTDECASFP 526

Query: 610 CQNGARCIDGVARYSCECTPGWEGALCEKEIDECLSNPCMNGGQCEDRLAGFVCNCSEEY 669
           CQNGA C D V  Y C C PG+ G LCE +I+EC S PC+NGG C D++ G+VC C+++ 
Sbjct: 527 CQNGATCTDQVNGYVCTCVPGYTGVLCETDINECASFPCLNGGTCNDQVNGYVCVCAQDT 586

Query: 670 VGERCESLRQISCADQPCYFGAVCQDTKISPYFPQGPICDCPPGYRGSRCEINIDECASG 729
               CE+ R   CA  PC  G  C D         G +C C PG+ G+ CEIN DECAS 
Sbjct: 587 SVSTCETDRD-ECASAPCLNGGACMDVV------NGFVCTCLPGWEGTNCEINTDECASS 639

Query: 730 PCKNSGQCIDDVNAFICNCTNTATG----------ASMGCLGEVRLGDLLLPYFTWEQLG 779
           PC N G C+D VN+++C C    TG          AS  CL   +  D +  Y      G
Sbjct: 640 PCMNGGLCVDQVNSYVCFCLPGFTGIHCGTEIDECASSPCLNGGQCIDRVDSYECVCAAG 699

Query: 780 YTDT---LSCPECFSLDSGPGGPGLADSGPGVQTTPILGYTGEMCEIDINECELSSDMCG 836
           YT     ++  EC S     GG    D   G       GYTG+ CE +I+EC  +S  C 
Sbjct: 700 YTAVRCQINIDECASAPCQNGGV-CVDGVNGYVCNCAPGYTGDNCETEIDEC--ASMPCL 756

Query: 837 NNGECINQPGDYKCACQFDTCGYLCNFP-DPCKDEPCQNGGTCHEDCRHQADYKCDCLPG 895
           N G CI     Y C C     G +C    D C   PCQNGG C +       Y C C+PG
Sbjct: 757 NGGACIEMVNGYTCQCVAGYTGVICETDIDECASAPCQNGGVCTDTING---YICACVPG 813

Query: 896 WTGKNC-TEVPEYLPSRVVDLALLIIG 921
           +TG NC T + E      ++  + + G
Sbjct: 814 FTGSNCETNIDECASDPCLNGGICVDG 840
Forms the apical lamina, a component of the extracellular matrix.
Strongylocentrotus purpuratus (taxid: 7668)
>sp|P10040|CRB_DROME Protein crumbs OS=Drosophila melanogaster GN=crb PE=1 SV=3 Back     alignment and function description
>sp|P07207|NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 Back     alignment and function description
>sp|P46530|NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio GN=notch1a PE=2 SV=1 Back     alignment and function description
>sp|P82279|CRUM1_HUMAN Protein crumbs homolog 1 OS=Homo sapiens GN=CRB1 PE=1 SV=2 Back     alignment and function description
>sp|Q8VHS2|CRUM1_MOUSE Protein crumbs homolog 1 OS=Mus musculus GN=Crb1 PE=1 SV=3 Back     alignment and function description
>sp|P21783|NOTCH_XENLA Neurogenic locus notch protein homolog OS=Xenopus laevis GN=notch1 PE=1 SV=3 Back     alignment and function description
>sp|Q5T1H1|EYS_HUMAN Protein eyes shut homolog OS=Homo sapiens GN=EYS PE=1 SV=5 Back     alignment and function description
>sp|Q01705|NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus GN=Notch1 PE=1 SV=3 Back     alignment and function description
>sp|Q9UM47|NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens GN=NOTCH3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query979
328709399 2180 PREDICTED: protein crumbs-like isoform 4 0.370 0.166 0.426 4e-78
328709397 2180 PREDICTED: protein crumbs-like isoform 3 0.370 0.166 0.426 4e-78
328709393 2304 PREDICTED: protein crumbs-like isoform 1 0.370 0.157 0.426 1e-77
328709395 2304 PREDICTED: protein crumbs-like isoform 2 0.370 0.157 0.426 1e-77
380013994 2055 PREDICTED: LOW QUALITY PROTEIN: protein 0.338 0.161 0.390 9e-75
328790651 2175 PREDICTED: protein crumbs [Apis mellifer 0.338 0.152 0.390 1e-74
307211378 2241 Protein crumbs [Harpegnathos saltator] 0.381 0.166 0.426 5e-74
332020655 2020 Protein crumbs [Acromyrmex echinatior] 0.370 0.179 0.406 3e-73
157120681642 crumbs [Aedes aegypti] gi|108874849|gb|E 0.344 0.524 0.387 2e-70
312375241 2374 hypothetical protein AND_14398 [Anophele 0.371 0.153 0.403 2e-68
>gi|328709399|ref|XP_003243948.1| PREDICTED: protein crumbs-like isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  299 bits (766), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 171/401 (42%), Positives = 229/401 (57%), Gaps = 38/401 (9%)

Query: 584  SYACKCPAGYSSETCAVDIDECVTHNCQNGARCIDGVARYSCECTPGWEGALCEKEIDEC 643
            SY C+C  GY ++ C+ +I+EC+++ C+N A CIDG+A Y+C+C  GW G  CE +I+EC
Sbjct: 1813 SYVCECQPGYEADDCSANINECLSNECRNSAECIDGIANYTCQCKIGWMGTFCEIDINEC 1872

Query: 644  LSNPCMNGGQCEDRLAGFVCNCSEEYVGERCESLRQISCADQPCYFGAVCQDTKISPYFP 703
             SNPC + G C D+L  F CNC+++Y G+ CE L+ ++C + PC  GA C   KI   F 
Sbjct: 1873 ESNPCHHNGICIDQLGDFECNCTDDYEGKTCEQLKLVTCDNLPCKNGANC--FKIPDQFG 1930

Query: 704  QGPICDCPPGYRGSRCEINIDECASGPCKNSGQCIDDVNAFICNCTNTATGASMGCLGEV 763
                C C  G+ G+ C+     C +  C+N+G C  + + F C C     G     L E 
Sbjct: 1931 NNYTCSCLEGFSGTTCDTAF--CDTNECQNNGLCKKEESPF-CECPLGFKGH----LCEQ 1983

Query: 764  RLGDLLLPYFTWEQLGYTDTLSCPECFSLDSGP----GGPGLADSGPGVQTTPILGYTGE 819
             + D                     CF  D+      GG  +             GYTG+
Sbjct: 1984 NIDD---------------------CFDNDNQQKCQHGGQCIDGINEFTCNCTDTGYTGD 2022

Query: 820  MCEIDINECELSSDMCGNNGECINQPGDYKCACQFDTCGYLCNFPDPCKDE-PCQNGGTC 878
             C IDI+EC   +  CG+ GEC N PG + CAC+   CG  C+  +PC  E PC NGG C
Sbjct: 2023 DCSIDIDECFDLNIQCGHRGECKNTPGSFICACEKGYCGNYCDLINPCLPENPCNNGGFC 2082

Query: 879  HEDCRHQADYKCDCLPGWTGKNCTEVPEYLPSRVVDLALLIIGPILAILLLGGLISMAVL 938
             E C     Y+C C  G+ G+NCTE+P  +     D+AL I+GPIL ILL+GG+ S+ VL
Sbjct: 2083 QEHCTDVIVYECQCANGYVGQNCTELP--IIHNYADIAL-IVGPILLILLIGGMGSLLVL 2139

Query: 939  CLMARQKRGRRGTYSPSSQEYCNPRVEMNNVLKPPPEERLI 979
             +MAR+KR  RGTYSPS QEYCNPRVE++NVLKPPPEERLI
Sbjct: 2140 LMMARKKRATRGTYSPSCQEYCNPRVELDNVLKPPPEERLI 2180

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328709397|ref|XP_003243947.1| PREDICTED: protein crumbs-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328709393|ref|XP_001950069.2| PREDICTED: protein crumbs-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328709395|ref|XP_003243946.1| PREDICTED: protein crumbs-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|380013994|ref|XP_003691029.1| PREDICTED: LOW QUALITY PROTEIN: protein crumbs-like [Apis florea] Back     alignment and taxonomy information
>gi|328790651|ref|XP_001121416.2| PREDICTED: protein crumbs [Apis mellifera] Back     alignment and taxonomy information
>gi|307211378|gb|EFN87505.1| Protein crumbs [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332020655|gb|EGI61061.1| Protein crumbs [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157120681|ref|XP_001659720.1| crumbs [Aedes aegypti] gi|108874849|gb|EAT39074.1| AAEL009093-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|312375241|gb|EFR22654.1| hypothetical protein AND_14398 [Anopheles darlingi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query979
FB|FBgn02596852146 crb "crumbs" [Drosophila melan 0.372 0.170 0.382 1.1e-107
ZFIN|ZDB-GENE-060612-1 1466 crb2a "crumbs homolog 2a" [Dan 0.304 0.203 0.362 4.4e-43
ZFIN|ZDB-GENE-990415-173 2437 notch1a "notch homolog 1a" [Da 0.316 0.127 0.383 9.4e-56
FB|FBgn0004647 2703 N "Notch" [Drosophila melanoga 0.309 0.112 0.378 3.9e-55
ZFIN|ZDB-GENE-000329-4 2475 notch2 "notch homolog 2" [Dani 0.318 0.126 0.369 3e-54
UNIPROTKB|I3LVI7504 NOTCH2 "Uncharacterized protei 0.316 0.615 0.357 3.5e-53
MGI|MGI:97363 2531 Notch1 "notch 1" [Mus musculus 0.319 0.123 0.369 4.1e-53
UNIPROTKB|G3I6Z6 2412 I79_019276 "Neurogenic locus n 0.319 0.129 0.372 4.6e-53
UNIPROTKB|E1BSB8 2434 E1BSB8 "Uncharacterized protei 0.324 0.130 0.346 3.5e-52
UNIPROTKB|F1P236 2442 F1P236 "Uncharacterized protei 0.324 0.130 0.346 3.6e-52
FB|FBgn0259685 crb "crumbs" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 625 (225.1 bits), Expect = 1.1e-107, Sum P(5) = 1.1e-107
 Identities = 152/397 (38%), Positives = 189/397 (47%)

Query:   605 CVTHNCQNGARCIDGVARYSCECTPGWEGALCEKEIDECLSNPCMNGGQCEDRLAGFVCN 664
             C   +C+N   C      Y+C C PG+EG  C  +IDECL+  C+N G C +++A F C 
Sbjct:  1760 CFQSDCKNDGFCQSPSDEYACTCQPGFEGDDCGTDIDECLNTECLNNGTCINQVAAFFCQ 1819

Query:   665 CSEEYVGERCESLRQISCADQPCYFGAVCQDTKISPYF---PQ---GPICDCPPGYRGSR 718
             C   + G+ CE      CADQPC+ G  C D  I+ Y    P+   GP CD     +   
Sbjct:  1820 CQPGFEGQHCEQNID-ECADQPCHNGGNCTDL-IASYVCDCPEDYMGPQCDV---LKQMT 1874

Query:   719 CEINIDECASGP-CKNSGQCIDDVNAFICNCTNTATGASMG---C-LGEVRLGDLLLPYF 773
             CE N + C +G  C+N G      N F C C     G       C +     G L L   
Sbjct:  1875 CE-N-EPCRNGSTCQN-GFNASTGNNFTCTCVPGFEGPLCDIPFCEITPCDNGGLCLTTG 1931

Query:   774 TWEQ----LGYTDTLSCPECFSLDSGP---GGPGLADSGPGVQTTPILGYTGEMCEIDIN 826
                     LGYT  L   +    +S P   GG      G         G+ G  CE DI+
Sbjct:  1932 AVPMCKCSLGYTGRLCEQDINECESNPCQNGGQCKDLVGRYECDCQGTGFEGIRCENDID 1991

Query:   827 ECELSSDMCGNNGECINQPGDYKCACQFDTCGYLCNFPDPCK-DEPCQNGGTCHEDCRHQ 885
             EC +  D CG  G C N+PG ++C CQ   CG  CNF DPC   + C NGG C E C  +
Sbjct:  1992 ECNMEGDYCGGLGRCFNKPGSFQCICQKPYCGAYCNFTDPCNATDLCSNGGRCVESCGAK 2051

Query:   886 ADYKCDCLPGWTGKNCTE---VPEYLPSRVVDXXXXXXXXXXXXXXXXXXXSMAVLCLMA 942
              DY C+C  G+ GKNCT      E  PS   D                    +    +MA
Sbjct:  2052 PDYYCECPEGFAGKNCTAPITAKEDGPS-TTDIAIIVIPVVVVLLLIAGAL-LGTFLVMA 2109

Query:   943 RQKRGRRGTYSPSSQEYCNPRVEMNNVLKPPPEERLI 979
             R KR  RGTYSPS+QEYCNPR+EM+NVLKPPPEERLI
Sbjct:  2110 RNKRATRGTYSPSAQEYCNPRLEMDNVLKPPPEERLI 2146
GO:0007163 "establishment or maintenance of cell polarity" evidence=NAS;IMP
GO:0005886 "plasma membrane" evidence=ISS;IDA
GO:0016324 "apical plasma membrane" evidence=NAS;IDA;TAS
GO:0045198 "establishment of epithelial cell apical/basal polarity" evidence=TAS
GO:0016021 "integral to membrane" evidence=NAS;TAS
GO:0048477 "oogenesis" evidence=IMP
GO:0002009 "morphogenesis of an epithelium" evidence=NAS;TAS
GO:0045197 "establishment or maintenance of epithelial cell apical/basal polarity" evidence=NAS;TAS
GO:0016334 "establishment or maintenance of polarity of follicular epithelium" evidence=IMP
GO:0042052 "rhabdomere development" evidence=NAS;IMP
GO:0045186 "zonula adherens assembly" evidence=IMP;TAS
GO:0016332 "establishment or maintenance of polarity of embryonic epithelium" evidence=IMP
GO:0016327 "apicolateral plasma membrane" evidence=IDA;IPI
GO:0005913 "cell-cell adherens junction" evidence=NAS
GO:0007043 "cell-cell junction assembly" evidence=NAS
GO:0046664 "dorsal closure, amnioserosa morphology change" evidence=IMP
GO:0045218 "zonula adherens maintenance" evidence=NAS;IMP
GO:0042051 "compound eye photoreceptor development" evidence=IMP;TAS
GO:0045494 "photoreceptor cell maintenance" evidence=NAS;IMP
GO:0016044 "cellular membrane organization" evidence=IMP;TAS
GO:0007435 "salivary gland morphogenesis" evidence=IMP
GO:0035239 "tube morphogenesis" evidence=IMP
GO:0030507 "spectrin binding" evidence=TAS
GO:0035003 "subapical complex" evidence=TAS
GO:0005918 "septate junction" evidence=TAS
GO:0007431 "salivary gland development" evidence=TAS
GO:0008104 "protein localization" evidence=TAS
GO:0001738 "morphogenesis of a polarized epithelium" evidence=TAS
GO:0034332 "adherens junction organization" evidence=IMP
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005080 "protein kinase C binding" evidence=IPI
GO:0045746 "negative regulation of Notch signaling pathway" evidence=IGI
GO:0008284 "positive regulation of cell proliferation" evidence=IMP
GO:0035088 "establishment or maintenance of apical/basal cell polarity" evidence=IMP
GO:0007424 "open tracheal system development" evidence=IMP
GO:0007399 "nervous system development" evidence=IMP
GO:0035090 "maintenance of apical/basal cell polarity" evidence=IMP
GO:0061336 "cell morphogenesis involved in Malpighian tubule morphogenesis" evidence=IMP
GO:0007443 "Malpighian tubule morphogenesis" evidence=IMP
GO:0016028 "rhabdomere" evidence=IDA
GO:0001745 "compound eye morphogenesis" evidence=IGI;IMP
GO:0042327 "positive regulation of phosphorylation" evidence=IMP
GO:0035330 "regulation of hippo signaling cascade" evidence=IGI
GO:0046621 "negative regulation of organ growth" evidence=IMP
GO:0035002 "liquid clearance, open tracheal system" evidence=IGI
ZFIN|ZDB-GENE-060612-1 crb2a "crumbs homolog 2a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-173 notch1a "notch homolog 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0004647 N "Notch" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000329-4 notch2 "notch homolog 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|I3LVI7 NOTCH2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:97363 Notch1 "notch 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3I6Z6 I79_019276 "Neurogenic locus notch-like protein 1" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSB8 E1BSB8 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P236 F1P236 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query979
smart00282132 smart00282, LamG, Laminin G domain 1e-15
cd00110151 cd00110, LamG, Laminin G domain; Laminin G-like do 4e-13
pfam00054131 pfam00054, Laminin_G_1, Laminin G domain 2e-10
smart00282132 smart00282, LamG, Laminin G domain 5e-10
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 6e-10
pfam02210124 pfam02210, Laminin_G_2, Laminin G domain 3e-09
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 1e-08
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 2e-08
cd00110151 cd00110, LamG, Laminin G domain; Laminin G-like do 5e-07
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 6e-07
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 5e-06
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 6e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 9e-06
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 7e-05
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 9e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 3e-04
pfam0000832 pfam00008, EGF, EGF-like domain 5e-04
pfam00054131 pfam00054, Laminin_G_1, Laminin G domain 6e-04
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 6e-04
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 9e-04
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 0.001
pfam02210124 pfam02210, Laminin_G_2, Laminin G domain 0.001
pfam0000832 pfam00008, EGF, EGF-like domain 0.001
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 0.001
smart00282132 smart00282, LamG, Laminin G domain 0.003
cd0005336 cd00053, EGF, Epidermal growth factor domain, foun 0.004
>gnl|CDD|214598 smart00282, LamG, Laminin G domain Back     alignment and domain information 
 Score = 73.9 bits (182), Expect = 1e-15
 Identities = 38/134 (28%), Positives = 52/134 (38%), Gaps = 19/134 (14%)

Query: 98  DISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTPE 157
            IS   RT    G + Y G  G                Y+A E+  G L +R    S P 
Sbjct: 1   SISFSFRTTSPNGLLLYAGSKGG-------------GDYLALELRDGRLVLRYDLGSGPA 47

Query: 158 SYNVGGVKLADGNNHLIQVVRNVTLVQVKLNGTEYFRKTISSTG---ILDVQ-VLYLGGI 213
                   L DG  H + V RN   V + ++G    R +  S G   IL++   LYLGG+
Sbjct: 48  RLTSDPTPLNDGQWHRVAVERNGRSVTLSVDGGN--RVSGESPGGLTILNLDGPLYLGGL 105

Query: 214 PETVHHHRSIRSPY 227
           PE +       +P 
Sbjct: 106 PEDLKLPPLPVTPG 119

Length = 132
>gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>gnl|CDD|215681 pfam00054, Laminin_G_1, Laminin G domain Back     alignment and domain information
>gnl|CDD|214598 smart00282, LamG, Laminin G domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238058 cd00110, LamG, Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|215652 pfam00008, EGF, EGF-like domain Back     alignment and domain information
>gnl|CDD|215681 pfam00054, Laminin_G_1, Laminin G domain Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|216930 pfam02210, Laminin_G_2, Laminin G domain Back     alignment and domain information
>gnl|CDD|215652 pfam00008, EGF, EGF-like domain Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|214598 smart00282, LamG, Laminin G domain Back     alignment and domain information
>gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 979
KOG3514|consensus 1591 100.0
KOG3514|consensus 1591 100.0
KOG4289|consensus 2531 100.0
KOG3516|consensus 1306 100.0
KOG3516|consensus1306 99.97
KOG4289|consensus 2531 99.97
KOG1219|consensus4289 99.97
KOG1219|consensus4289 99.91
PF00054131 Laminin_G_1: Laminin G domain; InterPro: IPR012679 99.79
KOG1226|consensus783 99.74
smart00282135 LamG Laminin G domain. 99.7
PF00054131 Laminin_G_1: Laminin G domain; InterPro: IPR012679 99.69
cd00110151 LamG Laminin G domain; Laminin G-like domains are 99.66
smart00282135 LamG Laminin G domain. 99.65
KOG1214|consensus 1289 99.59
PF02210128 Laminin_G_2: Laminin G domain; InterPro: IPR012680 99.57
KOG1217|consensus487 99.54
cd00110151 LamG Laminin G domain; Laminin G-like domains are 99.53
PF02210128 Laminin_G_2: Laminin G domain; InterPro: IPR012680 99.52
KOG0994|consensus 1758 99.42
KOG1217|consensus487 99.39
KOG1225|consensus525 99.3
KOG1214|consensus 1289 99.25
KOG1225|consensus525 99.19
KOG1226|consensus783 99.16
KOG0994|consensus 1758 99.04
KOG4260|consensus350 98.93
KOG4260|consensus350 98.9
KOG1836|consensus 1705 98.76
smart00210184 TSPN Thrombospondin N-terminal -like domains. Hepa 98.42
smart00210184 TSPN Thrombospondin N-terminal -like domains. Hepa 98.14
KOG1836|consensus 1705 98.03
PF13385157 Laminin_G_3: Concanavalin A-like lectin/glucanases 97.82
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.81
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.48
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.43
PHA03099139 epidermal growth factor-like protein (EGF-like pro 97.37
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.32
PF0000832 EGF: EGF-like domain This is a sub-family of the P 97.25
KOG3512|consensus592 97.2
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.17
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 96.99
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.87
cd00152201 PTX Pentraxins are plasma proteins characterized b 96.82
PF02973190 Sialidase: Sialidase, N-terminal domain; InterPro: 96.76
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 96.76
smart00159206 PTX Pentraxin / C-reactive protein / pentaxin fami 96.69
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.66
KOG1218|consensus316 96.58
PF13385157 Laminin_G_3: Concanavalin A-like lectin/glucanases 96.49
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 96.44
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.4
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 96.36
PF00354195 Pentaxin: Pentaxin family; InterPro: IPR001759 Pen 96.23
cd0005336 EGF Epidermal growth factor domain, found in epide 96.05
smart0018135 EGF Epidermal growth factor-like domain. 95.91
KOG1218|consensus316 95.74
cd0005336 EGF Epidermal growth factor domain, found in epide 95.73
PF1266224 cEGF: Complement Clr-like EGF-like 95.69
KOG3509|consensus 964 95.6
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.58
smart0018135 EGF Epidermal growth factor-like domain. 95.41
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 95.25
KOG3512|consensus592 95.23
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 95.0
PF1266224 cEGF: Complement Clr-like EGF-like 94.72
PF02973190 Sialidase: Sialidase, N-terminal domain; InterPro: 94.5
KOG3509|consensus964 94.18
smart00159206 PTX Pentraxin / C-reactive protein / pentaxin fami 94.18
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 93.9
PF12955103 DUF3844: Domain of unknown function (DUF3844); Int 93.82
PTZ0038296 Variant-specific surface protein (VSP); Provisiona 93.51
smart0005163 DSL delta serrate ligand. 92.22
PF15102146 TMEM154: TMEM154 protein family 92.14
cd00152201 PTX Pentraxins are plasma proteins characterized b 92.02
KOG1834|consensus952 91.61
smart00560133 LamGL LamG-like jellyroll fold domain. 91.34
PF06439185 DUF1080: Domain of Unknown Function (DUF1080); Int 91.33
PHA03099139 epidermal growth factor-like protein (EGF-like pro 91.28
PF00354195 Pentaxin: Pentaxin family; InterPro: IPR001759 Pen 90.7
smart0005163 DSL delta serrate ligand. 90.31
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 90.24
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 90.06
KOG3607|consensus716 89.2
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 88.06
smart00560133 LamGL LamG-like jellyroll fold domain. 85.45
cd01951223 lectin_L-type legume lectins. The L-type (legume-t 84.31
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 82.93
PHA02887126 EGF-like protein; Provisional 82.24
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 82.19
PF02009299 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR00 81.44
PF0103464 Syndecan: Syndecan domain; InterPro: IPR001050 The 80.23
>KOG3514|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.5e-50  Score=447.98  Aligned_cols=475  Identities=20%  Similarity=0.353  Sum_probs=349.6

Q ss_pred             cccccCCCeeEEEEeCccccccceeeEEEEEEEEeCCCCeEEEEecCCCCCCCCCCCCCCCCCCCEEEEEEeCcEEEEEE
Q psy9685          71 FGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRL  150 (979)
Q Consensus        71 Fg~~~~~~s~~~~~~~~~~~~~~~~~~~isl~FrT~~~~GlLly~~~~~~~~~~~~~~~~~~~~dfi~l~L~~G~l~~~~  150 (979)
                      |-++++++||..|+.|...     ..-+++|+|||++++|||||..+++             ..||+.|.|++|+|+++|
T Consensus        26 ~~l~Ga~~s~ary~kW~~~-----~~g~ls~e~kt~q~~glllytDdGg-------------t~df~eL~lveG~lrLrf   87 (1591)
T KOG3514|consen   26 IILTGAPDSYARYPKWAHS-----FEGSLSMELKTRQSDGLLLYTDDGG-------------THDFYELTLVEGHLRLRF   87 (1591)
T ss_pred             eEecCCCcchhhchhhhcc-----cCceeeeeeeccCCCcEEEEecCCC-------------ceeeeEEEEecceEEEEE
Confidence            4444489999999997666     6778999999999999999987532             569999999999999999


Q ss_pred             EeCCcceEEeecCeeecCCCcEEEEEEEEceEEEEEECCEEeEEEecCc-ccccccc-eeEEcCCCCccccc--------
Q psy9685         151 QFNSTPESYNVGGVKLADGNNHLIQVVRNVTLVQVKLNGTEYFRKTISS-TGILDVQ-VLYLGGIPETVHHH--------  220 (979)
Q Consensus       151 ~~g~~~~~~~~~~~~lnDg~WH~V~v~r~~~~~~L~VD~~~~~~~~~~~-~~~l~~~-~lyvGG~p~~~~~~--------  220 (979)
                      ++|+++..+.. ..+++|++||+|.|.|+.++..|.||+.++.....+. ....++- .+||||+|......        
T Consensus        88 ~Lg~~~~~~q~-~~~i~D~~WH~v~i~r~~e~t~L~vDgv~~~~~~~~~~f~fg~iasdvfVGGlP~~~~la~l~lp~v~  166 (1591)
T KOG3514|consen   88 RLGNSNEFGQR-RVRIDDDKWHTVTIFRSWENTKLEVDGVLVFKILNQRSFVFGNIASDVFVGGLPNMHMLAVLSLPLVR  166 (1591)
T ss_pred             EecCCCceeee-cceecCCceeEEEEEeccccceEEechhhhhhhhhcceeeeeeeehheeecCCChHHhhhhhcCcccc
Confidence            99977655554 4899999999999999999999999997665554433 3333333 89999999654331        


Q ss_pred             ------ccccCCCc---------------------------------cCCCCCCCCccccCCCCeeeecCCCCCCCCccc
Q psy9685         221 ------RSIRSPYQ---------------------------------PSRSYPSGGHCTDLWRDFSCSCVRPFLGHTCQY  261 (979)
Q Consensus       221 ------~~~~~~~~---------------------------------~~~pc~~~G~C~~~~~~~~C~C~~~~~g~~C~~  261 (979)
                            ..+|++..                                 ...+|.++|.|+....+.+|+|...+.|.+|++
T Consensus       167 yep~frg~~rnl~y~~~p~g~t~~q~l~~~~d~~c~d~~~~~~~~~~~~~~c~~~g~c~s~d~gp~c~c~~~~dgq~cek  246 (1591)
T KOG3514|consen  167 YEPRFRGNVRNLMYRQYPQGVTSPQLLEVGTDTNCDDHCKSKSMSSREQFVCLNDGECYSSDDGPHCDCQFDHDGQNCEK  246 (1591)
T ss_pred             cccccCccceeeeeecCCCCcCChhhhhcccCCCCcCCCCCccccccccceeccCCeEecCCCCCccccccccCcccccc
Confidence                  01111110                                 334789999999999999999999999999998


Q ss_pred             ccCc--ccccCCCcceeeEEEecCcchhccccceeEEEEEEEeccCCeEEEEecCCCCCCCCCCCCCCCCccceEEEEEe
Q psy9685         262 NFTA--ATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEME  339 (979)
Q Consensus       262 ~~~~--~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~frT~~~~GlLl~~g~~~~~~~~~~~~~~~~~~d~l~l~l~  339 (979)
                      +...  ++|++..+..|-+.  ..    ........|+|.|||.+.||||||.|.               +.||+.|.|+
T Consensus       247 eK~~~eaTF~G~ef~~YDls--~n----pI~s~~d~itl~FrT~q~ngllfytG~---------------~~dYlnlaL~  305 (1591)
T KOG3514|consen  247 EKNDGEATFGGDEFVGYDLS--QN----PIRSKKDNITLTFRTVQGNGLLFYTGD---------------EKDYLNLALQ  305 (1591)
T ss_pred             ccCcceEEecCceEEEeecc--CC----cccccccceEEEEEEecCceeEEEccC---------------CcceeeEeec
Confidence            7654  78998665554332  22    224456789999999999999999986               6799999999


Q ss_pred             cCEEEEEEEcCCcCceee--ecCeeecCCCeeEEEEEeecceeeeEE----------------------EEEccCCCccc
Q psy9685         340 AGELFVRLQFNSTPESYN--VGGVKLADGNNHLIQTISSTGILDVQV----------------------LYLGGIPETVH  395 (979)
Q Consensus       340 ~G~l~~~~~~g~~~~~~~--~~~~~l~DG~wH~V~~~~~~~~l~l~v----------------------lyvGG~p~~~~  395 (979)
                      +|-|.+..++++|...+.  ..+.+++|..||.|.+.|.-..+.+.|                      +|+||.|..  
T Consensus       306 dGaV~l~~~l~~g~~e~~~~p~~~rfdD~~WH~V~v~R~~~m~t~~VDg~~t~~~~~a~~~tmlsss~~fyvgg~~~~--  383 (1591)
T KOG3514|consen  306 DGAVSLSSKLDGGDAEIIRMPNSFRFDDDSWHTVIVERSLQMMTLIVDGRRTEIRQYAPELTMLSSSDFFYVGGSPNT--  383 (1591)
T ss_pred             CCcEEEEEecCCccceeEEccccccccCCcceEEEEEeeeEEEEEEEccEEecccccccceeEeeccceEEecCCCCc--
Confidence            999999999999887765  457899999999999999876665533                      888888766  


Q ss_pred             ccccccCCCCCCCCCCccccccccccccccccccccccCCccccCCCCCcceeEeEEEEE--------------------
Q psy9685         396 HHRSIRSPYQPSRSYPRWATYDEMENYTTARRRYSRQTAGEKQFSPLPNFKGIIHDVQIY--------------------  455 (979)
Q Consensus       396 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~F~Gci~~v~i~--------------------  455 (979)
                        .++.++.++                                      |.||+++|+..                    
T Consensus       384 --~~l~gsrVs--------------------------------------F~GClkkV~y~~d~~rl~L~~LAk~g~~~~k  423 (1591)
T KOG3514|consen  384 --ADLPGSRVS--------------------------------------FMGCLKKVVYKNDDTRLELSRLAKQGDSKMK  423 (1591)
T ss_pred             --cccCCCcee--------------------------------------eeeeeeeeEeccCceeehhhHHhhcCCceeE
Confidence              333333322                                      77777777662                    


Q ss_pred             -------------------eecCCCCccCCCC----CCCCCc--ccc------------------chhcccccceEEEEe
Q psy9685         456 -------------------FISGSGDRSSPSS----NGAGSE--ETS------------------YIAAEMEAGELFVRL  492 (979)
Q Consensus       456 -------------------~~~~~~~~~lp~~----~g~~~~--rt~------------------~~~~~~~~~~~~~~~  492 (979)
                                         |......+.||..    .|++||  ||.                  |++.|+..+||+..+
T Consensus       424 ~~G~l~y~C~n~~~~DpvtFtt~es~l~LP~Wnt~~~gSiSf~FRTtepnGlil~~~g~~~~~~d~~A~ELldghlyl~l  503 (1591)
T KOG3514|consen  424 TEGDLSYSCENVAQLDPVTFTTPESYLTLPRWNTKKSGSISFDFRTTEPNGLILFHGGPQANATDYFAIELLDGHLYLLL  503 (1591)
T ss_pred             eeceEEEecCCCCccCceeeecccceeeccccccCCcceeEEEEeecCCCceEEEccCcccccccEEEEEEeCCeEEEEE
Confidence                               5667777777744    678887  775                  999999999999999


Q ss_pred             eeCCCceeeeecceeecCCCceEEEeCCCC-----ceeeeeccccc-CeeEEEEecCc-----------ccccc---ccc
Q psy9685         493 QFNSTPESYNVGGVKLADGNNHLIQVGPGF-----DFQRIDHPFTK-KHVIVCVLNAH-----------QLSGI---SDQ  552 (979)
Q Consensus       493 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~-----~~~~~~~~~~~-~~~~~~~~~~~-----------~~~~~---~~~  552 (979)
                      +|+++...+.....+++|++||.+++.+..     ....+.-+|.. +....+.+..+           .++.+   ..+
T Consensus       504 dlGSG~iklras~rkv~DGeWhhv~l~R~gR~gsvsVd~~~~df~tpG~s~iL~ld~~mylG~~~n~l~~P~~vWta~L~  583 (1591)
T KOG3514|consen  504 DLGSGVIKLRASSRKVNDGEWHHVDLQRDGRTGSVSVDAIKTDFSTPGDSEILDLDDPMYLGEVPNNLVYPSEVWTAALR  583 (1591)
T ss_pred             ecCCceEEeeeecccccCCceEEEEeeccCccceEEEeeeecCccCCCcceeEeecCceeeccCCCCccCcHHHHHHHHh
Confidence            999999999999999999999999986541     11112222221 11111111111           11111   256


Q ss_pred             ccccccccccccceeeeecccCCCCCCCCCCCceEECCCCccCCCCCCCC-CCCCCCCCCCCCeeccCCCceeeec-CCC
Q psy9685         553 ADLVRCTSEAYLNLIIYISWLLSPHDSDPLTSYACKCPAGYSSETCAVDI-DECVTHNCQNGARCIDGVARYSCEC-TPG  630 (979)
Q Consensus       553 ~~~~gC~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~C~~G~~g~~C~~~~-~~C~~~~C~~~~~C~~~~g~~~C~C-~~G  630 (979)
                      .+++||++++.++...............          .| .-..|.... ..|..+||.|++.|...|+.+.|.| ..+
T Consensus       584 ~GyvGCirdl~i~G~s~di~q~ae~q~s----------ag-vkpsCs~~~~~~C~~nPC~N~g~C~egwNrfiCDCs~T~  652 (1591)
T KOG3514|consen  584 KGYVGCIRDLFIDGVSTDIRQEAEAQNS----------AG-VKPSCSLSNEKICESNPCQNGGKCSEGWNRFICDCSGTG  652 (1591)
T ss_pred             ccchheehhheecceehhhHHHhhhccc----------cc-cCcccchhhccccCCCcccCCCCccccccccccccccCc
Confidence            8999999999988554222211100000          00 112344322 3799999999999999999999999 568


Q ss_pred             CCCCcccc
Q psy9685         631 WEGALCEK  638 (979)
Q Consensus       631 ~~G~~C~~  638 (979)
                      |.|+.|+.
T Consensus       653 ~~G~~Cer  660 (1591)
T KOG3514|consen  653 FEGRTCER  660 (1591)
T ss_pred             ccCccccc
Confidence            99999974

>KOG3514|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>KOG3516|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>smart00282 LamG Laminin G domain Back     alignment and domain information
>PF00054 Laminin_G_1: Laminin G domain; InterPro: IPR012679 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>smart00282 LamG Laminin G domain Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>cd00110 LamG Laminin G domain; Laminin G-like domains are usually Ca++ mediated receptors that can have binding sites for steroids, beta1 integrins, heparin, sulfatides, fibulin-1, and alpha-dystroglycans Back     alignment and domain information
>PF02210 Laminin_G_2: Laminin G domain; InterPro: IPR012680 Laminins are large heterotrimeric glycoproteins involved in basement membrane function [] Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>smart00210 TSPN Thrombospondin N-terminal -like domains Back     alignment and domain information
>smart00210 TSPN Thrombospondin N-terminal -like domains Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PF13385 Laminin_G_3: Concanavalin A-like lectin/glucanases superfamily; PDB: 4DQA_A 1N1Y_A 1MZ6_A 1MZ5_A 1N1S_A 2A75_A 1WCS_A 1N1T_A 1N1V_A 2FHR_A Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00152 PTX Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity Back     alignment and domain information
>PF02973 Sialidase: Sialidase, N-terminal domain; InterPro: IPR004124 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>smart00159 PTX Pentraxin / C-reactive protein / pentaxin family Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>PF13385 Laminin_G_3: Concanavalin A-like lectin/glucanases superfamily; PDB: 4DQA_A 1N1Y_A 1MZ6_A 1MZ5_A 1N1S_A 2A75_A 1WCS_A 1N1T_A 1N1V_A 2FHR_A Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF02973 Sialidase: Sialidase, N-terminal domain; InterPro: IPR004124 O-Glycosyl hydrolases 3 Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>smart00159 PTX Pentraxin / C-reactive protein / pentaxin family Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF12955 DUF3844: Domain of unknown function (DUF3844); InterPro: IPR024382 This presumed domain is found in fungal species Back     alignment and domain information
>PTZ00382 Variant-specific surface protein (VSP); Provisional Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF15102 TMEM154: TMEM154 protein family Back     alignment and domain information
>cd00152 PTX Pentraxins are plasma proteins characterized by their pentameric discoid assembly and their Ca2+ dependent ligand binding, such as Serum amyloid P component (SAP) and C-reactive Protein (CRP), which are cytokine-inducible acute-phase proteins implicated in innate immunity Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>smart00560 LamGL LamG-like jellyroll fold domain Back     alignment and domain information
>PF06439 DUF1080: Domain of Unknown Function (DUF1080); InterPro: IPR010496 This is a family of proteins of unknown function Back     alignment and domain information
>PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional Back     alignment and domain information
>PF00354 Pentaxin: Pentaxin family; InterPro: IPR001759 Pentaxins (or pentraxins) [, ] are a family of proteins which show, under electron microscopy, a discoid arrangement of five noncovalently bound subunits Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>KOG3607|consensus Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>smart00560 LamGL LamG-like jellyroll fold domain Back     alignment and domain information
>cd01951 lectin_L-type legume lectins Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>PHA02887 EGF-like protein; Provisional Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>PF02009 Rifin_STEVOR: Rifin/stevor family; InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world Back     alignment and domain information
>PF01034 Syndecan: Syndecan domain; InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query979
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 8e-18
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 3e-16
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 3e-06
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 2e-17
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 1e-15
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 9e-06
4d90_A143 Crystal Structure Of Del-1 Egf Domains Length = 143 2e-09
2ygq_A324 Wif Domain-Epidermal Growth Factor (Egf)-Like Domai 3e-06
1lmj_A86 Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 1e-04
2rqz_A38 Structure Of Sugar Modified Epidermal Growth Factor 1e-04
2vj2_A169 Human Jagged-1, Domains Dsl And Egfs1-3 Length = 16 3e-04
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure 
Iteration: 1

 Score = 89.7 bits (221), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 59/94 (62%)
Query: 582 LTSYACKCPAGYSSETCAVDIDECVTHNCQNGARCIDGVARYSCECTPGWEGALCEKEID 641
           L S+ C+C  GY+   C +D++ECV++ CQN A C+D +  + C C PG+EG  CE   D
Sbjct: 25  LGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGVHCEVNTD 84
Query: 642 ECLSNPCMNGGQCEDRLAGFVCNCSEEYVGERCE 675
           EC S+PC++ G+C D++  F C C   + G  C+
Sbjct: 85  ECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQ 118
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|4D90|A Chain A, Crystal Structure Of Del-1 Egf Domains Length = 143 Back     alignment and structure
>pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 Back     alignment and structure
>pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 Back     alignment and structure
>pdb|2RQZ|A Chain A, Structure Of Sugar Modified Epidermal Growth Factor-Like Repeat 12 Of Mouse Notch-1 Receptor Length = 38 Back     alignment and structure
>pdb|2VJ2|A Chain A, Human Jagged-1, Domains Dsl And Egfs1-3 Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query979
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-46
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 4e-27
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-23
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 8e-20
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 3e-12
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-45
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 4e-38
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-26
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 4e-25
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-19
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 6e-16
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 3e-10
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-05
2vh0_B134 Activated factor XA light chain; serine protease, 7e-39
2vh0_B134 Activated factor XA light chain; serine protease, 4e-25
2vh0_B134 Activated factor XA light chain; serine protease, 8e-21
2vh0_B134 Activated factor XA light chain; serine protease, 1e-16
2vh0_B134 Activated factor XA light chain; serine protease, 1e-14
2vh0_B134 Activated factor XA light chain; serine protease, 1e-11
2vh0_B134 Activated factor XA light chain; serine protease, 2e-04
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 6e-35
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 7e-32
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 4e-23
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 7e-19
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 3e-17
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 1e-13
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 2e-09
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 6e-35
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 3e-30
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-24
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 1e-16
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-15
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 5e-11
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-08
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 8e-04
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 4e-33
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 5e-22
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 2e-21
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 3e-19
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-14
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 4e-11
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-08
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 1e-32
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 3e-25
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 3e-18
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 9e-18
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 1e-16
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 5e-12
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 3e-11
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-31
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 4e-31
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 2e-29
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 4e-24
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-17
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 1e-12
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-06
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-28
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 3e-28
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 2e-21
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 1e-11
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 7e-04
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 8e-04
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 1e-24
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 5e-13
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 3e-07
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 4e-06
3asi_A 410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 4e-04
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 7e-04
1aut_L114 Activated protein C; serine proteinase, plasma cal 5e-24
1aut_L114 Activated protein C; serine proteinase, plasma cal 4e-21
1aut_L114 Activated protein C; serine proteinase, plasma cal 6e-14
1aut_L114 Activated protein C; serine proteinase, plasma cal 3e-13
1aut_L114 Activated protein C; serine proteinase, plasma cal 3e-12
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 7e-21
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-12
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 3e-09
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 1e-08
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 9e-21
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 5e-15
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 2e-14
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 8e-20
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 7e-10
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 6e-09
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-07
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 1e-19
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 6e-19
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 2e-19
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 4e-19
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 3e-18
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 2e-16
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-18
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 5e-07
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-06
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 1e-18
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 2e-08
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-18
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-11
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 3e-09
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-07
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-04
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-17
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 2e-14
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 4e-04
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 7e-16
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 1e-13
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 3e-12
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 2e-10
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 6e-14
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 4e-05
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 9e-14
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 1e-12
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-08
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-08
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 9e-08
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-04
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 2e-13
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 2e-12
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 1e-09
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 1e-08
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 8e-05
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-12
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 3e-10
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-07
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-07
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-05
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 4e-05
2bou_A143 EGF-like module containing mucin-like hormone rece 4e-12
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-10
2bou_A143 EGF-like module containing mucin-like hormone rece 5e-08
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-07
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 2e-11
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 2e-06
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 3e-11
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-09
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 4e-09
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-04
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 2e-10
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 1e-04
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 3e-10
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 3e-07
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 3e-07
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-05
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 9e-04
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 4e-10
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 5e-05
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 8e-10
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 2e-05
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 1e-09
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 6e-05
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 3e-09
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 6e-07
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 8e-05
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 3e-04
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 3e-09
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 7e-04
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 1e-08
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 6e-05
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 1e-08
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 4e-06
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 2e-08
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 3e-04
3v64_A191 Low-density lipoprotein receptor-related protein; 2e-08
3v64_A191 Low-density lipoprotein receptor-related protein; 7e-04
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 2e-08
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 1e-06
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 4e-06
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 3e-08
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 6e-08
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 3e-06
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 2e-05
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 8e-05
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-07
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 7e-06
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 2e-06
3v65_B 386 Low-density lipoprotein receptor-related protein; 4e-06
3v65_B386 Low-density lipoprotein receptor-related protein; 5e-05
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 4e-06
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 5e-06
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 7e-06
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 7e-06
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 6e-05
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 1e-05
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 8e-04
3p5b_L400 Low density lipoprotein receptor variant; B-propel 2e-05
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 4e-05
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 9e-05
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 3e-05
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 3e-05
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 4e-05
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 3e-04
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 3e-04
1nql_B53 Epidermal growth factor; cell surface receptor, ty 6e-05
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 2e-04
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 2e-04
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 3e-04
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 6e-04
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 7e-04
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 8e-04
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
 Score =  161 bits (411), Expect = 2e-46
 Identities = 44/140 (31%), Positives = 67/140 (47%), Gaps = 11/140 (7%)

Query: 599 AVDIDECVTHN--CQNGARCIDGVARYSCECTPGWEGALCEKEIDECLSNPCMNGGQCED 656
           A D+DEC      C++  +CI+ +  + C+C  G+ G  CE +++EC+SNPC N   C D
Sbjct: 2   AQDVDECSLGANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLD 61

Query: 657 RLAGFVCNCSEEYVGERCESLRQIS-CADQPCYFGAVCQDTKISPYFPQGPICDCPPGYR 715
           ++  F C C   Y G  CE       CA  PC     C D KI+ +      C+CP G+ 
Sbjct: 62  QIGEFQCICMPGYEGVHCEV--NTDECASSPCLHNGRCLD-KINEFQ-----CECPTGFT 113

Query: 716 GSRCEINIDECASGPCKNSG 735
           G  C++++            
Sbjct: 114 GHLCQVDLHHILDAQKMVWN 133
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Length = 1245 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Length = 410 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Length = 608 Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Length = 383 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Length = 394 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Length = 422 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Length = 184 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Length = 182 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Length = 178 Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Length = 170 Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Length = 189 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Length = 195 Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Length = 226 Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Length = 205 Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Length = 204 Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Length = 191 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Length = 267 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Length = 220 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Length = 162 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Length = 53 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Length = 217 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Length = 53 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Length = 157 Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Length = 188 Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* 3krk_A* ... Length = 587 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Length = 63 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Length = 553 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query979
3qcw_A1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 100.0
3qcw_A 1245 Neurexin-1-alpha; synaptic adhesion molecule, cell 100.0
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 100.0
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 100.0
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 100.0
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 100.0
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 100.0
2wjs_A608 Laminin subunit alpha-2; integrin, secreted, coile 100.0
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 99.84
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 99.83
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 99.83
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 99.83
1dyk_A394 Laminin alpha 2 chain; metal binding protein; 2.0A 99.83
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 99.83
3v64_A191 Low-density lipoprotein receptor-related protein; 99.82
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 99.82
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 99.82
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.81
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.81
2jd4_A383 Laminin subunit alpha-1; basement membrane protein 99.8
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 99.8
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.79
3asi_A410 Neurexin-1-alpha; beta-sandwich, cell adhesion, sy 99.78
1d2s_A170 SHBG, sex hormone-binding globulin; steroid transp 99.74
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.74
1f5f_A205 SHBG, sex hormone-binding globulin; jellyroll, sig 99.73
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.72
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.72
1pz7_A204 Agrin; structural protein; 1.42A {Gallus gallus} S 99.71
2r1d_A226 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.71
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.71
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.71
1h30_A422 GAS6, growth-arrest-specific protein; laminin G-do 99.71
3v64_A191 Low-density lipoprotein receptor-related protein; 99.7
2r16_A182 Neurexin-1-alpha; beta-sandwich, cell adhesion, sp 99.7
3pve_A189 Agrin, AGRN protein; mRNA splicing, structural gen 99.7
3sh4_A195 LG3 peptide; actin disassambly, integrin alpha12 B 99.69
2h0b_A184 Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A 99.69
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.68
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.68
3bod_A178 Neurexin-1-alpha; neurexin1D, LNS6, alternative sp 99.68
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.66
2r1b_A220 Neurexin-1-beta, neurexin I-beta; beta-sandwich, c 99.66
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.64
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.64
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.64
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.62
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.62
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.59
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.53
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.52
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.51
2bou_A143 EGF-like module containing mucin-like hormone rece 99.49
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.48
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.46
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.4
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.34
2bou_A143 EGF-like module containing mucin-like hormone rece 99.34
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.34
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.34
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.33
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.28
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.28
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.23
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.19
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.06
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.04
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.98
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.95
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 98.94
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.93
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.92
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.9
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.89
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.88
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.88
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.86
2vh0_B134 Activated factor XA light chain; serine protease, 98.83
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.82
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 98.81
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 98.8
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.8
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.79
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.79
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.77
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.75
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.75
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.73
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.72
2vh0_B134 Activated factor XA light chain; serine protease, 98.69
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.66
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 98.6
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 98.6
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.44
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.34
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.3
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 98.27
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 98.26
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.15
3v65_B 386 Low-density lipoprotein receptor-related protein; 98.12
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 98.03
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 98.01
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.95
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.88
2v73_A191 CBM40, putative EXO-alpha-sialidase; carbohydrate- 97.78
2erf_A209 Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug 97.71
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.68
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.67
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.59
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.56
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 97.54
2uur_A245 Collagen alpha-1(IX) chain; glycoprotein, hydroxyl 97.54
1za4_A251 Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel 97.53
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.51
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.39
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.36
2erf_A209 Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sug 97.31
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.3
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 97.29
3flp_A217 SAP-like pentraxin; physiological doubly-stacked h 97.27
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.27
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.24
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.24
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.23
1za4_A251 Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cel 97.07
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 97.02
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 97.0
2uur_A245 Collagen alpha-1(IX) chain; glycoprotein, hydroxyl 96.99
3kqr_A204 Serum amyloid P-component; glycoprotein, disulfide 96.95
3pvn_A206 C-reactive protein; pentraxin family, immune syste 96.93
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.88
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 96.79
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 96.64
2v73_A191 CBM40, putative EXO-alpha-sialidase; carbohydrate- 96.59
4b1m_A185 Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil 96.56
1nql_B53 Epidermal growth factor; cell surface receptor, ty 96.54
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 96.42
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 96.4
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 96.26
2knc_B79 Integrin beta-3; transmembrane signaling, protein 96.24
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 96.24
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 96.11
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 96.11
1ob1_C99 Major merozoite surface protein; immune system, im 96.05
3flp_A217 SAP-like pentraxin; physiological doubly-stacked h 95.99
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 95.94
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 95.93
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 95.78
1ob1_C99 Major merozoite surface protein; immune system, im 95.7
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 95.63
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 95.63
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 95.5
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 95.45
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 95.37
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 95.33
2sli_A679 Intramolecular trans-sialidase; hydrolase, neurami 95.28
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 95.22
3kqr_A204 Serum amyloid P-component; glycoprotein, disulfide 95.18
4dqa_A355 Uncharacterized protein; two domains structure, DU 95.16
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 95.09
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 95.03
2jkb_A686 Sialidase B; intramolecular trans-sialidase, lyase 94.7
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 94.7
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 94.36
3pvn_A206 C-reactive protein; pentraxin family, immune syste 94.28
2k9j_B43 Integrin beta-3; transmembrane complex, cell adhes 94.26
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 94.2
1szb_A170 Mannose binding lectin-associated serine protease- 94.13
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 94.0
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 93.85
2l2t_A44 Receptor tyrosine-protein kinase ERBB-4; transmemb 93.68
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 93.67
2jwa_A44 Receptor tyrosine-protein kinase ERBB-2; transmemb 93.67
2y38_A403 Laminin subunit alpha-5; structural protein, cell 93.6
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 93.51
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 93.45
1a8d_A452 Tetanus neurotoxin; clostridial, ganglioside bindi 93.38
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 93.24
2ks1_B44 Epidermal growth factor receptor; ERBB1, ERBB2, tr 93.23
2wph_E59 Coagulation factor IXA light chain; serine proteas 93.03
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 93.02
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 92.52
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 92.51
2i9a_A145 Urokinase-type plasminogen activator; growth facto 92.42
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 92.1
1szb_A170 Mannose binding lectin-associated serine protease- 92.05
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 91.62
2y38_A403 Laminin subunit alpha-5; structural protein, cell 91.33
2i9a_A145 Urokinase-type plasminogen activator; growth facto 91.27
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 91.12
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 91.12
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 90.97
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 90.7
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 90.39
4dqa_A355 Uncharacterized protein; two domains structure, DU 89.72
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 89.3
2knc_A54 Integrin alpha-IIB; transmembrane signaling, prote 89.16
2l8s_A54 Integrin alpha-1; transmembrane region, detergent 89.13
1g1t_A157 E-selectin; EGF, adhesion molecule, SLEX, immune s 88.91
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 88.8
4b1m_A185 Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacil 88.02
1nzi_A159 Complement C1S component; calcium, innate immunity 87.55
3f1s_B 283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 87.38
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 86.6
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 86.29
4azz_A172 Levanase; hydrolase; 1.70A {Bacillus subtilis} 85.04
2sli_A679 Intramolecular trans-sialidase; hydrolase, neurami 83.99
3zr5_A656 Galactocerebrosidase; hydrolase, GALC, glycosyl hy 83.83
3v64_C 349 Agrin; beta propeller, laminin-G, signaling, prote 81.22
2k1a_A42 Integrin alpha-IIB; single-PASS transmembrane segm 80.54
2jkb_A686 Sialidase B; intramolecular trans-sialidase, lyase 80.24
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
Probab=100.00  E-value=4.8e-44  Score=461.40  Aligned_cols=504  Identities=18%  Similarity=0.287  Sum_probs=328.8

Q ss_pred             CCeeEEEEeCccccccceeeEEEEEEEEeCCCCeEEEEecCCCCCCCCCCCCCCCCCCCEEEEEEeCcEEEEEEEeCCcc
Q psy9685          77 TNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRLQFNSTP  156 (979)
Q Consensus        77 ~~s~~~~~~~~~~~~~~~~~~~isl~FrT~~~~GlLly~~~~~~~~~~~~~~~~~~~~dfi~l~L~~G~l~~~~~~g~~~  156 (979)
                      ++||+.++.+...     ..++|+|+|||.+++|||||+++.. .....+..+.....|||+|+|.+|+|+|+|++|+++
T Consensus       429 ~~syl~lp~~~~~-----~~~~is~~FrT~~~~GlLly~~~~~-~~~~~~~~~~~~~~df~~LeL~~G~l~l~~~~G~g~  502 (1245)
T 3qcw_A          429 PESFISLPKWNAK-----KTGSISFDFRTTEPNGLILFSHGKP-RHQKDAKHPQMIKVDFFAIEMLDGHLYLLLDMGSGT  502 (1245)
T ss_dssp             TTCCEEECCCCCS-----SEEEEEEEEECCCSCEEEEEEECCC-CSSCCSSCTTSCCCCEEEEEEETTEEEEEEESSSCE
T ss_pred             CCeEEEecCCCcc-----CceEEEEEEEeCCCCeEEEEecCcc-ccccccccccccCCCEEEEEEeCCeEEEEEECCCCe
Confidence            6799999876544     6789999999999999999987421 000011122334679999999999999999999997


Q ss_pred             eEEeecCeeecCCCcEEEEEEEEceEEEEEECCEEeEEEecCcccccccc-eeEEcCCCCccc----------------c
Q psy9685         157 ESYNVGGVKLADGNNHLIQVVRNVTLVQVKLNGTEYFRKTISSTGILDVQ-VLYLGGIPETVH----------------H  219 (979)
Q Consensus       157 ~~~~~~~~~lnDg~WH~V~v~r~~~~~~L~VD~~~~~~~~~~~~~~l~~~-~lyvGG~p~~~~----------------~  219 (979)
                      ..++.+..++|||+||+|+|.|+++.++|+||+.......++....+++. +|||||+|....                .
T Consensus       503 ~~l~~s~~~vnDG~WH~V~l~r~~~~~~L~VD~~~~~~~~~~~~~~l~~~~~lylGG~p~~~~~~~~p~~~~~~~~~~gF  582 (1245)
T 3qcw_A          503 IKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTAPGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGY  582 (1245)
T ss_dssp             EEEESCSSCCCSSCCEEEEEEEETTEEEEEETTEEEEEECSSSCCCCCCCSCEEESSCCSSCTTCCCCTTCHHHHTTCBC
T ss_pred             EEEeecccEecCCCEEEEEEEEecCEEEEEEcccccccccCCCcceeccCCceEEcccccccccccccccccccccccCc
Confidence            66666678999999999999999999999999987655566677778877 999999997531                1


Q ss_pred             ccccc-------------------------------CCCccCCCCCCCCccccCCCCeeeecC-CCCCCCCcccccCccc
Q psy9685         220 HRSIR-------------------------------SPYQPSRSYPSGGHCTDLWRDFSCSCV-RPFLGHTCQYNFTAAT  267 (979)
Q Consensus       220 ~~~~~-------------------------------~~~~~~~pc~~~G~C~~~~~~~~C~C~-~~~~g~~C~~~~~~~~  267 (979)
                      .++||                               ...+.++||.|+|.|++.|+.|.|+|+ .+|.|+.|+.+.....
T Consensus       583 ~GCir~l~ing~~~dl~~~~~~~~~~gv~~gC~~~~~~~C~~~pC~ngg~C~~~~~~~~C~C~~~g~~G~~C~~~~~~~~  662 (1245)
T 3qcw_A          583 VGCIRDLFIDGQSKDIRQMAEVQSTAGVKPSCSRETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLS  662 (1245)
T ss_dssp             CEEEEEEEETTEEECHHHHTTTTTCTTEESSCCCCSSCGGGSCCCCTTCEEEECSSSEEEECTTTTEESTTSCEECCEEE
T ss_pred             eEEEEEEEECCEEcCchhhhhhhccccccccccccCCCCCCccCCCCCCEEeCCCCCeEEECCCCCcccccCcccccccc
Confidence            11111                               012356799999999999999999999 5999999998776666


Q ss_pred             ccCCCcceeeEEEecCcchhccccceeEEEEEEEeccCCeEEEEecCCCCCCCCCCCCCCCCccceEEEEEecCEEEEEE
Q psy9685         268 FGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAGSEETSYIAAEMEAGELFVRL  347 (979)
Q Consensus       268 f~~~~~~~~~~~~~~~~~~~~~~~~~~~is~~frT~~~~GlLl~~g~~~~~~~~~~~~~~~~~~d~l~l~l~~G~l~~~~  347 (979)
                      |.+.++..+  .++..     ......+|+|.|||++++|+|||.+..             +..||++|+|.+|+|++++
T Consensus       663 fdGs~~l~~--~~~~~-----~~~~~~~isl~FrT~~~~GlLl~~~~~-------------~~~d~l~L~L~~G~l~l~~  722 (1245)
T 3qcw_A          663 YDGSMFMKI--QLPVV-----MHTEAEDVSLRFRSQRAYGILMATTSR-------------DSADTLRLELDAGRVKLTV  722 (1245)
T ss_dssp             EESSCCEEE--EEEEE-----EEESEEEEEEEEECSSSCEEEEEEEBT-------------TBSCEEEEEEETTEEEEEE
T ss_pred             cCCCCceEE--ecccc-----cccccceEEEEEEEcCCCEEEEEecCC-------------CCccEEEEEEeCCEEEEEE
Confidence            766443322  11111     123457899999999999999998653             1569999999999999999


Q ss_pred             EcCCcCceeeecCeeecCCCeeEEEEEeecceeeeEEEEEccCCCcccccccccCCCCCCCCCCcccccccccccccccc
Q psy9685         348 QFNSTPESYNVGGVKLADGNNHLIQTISSTGILDVQVLYLGGIPETVHHHRSIRSPYQPSRSYPRWATYDEMENYTTARR  427 (979)
Q Consensus       348 ~~g~~~~~~~~~~~~l~DG~wH~V~~~~~~~~l~l~vlyvGG~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  427 (979)
                      ++|+++..+ .....++||+||.|.+.+.++.+.|.   |.+.+....   ...+....+.          ..++..+..
T Consensus       723 nlg~g~~~~-~~~~~~~DG~WH~V~v~r~~~~~~l~---vD~~~~~~g---~~~g~~~~l~----------~~~~~~G~~  785 (1245)
T 3qcw_A          723 NLGKGPETL-FAGYNLNDNEWHTVRVVRRGKSLKLT---VDDQQAMTG---QMAGDHTRLE----------FHNIETGII  785 (1245)
T ss_dssp             ESSSSEEEE-EECSCCCSSSCEEEEEEEETTEEEEE---ETTSCCEEE---ECSSSCCCEE----------EEEEEESSC
T ss_pred             ECCCCceEE-EeCccccCCCcEEEEEEEeCCEEEEE---ECCccceeE---ecCCCcceee----------ccccccccc
Confidence            999887644 45678999999999999998876553   333221000   0000000000          000000000


Q ss_pred             ccccccCCccccCCCCCcceeEeEEEEE---------------e------------------ecCCCCccCCCC----CC
Q psy9685         428 RYSRQTAGEKQFSPLPNFKGIIHDVQIY---------------F------------------ISGSGDRSSPSS----NG  470 (979)
Q Consensus       428 ~~~~~~~g~~~~~~~~~F~Gci~~v~i~---------------~------------------~~~~~~~~lp~~----~g  470 (979)
                      ...     ...-..+.+|+|||++++++               |                  ......+.+|..    ..
T Consensus       786 ~~~-----~~~~~~~~~F~GCl~~v~~ng~~~~~~~~~g~~~~C~~~~~~g~~~~~~~~~~F~~~~sy~~~p~~~~~~~~  860 (1245)
T 3qcw_A          786 TER-----RYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFRNIIADPVTFKTKSSYVALATLQAYTSM  860 (1245)
T ss_dssp             CCC-----TTCSCCCCCCEEEEEEEEETTEEHHHHHHTTSCSCEEECCEESCCCCCCSCEEECSTTCEEEESCCCCSSCE
T ss_pred             ccc-----cccCCCCCCCEEEeeeEEECCEEchhhhhcCCccccccccccCccccccCCccccccccEEEcCCccccceE
Confidence            000     00001234699999998873               1                  112222233321    11


Q ss_pred             CCCc--ccc---------------chhcccccceEEEEeeeCCCceeeee-cceeecCCCceEEEeCCCC-c--eeeeec
Q psy9685         471 AGSE--ETS---------------YIAAEMEAGELFVRLQFNSTPESYNV-GGVKLADGNNHLIQVGPGF-D--FQRIDH  529 (979)
Q Consensus       471 ~~~~--rt~---------------~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~g~-~--~~~~~~  529 (979)
                      .++|  ||+               |++.++..+++.+.+++++....+.+ ....++|++||.|++.... .  +..++.
T Consensus       861 ~is~~frT~~~~GlLly~~~~~~dfi~l~L~~G~l~~~~~~G~g~~~~~~~s~~~vnDg~WH~V~~~~~~~~~~~L~VD~  940 (1245)
T 3qcw_A          861 HLFFQFKTTSLDGLILYNSGDGNDFIVVELVKGYLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDT  940 (1245)
T ss_dssp             EEEEEEECSCSCEEEEEEEESTTCEEEEEEETTEEEEEEESSSCCEEEECCCSSCSCSSSCEEEEEEECTTCEEEEEETT
T ss_pred             EEEEEEEeCCCCEEEEEeCCCCCCEEEEEEeCCEEEEEEECCCCcEEEEecCcccccCCCeEEEEEEEeCCeeEEEEECC
Confidence            2333  665               66677777888888887776655543 5678999999999886532 1  222221


Q ss_pred             ccc----cC--e--eE-EEEecCccc---c----cccccccccccccccccceeeeecccCCCCCCCCCCCceEECCCCc
Q psy9685         530 PFT----KK--H--VI-VCVLNAHQL---S----GISDQADLVRCTSEAYLNLIIYISWLLSPHDSDPLTSYACKCPAGY  593 (979)
Q Consensus       530 ~~~----~~--~--~~-~~~~~~~~~---~----~~~~~~~~~gC~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~C~~G~  593 (979)
                      -..    .+  .  +. .+.+.....   .    ......+|.||+++++++.......     .    .....   .+-
T Consensus       941 ~~~~~~~~~~~~l~~~~~lylGG~p~~~~~~~~~~~~~~~~F~GCi~~l~ing~~~~l~-----~----~~~~~---~~~ 1008 (1245)
T 3qcw_A          941 KITTQITAGARNLDLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLI-----S----DALFC---NGQ 1008 (1245)
T ss_dssp             EEEEEECCCCCCCCEEEEEEESCCCGGGGGGCCTTCCCSSBCCEEEEEEEETTBCCCTT-----T----TCSEE---ESC
T ss_pred             EeeeeccCCcceeccCCCeEECcccccchhhhcccccccCCcEEEeeeEEECCEEcccc-----c----chhcc---ccc
Confidence            000    00  0  00 112222111   0    1123468999999999984421100     0    00000   111


Q ss_pred             cCCCCCCCCCCCCCCCCCCCCeeccCCCceeeecC-CCCCCCcccccc
Q psy9685         594 SSETCAVDIDECVTHNCQNGARCIDGVARYSCECT-PGWEGALCEKEI  640 (979)
Q Consensus       594 ~g~~C~~~~~~C~~~~C~~~~~C~~~~g~~~C~C~-~G~~G~~C~~~~  640 (979)
                      ....|....+.|...||.+++.|...+..|.|.|+ +||.|+.|+.+.
T Consensus      1009 v~~gC~~~~~~C~~~pC~ngG~C~~~~~~~~C~C~~~g~~G~~C~~~~ 1056 (1245)
T 3qcw_A         1009 IERGCEGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPG 1056 (1245)
T ss_dssp             EEESSSCCCCCCCTTSSSSSCEEEEETTEEEEECTTSSCBSTTSCBCC
T ss_pred             eeeeeecccCceECCcCCCCCEeCCCCCCCEEECCCCCCCCCCccCCC
Confidence            12346545578999999999999999999999999 699999997544
>3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>2wjs_A Laminin subunit alpha-2; integrin, secreted, coiled coil, glycoprotein, laminin EGF-like domain, extracellular matrix, laminin G-like domain; HET: NAG; 2.80A {Mus musculus} Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Back     alignment and structure
>1dyk_A Laminin alpha 2 chain; metal binding protein; 2.0A {Mus musculus} SCOP: b.29.1.4 b.29.1.4 PDB: 1okq_A 1qu0_A Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Back     alignment and structure
>2jd4_A Laminin subunit alpha-1; basement membrane protein, metal binding protein; 1.9A {Mus musculus} Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} Back     alignment and structure
>1d2s_A SHBG, sex hormone-binding globulin; steroid transport, laminin G-like domain, jellyroll, androgen binding protein (ABP); HET: DHT; 1.55A {Homo sapiens} SCOP: b.29.1.4 PDB: 1kdk_A* 1kdm_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1f5f_A SHBG, sex hormone-binding globulin; jellyroll, signaling protein; HET: DHT; 1.70A {Homo sapiens} SCOP: b.29.1.4 PDB: 1lhw_A* 1lho_A* 1lhn_A* 1lhv_A* 1lhu_A* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1pz7_A Agrin; structural protein; 1.42A {Gallus gallus} SCOP: b.29.1.4 PDB: 1pz8_A 1pz9_A 1q56_A Back     alignment and structure
>2r1d_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 2.60A {Rattus norvegicus} SCOP: b.29.1.4 PDB: 3biw_E* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>1h30_A GAS6, growth-arrest-specific protein; laminin G-domain protein, vitamin K-dependent protein, AXL/SKY/MER ligand, laminin G- like domain; 2.2A {Homo sapiens} SCOP: b.29.1.4 b.29.1.4 PDB: 2c5d_A* Back     alignment and structure
>3v64_A Low-density lipoprotein receptor-related protein; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} PDB: 3v65_A Back     alignment and structure
>2r16_A Neurexin-1-alpha; beta-sandwich, cell adhesion, splicing; 1.04A {Bos taurus} Back     alignment and structure
>3pve_A Agrin, AGRN protein; mRNA splicing, structural genomics, PSI-2, protein structure initiative; 1.40A {Mus musculus} Back     alignment and structure
>3sh4_A LG3 peptide; actin disassambly, integrin alpha12 BETA1, metal binding Pro; 1.50A {Homo sapiens} PDB: 3sh5_A Back     alignment and structure
>2h0b_A Neurexin-1-alpha; B-sandwich, cell adhesion; 2.10A {Bos taurus} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3bod_A Neurexin-1-alpha; neurexin1D, LNS6, alternative splicing, calcium, cell adhesion, EGF-like domain, glycoprotein, membrane, metal- binding; 1.70A {Mus musculus} PDB: 2vh8_C 2xb6_C* 2wqz_C* 1c4r_A 3bop_A 3mw4_A* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2r1b_A Neurexin-1-beta, neurexin I-beta; beta-sandwich, cell adhesion, splicing; 1.72A {Rattus norvegicus} PDB: 3mw2_A* 3b3q_E* 3mw3_A* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} Back     alignment and structure
>2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} Back     alignment and structure
>1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2erf_A Thrombospondin-1; TSP-1, N-terminal TSPN, HBD, sugar binding protein; 1.45A {Homo sapiens} SCOP: b.29.1.4 PDB: 2es3_A 1z78_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1za4_A Thrombospondin 1; TSP-1, NTSP-1, HBD, arixtra, cell adhesion; HET: SGN; 1.90A {Homo sapiens} SCOP: b.29.1.4 PDB: 2ouh_A 2ouj_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2uur_A Collagen alpha-1(IX) chain; glycoprotein, hydroxylation, structural protein, NC4, collagen IX, polymorphism, extracellular matrix; 1.8A {Homo sapiens} Back     alignment and structure
>3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* Back     alignment and structure
>3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2v73_A CBM40, putative EXO-alpha-sialidase; carbohydrate-binding module, bacterial pathogen, sialic acid, sugar-binding protein; HET: SIA; 2.2A {Clostridium perfringens} Back     alignment and structure
>4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>2knc_B Integrin beta-3; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens} Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>3flp_A SAP-like pentraxin; physiological doubly-stacked heptamer, pentraxin fold, cyclic heptamer, invertebrate lectin, sugar binding protein; 2.30A {Limulus polyphemus} PDB: 3flr_A 3flt_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>2sli_A Intramolecular trans-sialidase; hydrolase, neuraminidase; HET: SKD; 1.80A {Macrobdella decora} SCOP: b.29.1.9 b.68.1.1 PDB: 1sll_A 1sli_A* 3sli_A* 4sli_A* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3kqr_A Serum amyloid P-component; glycoprotein, disulfide bond, lectin, metal-binding secreted; HET: NAG; 1.50A {Homo sapiens} SCOP: b.29.1.5 PDB: 1lgn_A* 1gyk_A 2a3w_A* 2a3x_A* 2a3y_A* 1sac_A* 3d5o_A* 2w08_A* Back     alignment and structure
>4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2jkb_A Sialidase B; intramolecular trans-sialidase, lyase, glycosidase, neuraminidase; HET: SKD; 1.54A {Streptococcus pneumoniae} PDB: 2vw2_A* 2vw1_A* 2vw0_A* Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>3pvn_A C-reactive protein; pentraxin family, immune system; 1.98A {Homo sapiens} SCOP: b.29.1.5 PDB: 1gnh_A 1lj7_A 3l2y_A 1b09_A 3pvo_A Back     alignment and structure
>2k9j_B Integrin beta-3; transmembrane complex, cell adhesion, cleavage on basic residues, disease mutation, glycoprotein, pyrrolidone carboxylic acid; NMR {Homo sapiens} PDB: 2rmz_A 2rn0_A 2l91_A Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1a8d_A Tetanus neurotoxin; clostridial, ganglioside binding region; 1.57A {Clostridium tetani} SCOP: b.29.1.6 b.42.4.2 PDB: 1af9_A 1fv3_A* 1fv2_A* 3hmy_A* 3hn1_A* 1d0h_A* 1dfq_A* 1dll_A* 1yxw_A* 1yyn_A* 1diw_A* Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>4dqa_A Uncharacterized protein; two domains structure, DUF 1735, laminin_G_3 concanavalin A- lectin/glucanases superfamily domain; HET: MSE; 1.50A {Bacteroides ovatus} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2knc_A Integrin alpha-IIB; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens} Back     alignment and structure
>2l8s_A Integrin alpha-1; transmembrane region, detergent micelle, CE adhesion; NMR {Homo sapiens} Back     alignment and structure
>1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>4b1m_A Levanase; hydrolase, CBM66; HET: FRU; 1.10A {Bacillus subtilis} PDB: 4b1l_A* 4azz_A Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>4azz_A Levanase; hydrolase; 1.70A {Bacillus subtilis} Back     alignment and structure
>2sli_A Intramolecular trans-sialidase; hydrolase, neuraminidase; HET: SKD; 1.80A {Macrobdella decora} SCOP: b.29.1.9 b.68.1.1 PDB: 1sll_A 1sli_A* 3sli_A* 4sli_A* Back     alignment and structure
>3zr5_A Galactocerebrosidase; hydrolase, GALC, glycosyl hydrolase, krabbe disease, TIM BAR lectin domain; HET: NAG; 2.10A {Mus musculus} PDB: 3zr6_A* Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2k1a_A Integrin alpha-IIB; single-PASS transmembrane segment, alternative splicing, calcium, cell adhesion, cleavage on PAIR of basic residues; NMR {Homo sapiens} PDB: 2k9j_A Back     alignment and structure
>2jkb_A Sialidase B; intramolecular trans-sialidase, lyase, glycosidase, neuraminidase; HET: SKD; 1.54A {Streptococcus pneumoniae} PDB: 2vw2_A* 2vw1_A* 2vw0_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 979
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-12
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 1e-10
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-09
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 2e-08
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 6e-06
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 7e-12
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 9e-11
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 5e-09
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 3e-07
d2c4fl137 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof 4e-05
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 2e-11
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 5e-08
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 8e-08
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 4e-07
d1haea_63 g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Hu 3e-05
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 4e-11
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 4e-11
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 4e-09
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 2e-07
d2vj3a239 g.3.11.1 (A:453-491) Neurogenic locus notch homolo 2e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 1e-10
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 5e-09
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 1e-07
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 8e-07
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 3e-05
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 4e-05
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 2e-10
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 2e-10
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 4e-09
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 1e-06
d1xkba139 g.3.11.1 (A:48-86) Factor X, N-terminal module {Hu 0.001
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 2e-10
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 4e-10
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 5e-09
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 1e-06
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 9e-05
d2vj3a335 g.3.11.1 (A:492-526) Neurogenic locus notch homolo 9e-04
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 9e-10
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 2e-08
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 2e-08
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 1e-05
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 2e-05
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 0.002
d1g1ta239 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human 0.003
d1dyka1189 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse 1e-09
d1dyka1189 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse 2e-06
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 6e-09
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 8e-09
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 1e-08
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 1e-05
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 1e-04
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.003
d1g1sa240 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human 0.003
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 2e-08
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 1e-06
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 3e-06
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 1e-04
d1cvua241 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EG 1e-04
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 2e-08
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 1e-06
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 7e-06
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 2e-04
d1autl148 g.3.11.1 (L:49-96) Activated protein c (autoprothr 2e-04
d1h30a1191 b.29.1.4 (A:261-451) Growth-arrest-specific protei 2e-08
d1h30a1191 b.29.1.4 (A:261-451) Growth-arrest-specific protei 6e-04
d1d2sa_170 b.29.1.4 (A:) Sex hormone-binding globulin {Human 2e-08
d1d2sa_170 b.29.1.4 (A:) Sex hormone-binding globulin {Human 4e-04
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 4e-08
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 9e-08
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 1e-05
d3egfa_53 g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse 2e-04
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 6e-08
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 2e-07
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 2e-06
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 2e-04
d1nqlb_48 g.3.11.1 (B:) Epidermal growth factor, EGF {Human 0.002
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 1e-07
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 4e-07
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 6e-07
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 4e-05
d1q4ga242 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EG 2e-04
d2r1da1177 b.29.1.4 (A:36-212) Ligand-binding domain of neure 1e-07
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 2e-07
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 3e-07
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 4e-07
d1tpga141 g.3.11.1 (A:51-91) Plasminogen activator (tissue-t 2e-06
d1dyka2185 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse 3e-07
d1dyka2185 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse 4e-04
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 4e-07
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 3e-05
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 0.004
d1pz7a_195 b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI 1e-06
d1pz7a_195 b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxI 1e-04
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 2e-05
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 4e-05
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 6e-05
d1k36a_46 g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo 8e-05
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 1e-04
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 8e-04
d1ioxa_50 g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) 2e-04
d1ioxa_50 g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) 5e-04
d1h30a2218 b.29.1.4 (A:461-678) Growth-arrest-specific protei 2e-04
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 3e-04
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 0.003
d1moxc_49 g.3.11.1 (C:) Transforming growth factor alpha {Hu 7e-04
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 8e-04
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 0.001
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Factor IX (IXa)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 60.4 bits (147), Expect = 1e-12
 Identities = 17/38 (44%), Positives = 22/38 (57%)

Query: 600 VDIDECVTHNCQNGARCIDGVARYSCECTPGWEGALCE 637
           VD D+C ++ C NG  C D +  Y C C  G+EG  CE
Sbjct: 1   VDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCE 38
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 189 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Length = 41 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Length = 48 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Length = 42 Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 185 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 Back     information, alignment and structure
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 195 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Length = 46 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 49 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query979
d1dyka1189 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.9
d2r1da1177 Ligand-binding domain of neurexin 1beta {Rat (Ratt 99.79
d1dyka1189 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.78
d1pz7a_195 Agrin {Chicken (Gallus gallus) [TaxId: 9031]} 99.77
d1d2sa_170 Sex hormone-binding globulin {Human (Homo sapiens) 99.77
d1h30a1191 Growth-arrest-specific protein Gas6 {Human (Homo s 99.77
d1dyka2185 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.76
d1h30a1191 Growth-arrest-specific protein Gas6 {Human (Homo s 99.76
d1dyka2185 Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 99.7
d1d2sa_170 Sex hormone-binding globulin {Human (Homo sapiens) 99.7
d1pz7a_195 Agrin {Chicken (Gallus gallus) [TaxId: 9031]} 99.68
d2r1da1177 Ligand-binding domain of neurexin 1beta {Rat (Ratt 99.67
d1h30a2218 Growth-arrest-specific protein Gas6 {Human (Homo s 99.51
d1h30a2218 Growth-arrest-specific protein Gas6 {Human (Homo s 99.47
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.63
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.38
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.36
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.33
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.33
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.32
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.31
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.26
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.23
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.22
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 98.22
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 98.16
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 98.14
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.02
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.99
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.95
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.94
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.92
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.9
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.87
d2erfa1206 Thrombospondin 1 N-terminal domain {Human (Homo sa 97.81
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.81
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.8
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.78
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.73
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.73
d2erfa1206 Thrombospondin 1 N-terminal domain {Human (Homo sa 97.69
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.68
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.63
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.6
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.54
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.53
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.52
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 97.51
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.5
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.44
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.33
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.33
d1saca_204 Serum amyloid P component (SAP) {Human (Homo sapie 97.32
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.29
d1b09a_206 C-reactive protein (CRP) {Human (Homo sapiens) [Ta 97.28
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.26
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.22
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.21
d1nt0a345 Mannose-binding protein associated serine protease 97.13
d1szba245 Mannose-binding protein associated serine protease 97.13
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 97.12
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.11
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 97.08
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.03
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 97.03
d2slia1196 Leech intramolecular trans-sialidase, N-terminal d 96.98
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 96.96
d1a8da1247 Tetanus neurotoxin {Clostridium tetani [TaxId: 151 96.74
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 96.72
d3btaa1207 Botulinum neurotoxin {Clostridium botulinum, serot 96.71
d1szba245 Mannose-binding protein associated serine protease 96.6
d2slia1196 Leech intramolecular trans-sialidase, N-terminal d 96.58
d1i0ua241 Low density lipoprotein (LDL) receptor, different 96.56
d1nt0a345 Mannose-binding protein associated serine protease 96.48
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.44
d1epwa1218 Botulinum neurotoxin {Clostridium botulinum, serot 96.22
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 96.0
d3bpse140 Low density lipoprotein (LDL) receptor, different 95.92
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 95.57
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 95.46
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 95.36
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 95.25
d1saca_204 Serum amyloid P component (SAP) {Human (Homo sapie 95.11
d1b09a_206 C-reactive protein (CRP) {Human (Homo sapiens) [Ta 94.96
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 94.78
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 94.76
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 94.69
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 94.66
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 94.65
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 93.92
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 93.88
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 93.85
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 93.82
d1ijqa250 Low density lipoprotein (LDL) receptor, different 93.51
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 92.54
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 92.32
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 91.43
d3btaa1207 Botulinum neurotoxin {Clostridium botulinum, serot 91.1
d1a8da1247 Tetanus neurotoxin {Clostridium tetani [TaxId: 151 90.88
d1epwa1218 Botulinum neurotoxin {Clostridium botulinum, serot 90.77
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 90.49
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 90.4
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 88.61
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 86.99
d1oq1a_223 Hypothetical protein YesU {Bacillus subtilis [TaxI 86.68
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 85.59
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 84.64
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 84.19
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 83.82
d1n1ta1222 Trypanosoma sialidase, C-terminal domain {Trypanos 83.68
d2ah2a1225 Trypanosoma sialidase, C-terminal domain {Parasiti 82.15
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 81.82
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 81.61
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 81.56
d1ijqa250 Low density lipoprotein (LDL) receptor, different 80.76
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Laminin G-like module
domain: Laminin alpha2 chain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.90  E-value=2.3e-23  Score=208.55  Aligned_cols=146  Identities=23%  Similarity=0.339  Sum_probs=125.7

Q ss_pred             CCCcceeeEeeeccCccccccccccCCCeeEEEEeCccccccceeeEEEEEEEEeCCCCeEEEEecCCCCCCCCCCCCCC
Q psy9685          51 SFPTTTNFTFVTSPDFTAATFGHENTTNSLVTVAVGGVARRAVRNIVDISMFIRTRQLRGAIFYLGGSGDRSSPSSNGAG  130 (979)
Q Consensus        51 ~~~c~~~~~~~~~~~~~a~~Fg~~~~~~s~~~~~~~~~~~~~~~~~~~isl~FrT~~~~GlLly~~~~~~~~~~~~~~~~  130 (979)
                      +.||+.+..|...++  |++||.  +.+||+.++.   .+..++++++|+|+|||.+++|||||.++             
T Consensus         1 ~g~C~~~~~~~~~~~--~~~fg~--s~~s~~~~~~---~~~~~~~~~~i~~~frT~~~~GlL~~~~~-------------   60 (189)
T d1dyka1           1 HGPCVAESEPALLTG--SKQFGL--SRNSHIAIAF---DDTKVKNRLTIELEVRTEAESGLLFYMAR-------------   60 (189)
T ss_dssp             CCSSCCCCCCCBCTT--CEECCS--STTCEEEEEC---CGGGGSSEEEEEEEEEECCSCEEEEEEEC-------------
T ss_pred             CCCccCCCCCccccC--ceecCC--CCCceEEEec---CcccccccEEEEEEEEECCCCEEEEEEcC-------------
Confidence            357999999999988  999999  7899999998   45566789999999999999999999874             


Q ss_pred             CCCCCEEEEEEeCcEEEEEEEeCCcceEEeecCeeecCCCcEEEEEEEEceEEEEEECCEEeEEEecCcccccccc-eeE
Q psy9685         131 SEETSYIAAEMEAGELFVRLQFNSTPESYNVGGVKLADGNNHLIQVVRNVTLVQVKLNGTEYFRKTISSTGILDVQ-VLY  209 (979)
Q Consensus       131 ~~~~dfi~l~L~~G~l~~~~~~g~~~~~~~~~~~~lnDg~WH~V~v~r~~~~~~L~VD~~~~~~~~~~~~~~l~~~-~ly  209 (979)
                      ....|||+|+|++|+|+++|++|++...+. ...++|||+||+|.|.|.++.++|+||+.......++....++.. .||
T Consensus        61 ~~~~dfi~l~l~~G~l~~~~~~g~~~~~~~-~~~~v~Dg~WH~V~v~~~~~~~~l~VD~~~~~~~~~~~~~~l~~~~~ly  139 (189)
T d1dyka1          61 INHADFATVQLRNGFPYFSYDLGSGDTSTM-IPTKINDGQWHKIKIVRVKQEGILYVDDASSQTISPKKADILDVVGILY  139 (189)
T ss_dssp             TTSSSEEEEEEETTEEEEEEESSSCEEEEE-CCSCCCSSSCEEEEEEEETTEEEEEETTEEEEEECSTTCCCCCCCSEEE
T ss_pred             CCCCcEEEEEEECCEEEEEEECCCccEEec-CCcEeeCCCEEEEEEEEcccEEEEEECCcceeeEccCcccccccccceE
Confidence            125689999999999999999998855444 457899999999999999999999999987766666666777776 999


Q ss_pred             EcCCCCcc
Q psy9685         210 LGGIPETV  217 (979)
Q Consensus       210 vGG~p~~~  217 (979)
                      |||+|...
T Consensus       140 iGG~p~~~  147 (189)
T d1dyka1         140 VGGLPINY  147 (189)
T ss_dssp             ESSCCTTC
T ss_pred             Eecccccc
Confidence            99999764
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dyka1 b.29.1.4 (A:2744-2932) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h30a1 b.29.1.4 (A:261-451) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dyka2 b.29.1.4 (A:2933-3117) Laminin alpha2 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2sa_ b.29.1.4 (A:) Sex hormone-binding globulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pz7a_ b.29.1.4 (A:) Agrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2r1da1 b.29.1.4 (A:36-212) Ligand-binding domain of neurexin 1beta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h30a2 b.29.1.4 (A:461-678) Growth-arrest-specific protein Gas6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erfa1 b.29.1.4 (A:10-215) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2slia1 b.29.1.9 (A:81-276) Leech intramolecular trans-sialidase, N-terminal domain {North american leech (Macrobdella decora) [TaxId: 6405]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1saca_ b.29.1.5 (A:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b09a_ b.29.1.5 (A:) C-reactive protein (CRP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3btaa1 b.29.1.6 (A:872-1078) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]} Back     information, alignment and structure
>d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]} Back     information, alignment and structure
>d1epwa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oq1a_ b.29.1.17 (A:) Hypothetical protein YesU {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n1ta1 b.29.1.15 (A:413-634) Trypanosoma sialidase, C-terminal domain {Trypanosoma rangeli [TaxId: 5698]} Back     information, alignment and structure
>d2ah2a1 b.29.1.15 (A:409-633) Trypanosoma sialidase, C-terminal domain {Parasitic flagellate protozoan (Trypanosoma cruzi) [TaxId: 5693]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure