Psyllid ID: psy9704

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MCTSLLISGRNVHNVMEMVGIEGLTYAGNHGLEIIHPDGSRFVHPIPTECASIYILRTAFGLDWTERVKIIYAGDDVTDEDAMEALKGMAATFRVTQSQIVKTAAERRLPSKPWIP
cccEEEEEcccHHHHHHHHccccEEEEcccccEEEccccccccccccccHHHHHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHccEEEEEEEcccccccccccccccccccc
cccEEEEEcccHHHHHHHcccccEEEEccccEEEEccccccccccccHHHHHHHHHHHHcccccHHcEEEEEEcccccHHHHHHHHHcHcEEEEEcccccEccccccccccccccc
mctsllisgrnvHNVMEMVGIEGltyagnhgleiihpdgsrfvhpiptecaSIYILRTAFGLDWTERVKIIyagddvtdEDAMEALKGMAATFRVTQSQIVKTAAerrlpskpwip
mctsllisgrnVHNVMEMVGIEGLTYAGNHGLEIIHPDGSRFVHPIPTECASIYILRTAFGLDWTERVKIIYAGDDVTDEDAMEALKGMAATFRVTQSQIvktaaerrlpskpwip
MCTSLLISGRNVHNVMEMVGIEGLTYAGNHGLEIIHPDGSRFVHPIPTECASIYILRTAFGLDWTERVKIIYAGDDVTDEDAMEALKGMAATFRVTQSQIVKTAAERRLPSKPWIP
****LLISGRNVHNVMEMVGIEGLTYAGNHGLEIIHPDGSRFVHPIPTECASIYILRTAFGLDWTERVKIIYAGDDVTDEDAMEALKGMAATFRVTQ*******************
*CTSLLISGRNVHNVMEMVGIEGLTYAGNHGLEIIHPDGSRFVHPIPTECASIYILRTAFGLDWTERVKIIYAGDDVTDEDAMEALKGMAATFRVTQSQIVKTAAERRLPS*PW**
MCTSLLISGRNVHNVMEMVGIEGLTYAGNHGLEIIHPDGSRFVHPIPTECASIYILRTAFGLDWTERVKIIYAGDDVTDEDAMEALKGMAATFRVTQSQIVKTAAE**********
MCTSLLISGRNVHNVMEMVGIEGLTYAGNHGLEIIHPDGSRFVHPIPTECASIYILRTAFGLDWTERVKIIYAGDDVTDEDAMEALKGMAATFRVTQSQIVKTAAERRLPSKPWIP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCTSLLISGRNVHNVMEMVGIEGLTYAGNHGLEIIHPDGSRFVHPIPTECASIYILRTAFGLDWTERVKIIYAGDDVTDEDAMEALKGMAATFRVTQSQIVKTAAERRLPSKPWIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query116 2.2.26 [Sep-21-2011]
A0QKN5391 Trehalose-phosphate phosp yes N/A 0.5 0.148 0.4 2e-05
B2HDP8390 Trehalose-phosphate phosp no N/A 0.482 0.143 0.379 6e-05
A0PMI0390 Trehalose-phosphate phosp yes N/A 0.482 0.143 0.379 6e-05
Q73U90391 Trehalose-phosphate phosp N/A N/A 0.5 0.148 0.4 0.0001
O50401391 Trehalose-phosphate phosp yes N/A 0.482 0.143 0.379 0.0001
A5U846391 Trehalose-phosphate phosp yes N/A 0.482 0.143 0.379 0.0001
A1KP65391 Trehalose-phosphate phosp yes N/A 0.482 0.143 0.379 0.0001
Q7TWL7391 Trehalose-phosphate phosp yes N/A 0.482 0.143 0.379 0.0001
Q10850 1327 Uncharacterized glycosyl no N/A 0.327 0.028 0.45 0.0006
Q49734 429 Trehalose-phosphate phosp yes N/A 0.482 0.130 0.362 0.0009
>sp|A0QKN5|OTSB_MYCA1 Trehalose-phosphate phosphatase OS=Mycobacterium avium (strain 104) GN=otsB PE=3 SV=1 Back     alignment and function desciption
 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 2   CTSLLISGRNVHNVMEMVGIEGLTYAGNHGLEIIHPDGSRFVHPIPTECASIYILRTAFG 61
           C   ++SGR++ +V + VG+ G+ YAG+HG E+  PDGS   H      A+I +L  A G
Sbjct: 179 CPVAVLSGRDLADVTKRVGVPGIWYAGSHGFELTAPDGSH--HQNDDAAAAIPVLAQAAG 236
Removes the phosphate from trehalose 6-phosphate to produce free trehalose.
Mycobacterium avium (strain 104) (taxid: 243243)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 2
>sp|B2HDP8|OTSB_MYCMM Trehalose-phosphate phosphatase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=otsB PE=3 SV=1 Back     alignment and function description
>sp|A0PMI0|OTSB_MYCUA Trehalose-phosphate phosphatase OS=Mycobacterium ulcerans (strain Agy99) GN=otsB PE=3 SV=1 Back     alignment and function description
>sp|Q73U90|OTSB_MYCPA Trehalose-phosphate phosphatase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=otsB PE=3 SV=1 Back     alignment and function description
>sp|O50401|OTSB_MYCTU Trehalose-phosphate phosphatase OS=Mycobacterium tuberculosis GN=otsB PE=1 SV=1 Back     alignment and function description
>sp|A5U846|OTSB_MYCTA Trehalose-phosphate phosphatase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=otsB PE=3 SV=1 Back     alignment and function description
>sp|A1KP65|OTSB_MYCBP Trehalose-phosphate phosphatase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=otsB PE=3 SV=1 Back     alignment and function description
>sp|Q7TWL7|OTSB_MYCBO Trehalose-phosphate phosphatase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=otsB PE=3 SV=1 Back     alignment and function description
>sp|Q10850|Y2006_MYCTU Uncharacterized glycosyl hydrolase Rv2006/MT2062 OS=Mycobacterium tuberculosis GN=Rv2006 PE=1 SV=1 Back     alignment and function description
>sp|Q49734|OTSB_MYCLE Trehalose-phosphate phosphatase OS=Mycobacterium leprae (strain TN) GN=otsB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
193697528 797 PREDICTED: alpha,alpha-trehalose-phospha 0.525 0.076 0.885 2e-24
193713833 797 PREDICTED: alpha,alpha-trehalose-phospha 0.525 0.076 0.885 4e-24
256708537 807 trehalose 6-phosphate synthase [Nilaparv 0.525 0.075 0.885 5e-24
157113405 813 trehalose-6-phosphate synthase [Aedes ae 0.525 0.075 0.885 1e-23
312384648 866 hypothetical protein AND_01815 [Anophele 0.525 0.070 0.885 1e-23
256862182 809 trehalose 6-phosphate synthase [Diaboloc 0.525 0.075 0.868 1e-23
157327041 813 trehalose-6-phosphate synthase [Locusta 0.525 0.075 0.868 2e-23
158296920 816 AGAP008227-PA [Anopheles gambiae str. PE 0.525 0.074 0.868 2e-23
170046932 829 trehalose-6-phosphate synthase [Culex qu 0.525 0.073 0.868 3e-23
400130722 824 trehalose-6-phosphate synthase [Ctenocep 0.525 0.074 0.852 4e-23
>gi|193697528|ref|XP_001944221.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 54/61 (88%), Positives = 60/61 (98%)

Query: 51  ASIYILRTAFGLDWTERVKIIYAGDDVTDEDAMEALKGMAATFRVTQSQIVKTAAERRLP 110
           AS+YILRTAFGLDW+ER++IIYAGDDVTDEDAM+ALKGMAATFRV QSQIVKT+AERRLP
Sbjct: 685 ASLYILRTAFGLDWSERIRIIYAGDDVTDEDAMQALKGMAATFRVAQSQIVKTSAERRLP 744

Query: 111 S 111
           S
Sbjct: 745 S 745

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi|193713833|ref|XP_001945523.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|256708537|gb|ACV20871.1| trehalose 6-phosphate synthase [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|157113405|ref|XP_001657813.1| trehalose-6-phosphate synthase [Aedes aegypti] gi|108877743|gb|EAT41968.1| AAEL006446-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312384648|gb|EFR29327.1| hypothetical protein AND_01815 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|256862182|gb|ACV32626.1| trehalose 6-phosphate synthase [Diabolocatantops pinguis] Back     alignment and taxonomy information
>gi|157327041|gb|ABV44614.1| trehalose-6-phosphate synthase [Locusta migratoria manilensis] Back     alignment and taxonomy information
>gi|158296920|ref|XP_317243.4| AGAP008227-PA [Anopheles gambiae str. PEST] gi|157014944|gb|EAA12459.4| AGAP008227-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170046932|ref|XP_001850998.1| trehalose-6-phosphate synthase [Culex quinquefasciatus] gi|167869506|gb|EDS32889.1| trehalose-6-phosphate synthase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|400130722|gb|AFP67548.1| trehalose-6-phosphate synthase [Ctenocephalides felis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query116
FB|FBgn0027560809 Tps1 "Trehalose-6-phosphate sy 0.525 0.075 0.803 1.2e-38
FB|FBgn0031907273 CG5171 [Drosophila melanogaste 0.534 0.227 0.435 1.1e-25
UNIPROTKB|O50401391 otsB "Trehalose-phosphate phos 0.482 0.143 0.379 3.5e-10
FB|FBgn0031908276 CG5177 [Drosophila melanogaste 0.732 0.307 0.391 2.1e-09
TAIR|locus:2153082 385 ATTPPA [Arabidopsis thaliana ( 0.413 0.124 0.387 9.1e-09
UNIPROTKB|Q10850 1327 MT2062 "Uncharacterized glycos 0.336 0.029 0.461 3.3e-08
UNIPROTKB|Q75WV3371 TPP1 "Probable trehalose-phosp 0.439 0.137 0.372 8.1e-08
TAIR|locus:2127510 377 TPPG "trehalose-6-phosphate ph 0.301 0.092 0.447 9.5e-08
UNIPROTKB|Q9FWQ2382 TPP2 "Probable trehalose-phosp 0.439 0.133 0.392 2.1e-07
TAIR|locus:2135540 368 TPPF "trehalose-6-phosphate ph 0.293 0.092 0.457 8.3e-06
FB|FBgn0027560 Tps1 "Trehalose-6-phosphate synthase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 253 (94.1 bits), Expect = 1.2e-38, Sum P(2) = 1.2e-38
 Identities = 49/61 (80%), Positives = 54/61 (88%)

Query:    51 ASIYILRTAFGLDWTERVKIIYAGDDVTDEDAMEALKGMAATFRVTQSQIVKTAAERRLP 110
             ASIYILRT+FG+DW ER+KIIY GDD+TDEDAM ALKGMA TFRVT S IVKTAA+ RLP
Sbjct:   697 ASIYILRTSFGVDWNERIKIIYVGDDLTDEDAMVALKGMARTFRVTSSDIVKTAADHRLP 756

Query:   111 S 111
             S
Sbjct:   757 S 757
GO:0003825 "alpha,alpha-trehalose-phosphate synthase (UDP-forming) activity" evidence=ISS;NAS
GO:0005992 "trehalose biosynthetic process" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
FB|FBgn0031907 CG5171 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|O50401 otsB "Trehalose-phosphate phosphatase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
FB|FBgn0031908 CG5177 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2153082 ATTPPA [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q10850 MT2062 "Uncharacterized glycosyl hydrolase Rv2006/MT2062" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q75WV3 TPP1 "Probable trehalose-phosphate phosphatase 1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2127510 TPPG "trehalose-6-phosphate phosphatase G" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9FWQ2 TPP2 "Probable trehalose-phosphate phosphatase 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2135540 TPPF "trehalose-6-phosphate phosphatase F" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
pfam02358 235 pfam02358, Trehalose_PPase, Trehalose-phosphatase 5e-05
PRK14501726 PRK14501, PRK14501, putative bifunctional trehalos 7e-05
TIGR00685244 TIGR00685, T6PP, trehalose-phosphatase 1e-04
PLN02580 384 PLN02580, PLN02580, trehalose-phosphatase 1e-04
COG1877266 COG1877, OtsB, Trehalose-6-phosphatase [Carbohydra 0.002
>gnl|CDD|216992 pfam02358, Trehalose_PPase, Trehalose-phosphatase Back     alignment and domain information 
 Score = 40.0 bits (94), Expect = 5e-05
 Identities = 20/84 (23%), Positives = 26/84 (30%), Gaps = 20/84 (23%)

Query: 6   LISGRNVHNVMEMVGIEGLTYAGNHGLEIIHPDG-SRFVHPIPTECASIYILRTAFGLDW 64
           +ISGR+        G+  L  A  HG  I  P G          +            LDW
Sbjct: 41  IISGRSRAFEDLFFGVPNLGLAAEHGAFIRDPGGEDWTNLAEVED------------LDW 88

Query: 65  TERVKIIYAGDDVTDEDAMEALKG 88
            + V  I        E+  E   G
Sbjct: 89  KKEVAAIL-------EEYTERTPG 105

This family consist of trehalose-phosphatases EC:3.1.3.12 these enzyme catalyze the de-phosphorylation of trehalose-6-phosphate to trehalose and orthophosphate. The aligned region is present in trehalose-phosphatases and comprises the entire length of the protein it is also found in the C-terminus of trehalose-6-phosphate synthase EC:2.4.1.15 adjacent to the trehalose-6-phosphate synthase domain - pfam00982. It would appear that the two equivalent genes in the E. coli otsBA operon otsA the trehalose-6-phosphate synthase and otsB trehalose-phosphatase (this family) have undergone gene fusion in most eukaryotes. Trehalose is a common disaccharide of bacteria, fungi and invertebrates that appears to play a major role in desiccation tolerance. Length = 235
>gnl|CDD|184712 PRK14501, PRK14501, putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>gnl|CDD|233092 TIGR00685, T6PP, trehalose-phosphatase Back     alignment and domain information
>gnl|CDD|215317 PLN02580, PLN02580, trehalose-phosphatase Back     alignment and domain information
>gnl|CDD|224789 COG1877, OtsB, Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 116
PLN02151354 trehalose-phosphatase 99.92
PF02358235 Trehalose_PPase: Trehalose-phosphatase; InterPro: 99.91
PLN03017366 trehalose-phosphatase 99.91
PLN02580384 trehalose-phosphatase 99.9
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 99.85
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 99.81
PLN02205854 alpha,alpha-trehalose-phosphate synthase [UDP-form 99.78
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 99.77
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 99.73
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 99.68
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 99.49
KOG1050|consensus732 99.03
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 98.36
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 98.36
PF08282 254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 97.82
PRK01158230 phosphoglycolate phosphatase; Provisional 97.55
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 97.46
COG0561 264 Cof Predicted hydrolases of the HAD superfamily [G 97.36
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 97.23
PRK15126 272 thiamin pyrimidine pyrophosphate hydrolase; Provis 97.07
PRK10513270 sugar phosphate phosphatase; Provisional 97.07
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 97.0
TIGR00099 256 Cof-subfamily Cof subfamily of IIB subfamily of ha 96.96
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 96.88
KOG1050|consensus 732 96.51
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 96.41
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 96.16
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 95.81
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 94.7
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 94.63
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 93.99
TIGR01486 256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 93.65
PLN02382 413 probable sucrose-phosphatase 92.66
COG4030315 Uncharacterized protein conserved in archaea [Func 92.05
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 91.41
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 91.06
PRK10976 266 putative hydrolase; Provisional 90.87
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 90.32
PRK11133322 serB phosphoserine phosphatase; Provisional 90.23
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 90.12
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 89.83
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 89.35
PRK13222226 phosphoglycolate phosphatase; Provisional 88.48
PLN02954224 phosphoserine phosphatase 88.43
PRK10976266 putative hydrolase; Provisional 88.23
PRK03669 271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 87.11
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 86.08
PRK11587218 putative phosphatase; Provisional 86.03
COG0546220 Gph Predicted phosphatases [General function predi 85.95
PRK10530 272 pyridoxal phosphate (PLP) phosphatase; Provisional 85.66
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 84.9
PF1324275 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY 84.87
PRK00192 273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 83.47
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 83.44
PRK13288214 pyrophosphatase PpaX; Provisional 83.04
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 82.64
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 82.55
PLN02779286 haloacid dehalogenase-like hydrolase family protei 82.32
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 82.21
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 81.31
PLN02887580 hydrolase family protein 81.08
PLN02423245 phosphomannomutase 80.76
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 80.26
PTZ00174247 phosphomannomutase; Provisional 80.12
>PLN02151 trehalose-phosphatase Back     alignment and domain information 
Probab=99.92  E-value=1.8e-25  Score=179.38  Aligned_cols=113  Identities=29%  Similarity=0.407  Sum_probs=79.9

Q ss_pred             ceEEEEcCCCHhhHHHhcCCCCccEEeccCceeecCCCc--ee------cCCCcHHH-----------------------
Q psy9704           2 CTSLLISGRNVHNVMEMVGIEGLTYAGNHGLEIIHPDGS--RF------VHPIPTEC-----------------------   50 (116)
Q Consensus         2 ~~vaIVSGR~~~~l~~~l~~~~~~~aG~HG~e~~~~~g~--~~------~~~~~~~~-----------------------   50 (116)
                      ++|||||||++++|++++++.+++|+|+||+|++.|++.  +.      ......+|                       
T Consensus       136 ~~vaIvSGR~~~~l~~~~~~~~l~laGsHG~e~~~p~~g~~~~~~~~~~~~~~~~~~~~~i~~v~~~l~~~~~~~pG~~V  215 (354)
T PLN02151        136 FPTAIVSGRCREKVSSFVKLTELYYAGSHGMDIKGPEQGSKYKKENQSLLCQPATEFLPVINEVYKKLVEKTKSIPGAKV  215 (354)
T ss_pred             CCEEEEECCCHHHHHHHcCCccceEEEeCCceeecCCCCccccccccccccccchhhHHHHHHHHHHHHHHHhcCCCCEE
Confidence            479999999999999999999999999999999877431  11      11111111                       


Q ss_pred             -------HHHH-----------------HHHHhCCC------------------------------CCCCc--eeEEEEe
Q psy9704          51 -------ASIY-----------------ILRTAFGL------------------------------DWTER--VKIIYAG   74 (116)
Q Consensus        51 -------a~~~-----------------~l~~~~g~------------------------------~~~~~--~~pv~iG   74 (116)
                             +.||                 .+...+++                              +|.++  .+|||||
T Consensus       216 E~K~~slavHYR~a~~~~~~~l~~~l~~v~~~~~~l~v~~GkkVvEvrP~~~~dKG~Av~~Ll~~~~~~~~~~~~pvyiG  295 (354)
T PLN02151        216 ENNKFCASVHFRCVEENKWSDLANQVRSVLKNYPKLMLTQGRKVLEIRPIIKWDKGKALEFLLESLGYANCTDVFPIYIG  295 (354)
T ss_pred             EecCcEEEEEeCCCChHHHHHHHHHHHHHHhhCCCcEEecCCEEEEEeCCCCCCHHHHHHHHHHhcccccCCCCeEEEEc
Confidence                   0011                 01111111                              12222  3799999


Q ss_pred             CCCccHHHHHhhhC--CCcEEEEcCCCCCCccceeecCCCCCC
Q psy9704          75 DDVTDEDAMEALKG--MAATFRVTQSQIVKTAAERRLPSKPWI  115 (116)
Q Consensus        75 DD~TDEdaF~al~~--~g~~i~VG~~~~~~T~A~~~l~~~~ev  115 (116)
                      ||+||||||++|++  .|++|+||..+ .+|.|+|+|++|++|
T Consensus       296 DD~TDEDaF~~L~~~~~G~gI~Vg~~~-k~T~A~y~L~dp~eV  337 (354)
T PLN02151        296 DDRTDEDAFKILRDKKQGLGILVSKYA-KETNASYSLQEPDEV  337 (354)
T ss_pred             CCCcHHHHHHHHhhcCCCccEEeccCC-CCCcceEeCCCHHHH
Confidence            99999999999986  36699999532 389999999999886

>PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3 Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>KOG1050|consensus Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>KOG1050|consensus Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query116
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 3e-07
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 3e-05
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Length = 239 Back     alignment and structure
 Score = 46.2 bits (110), Expect = 3e-07
 Identities = 5/47 (10%), Positives = 16/47 (34%), Gaps = 2/47 (4%)

Query: 6  LISGRNVHNVMEMVGIEGLTYAGNHGLEIIHPDGSRFVHPIPTECAS 52
          +++GR+   +   + ++ +     HG      +G    +        
Sbjct: 43 IVTGRSPEEISRFLPLD-INMICYHGAC-SKINGQIVYNNGSDRFLG 87
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Length = 239 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 98.77
1l6r_A227 Hypothetical protein TA0175; structural genomics, 98.27
3dao_A283 Putative phosphatse; structural genomics, joint ce 97.77
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 97.76
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 97.63
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 97.52
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 97.51
3pgv_A 285 Haloacid dehalogenase-like hydrolase; structural g 97.47
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 97.32
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 96.87
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 96.16
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 96.01
3mmz_A176 Putative HAD family hydrolase; structural genomics 95.99
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 95.95
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 95.82
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 95.7
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 95.37
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 95.22
1nf2_A 268 Phosphatase; structural proteomics, HAD NEW fold, 94.81
3mn1_A189 Probable YRBI family phosphatase; structural genom 94.66
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 94.41
1rlm_A 271 Phosphatase; HAD family, rossman fold, hydrolase; 94.36
3zx4_A 259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 94.36
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 94.13
1xvi_A 275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 94.07
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 94.01
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 93.85
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 93.69
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 93.65
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 93.57
1rkq_A 282 Hypothetical protein YIDA; two domain structure wi 93.43
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 93.28
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 93.22
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 93.15
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 93.06
2b30_A 301 Pvivax hypothetical protein; SGPP, structural geno 93.02
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 92.99
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 92.69
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 92.61
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 92.57
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 92.43
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 92.41
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 92.29
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 92.27
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 92.26
1y8a_A332 Hypothetical protein AF1437; structural genomics, 92.21
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 91.67
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 91.47
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 91.4
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 91.35
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 91.32
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 91.17
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 90.65
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 90.5
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 90.15
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 89.9
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 89.87
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 89.83
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 89.41
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 89.33
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 89.31
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 89.14
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 89.06
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 89.04
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 88.97
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 88.2
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 88.14
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 88.12
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 87.82
3fzq_A 274 Putative hydrolase; YP_001086940.1, putative haloa 87.34
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 87.32
2p11_A231 Hypothetical protein; putative haloacid dehalogena 86.33
2o2x_A218 Hypothetical protein; structural genomics, joint c 86.3
3fvv_A232 Uncharacterized protein; unknown function, structu 86.23
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 85.95
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 85.72
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 85.59
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 85.57
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 85.54
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 85.05
1te2_A226 Putative phosphatase; structural genomics, phospha 85.0
2rbk_A 261 Putative uncharacterized protein; HAD-like phospha 84.37
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 84.05
3gyg_A 289 NTD biosynthesis operon putative hydrolase NTDB; P 83.54
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 83.43
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 82.55
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 82.49
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 82.47
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 82.28
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 82.14
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 81.52
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 81.08
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 81.05
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 80.5
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 80.07
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 80.06
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
Probab=98.77  E-value=2.3e-08  Score=73.80  Aligned_cols=103  Identities=22%  Similarity=0.275  Sum_probs=69.1

Q ss_pred             eEEEEcCCCHhhHHHhcCCCCccEEeccCceeecCCCceec-------CCCcHHHH------------------------
Q psy9704           3 TSLLISGRNVHNVMEMVGIEGLTYAGNHGLEIIHPDGSRFV-------HPIPTECA------------------------   51 (116)
Q Consensus         3 ~vaIVSGR~~~~l~~~l~~~~~~~aG~HG~e~~~~~g~~~~-------~~~~~~~a------------------------   51 (116)
                      .++|+|||+...+.+++... .+++++||+.+.. +++...       .+.+.+++                        
T Consensus        40 ~v~iaTGR~~~~~~~~~~~l-~~~I~~nGa~i~~-~~~~~~~~~~~~~~~l~~~~~~~i~~~~~~~~~~~~~~~~~~~~~  117 (239)
T 1u02_A           40 DTYIVTGRSPEEISRFLPLD-INMICYHGACSKI-NGQIVYNNGSDRFLGVFDRIYEDTRSWVSDFPGLRIYRKNLAVLY  117 (239)
T ss_dssp             EEEEECSSCHHHHHHHSCSS-CEEEEGGGTEEEE-TTEEEECTTGGGGHHHHHHHHHHHTTHHHHSTTCEEEEETTEEEE
T ss_pred             CEEEEeCCCHHHHHHHhccc-hheEEECCEEEee-CCeeeecccccccchhhHHHHHHHHHHHhhCCCcEEEecCCEEEE
Confidence            68999999999999999877 8899999999876 554310       11111110                        


Q ss_pred             ------------HH---HHHHHhCCC------------C----------C-CCceeEEEEeCCCccHHHHHhhhCCCcEE
Q psy9704          52 ------------SI---YILRTAFGL------------D----------W-TERVKIIYAGDDVTDEDAMEALKGMAATF   93 (116)
Q Consensus        52 ------------~~---~~l~~~~g~------------~----------~-~~~~~pv~iGDD~TDEdaF~al~~~g~~i   93 (116)
                                  ..   ..+....++            +          + ....-+++|||+.||++||+.++. |.+|
T Consensus       118 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~lei~~~~~~Kg~al~~l~~~~gvia~GD~~ND~~Ml~~a~~-g~~v  196 (239)
T 1u02_A          118 HLGLMGADMKPKLRSRIEEIARIFGVETYYGKMIIELRVPGVNKGSAIRSVRGERPAIIAGDDATDEAAFEANDD-ALTI  196 (239)
T ss_dssp             ECTTSCSTTHHHHHHHHHHHHHHHTCEEEECSSEEEEECTTCCHHHHHHHHHTTSCEEEEESSHHHHHHHHTTTT-SEEE
T ss_pred             EcCCCChhHHHHHHHHHHHHhccCCcEEEeCCcEEEEEcCCCCHHHHHHHHHhhCCeEEEeCCCccHHHHHHhhC-CcEE
Confidence                        00   011111111            0          0 011018999999999999998865 7899


Q ss_pred             EEcCCCCCCccceeecCC
Q psy9704          94 RVTQSQIVKTAAERRLPS  111 (116)
Q Consensus        94 ~VG~~~~~~T~A~~~l~~  111 (116)
                      .||+.   ++.|+|.+++
T Consensus       197 am~Na---~~~A~~v~~~  211 (239)
T 1u02_A          197 KVGEG---ETHAKFHVAD  211 (239)
T ss_dssp             EESSS---CCCCSEEESS
T ss_pred             EECCC---CCcceEEeCC
Confidence            99987   6889998876
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query116
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 99.4
d1rlma_ 269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 98.52
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 98.43
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 98.24
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 98.22
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 98.19
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 98.17
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 98.15
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 98.12
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 98.04
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 97.98
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 97.9
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 95.88
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 93.93
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 93.73
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 93.68
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 93.47
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 92.94
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 92.12
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 91.23
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 90.56
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 88.76
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 86.33
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 85.67
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 84.82
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 84.08
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 81.83
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Trehalose-phosphatase
domain: Trehalose-6-phosphate phosphatase related protein
species: Archaeon Thermoplasma acidophilum [TaxId: 2303]

Probab=99.40  E-value=1.7e-13  Score=95.85  Aligned_cols=43  Identities=37%  Similarity=0.367  Sum_probs=38.4

Q ss_pred             eEEEEeCCCccHHHHHhhhCCCcEEEEcCCCCCCccceeecCCCCCC
Q psy9704          69 KIIYAGDDVTDEDAMEALKGMAATFRVTQSQIVKTAAERRLPSKPWI  115 (116)
Q Consensus        69 ~pv~iGDD~TDEdaF~al~~~g~~i~VG~~~~~~T~A~~~l~~~~ev  115 (116)
                      .+++|||+.||+.||+.+. .|++|+||+.   +|.|+|++++++||
T Consensus       172 ~~i~~GDs~ND~~Mf~~~~-~~~av~~g~~---~~~A~~~~~~~~ev  214 (229)
T d1u02a_         172 PAIIAGDDATDEAAFEAND-DALTIKVGEG---ETHAKFHVADYIEM  214 (229)
T ss_dssp             CEEEEESSHHHHHHHHTTT-TSEEEEESSS---CCCCSEEESSHHHH
T ss_pred             cceeecCCCChHHHHhccC-CeEEEEeCCC---CccCeEEcCCHHHH
Confidence            7899999999999999984 6889999986   79999999998764
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure