Psyllid ID: psy9705

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDERTLRMNYLRKREKVHDVNYWMRSFLKGMGTLITEDGDDVLPTTMQPVTLEDFDEYLSKYIGTHEQAWALLLDYDGELWLP
ccccHHHHHHHcccccccEEEEccccccHHHcccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHcccccccccccccccccHHHHHHHHHccccccEEEEEEcccccccc
cccccEEEEEEEccccccEEEEEccccccHHHcccEEEccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcccccEEcccccccHHHHHHHHHHHHHcccccEEEEEEcccccccc
MNLVAKEFVACqineppgvlivspfagageQMHEALICNPYEIDAAAEVIHRALTMPEDERTLRMNYLRKREKVHDVNYWMRSFLKGMGtlitedgddvlpttmqpvtleDFDEYLSKYIGTHEQAWALLLDydgelwlp
MNLVAKEFVacqineppgVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRAltmpedertLRMNYLrkrekvhdvnyWMRSFLKGMGTLITEDGDDVLPTTMQPVTLEDFDEYLSKYIGTHEQAWALLLDYDGELWLP
MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDERTLRMNYLRKREKVHDVNYWMRSFLKGMGTLITEDGDDVLPTTMQPVTLEDFDEYLSKYIGTHEQAWALLLDYDGELWLP
***VAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDERTLRMNYLRKREKVHDVNYWMRSFLKGMGTLITEDGDDVLPTTMQPVTLEDFDEYLSKYIGTHEQAWALLLDYDGELWL*
MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDERTLRMNYLRKREKVHDVNYWMRSFLKGMG*************************YLSKYIGTHEQAWALLLDYDGELWLP
MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDERTLRMNYLRKREKVHDVNYWMRSFLKGMGTLITEDGDDVLPTTMQPVTLEDFDEYLSKYIGTHEQAWALLLDYDGELWLP
*NLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDERTLRMNYLRKREKVHDVNYWMRSFLKGMGTLITEDGDDVLPTTMQPVTLEDFDEYLSKYIGTHEQAWALLLDYDGELW**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDERTLRMNYLRKREKVHDVNYWMRSFLKGMGTLITEDGDDVLPTTMQPVTLEDFDEYLSKYIGTHEQAWALLLDYDGELWLP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query140 2.2.26 [Sep-21-2011]
A8AFD4473 Alpha,alpha-trehalose-pho yes N/A 0.628 0.186 0.477 3e-16
A4WBR1474 Alpha,alpha-trehalose-pho yes N/A 0.628 0.185 0.443 1e-15
A7MEE9474 Alpha,alpha-trehalose-pho yes N/A 0.628 0.185 0.443 2e-15
P55612464 Probable alpha,alpha-treh yes N/A 0.607 0.183 0.458 3e-15
Q2NTK9469 Alpha,alpha-trehalose-pho yes N/A 0.65 0.194 0.439 6e-15
Q57N70473 Alpha,alpha-trehalose-pho yes N/A 0.607 0.179 0.482 2e-14
P0CL06473 Alpha,alpha-trehalose-pho yes N/A 0.607 0.179 0.482 2e-14
E1WGG8473 Alpha,alpha-trehalose-pho yes N/A 0.607 0.179 0.482 2e-14
P0A1Q1473 Alpha,alpha-trehalose-pho N/A N/A 0.607 0.179 0.482 2e-14
A9MU86473 Alpha,alpha-trehalose-pho yes N/A 0.607 0.179 0.482 2e-14
>sp|A8AFD4|OTSA_CITK8 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=otsA PE=3 SV=2 Back     alignment and function desciption
 Score = 84.0 bits (206), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/88 (47%), Positives = 57/88 (64%)

Query: 1   MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDE 60
           MNLVAKEFVA Q    PGVL++S FAGA  ++  ALI NPY+ D  A  +HRALTMP  E
Sbjct: 363 MNLVAKEFVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDDVAVALHRALTMPLAE 422

Query: 61  RTLRMNYLRKREKVHDVNYWMRSFLKGM 88
           R  R   + +    +D+N+W + F++ +
Sbjct: 423 RISRHAEMLETIIKNDINHWQQRFIRDL 450
Catalyzes the transfer of glucose from UDP-glucose to glucose-6-phosphate to form alpha,alpha-1,1 trehalose-6-phosphate. Acts with retention of the anomeric configuration of the UDP-sugar donor.
Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) (taxid: 290338)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 5
>sp|A4WBR1|OTSA_ENT38 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Enterobacter sp. (strain 638) GN=otsA PE=3 SV=1 Back     alignment and function description
>sp|A7MEE9|OTSA_CROS8 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=otsA PE=3 SV=1 Back     alignment and function description
>sp|P55612|OTSA_RHISN Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Rhizobium sp. (strain NGR234) GN=otsA PE=3 SV=1 Back     alignment and function description
>sp|Q2NTK9|OTSA_SODGM Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Sodalis glossinidius (strain morsitans) GN=otsA PE=3 SV=1 Back     alignment and function description
>sp|Q57N70|OTSA_SALCH Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella choleraesuis (strain SC-B67) GN=otsA PE=3 SV=1 Back     alignment and function description
>sp|P0CL06|OTSA_SALTY Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=otsA PE=3 SV=1 Back     alignment and function description
>sp|E1WGG8|OTSA_SALTS Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella typhimurium (strain SL1344) GN=otsA PE=3 SV=1 Back     alignment and function description
>sp|P0A1Q1|OTSA_SALTI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella typhi GN=otsA PE=3 SV=2 Back     alignment and function description
>sp|A9MU86|OTSA_SALPB Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=otsA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
242025293 800 alpha,alpha-trehalose-phosphate synthase 0.971 0.17 0.868 4e-64
256708537 807 trehalose 6-phosphate synthase [Nilaparv 0.971 0.168 0.854 7e-63
388540222 807 trehalose phosphate synthase [Sogatella 0.971 0.168 0.854 1e-62
380851042 618 trehalose phosphate synthase [Sogatella 0.971 0.220 0.854 4e-62
157327041 813 trehalose-6-phosphate synthase [Locusta 0.964 0.166 0.846 4e-61
256862182 809 trehalose 6-phosphate synthase [Diaboloc 0.964 0.166 0.832 7e-61
193713833 797 PREDICTED: alpha,alpha-trehalose-phospha 0.971 0.170 0.802 3e-57
307174674 860 Alpha,alpha-trehalose-phosphate synthase 0.957 0.155 0.788 6e-56
307206697 861 Alpha,alpha-trehalose-phosphate synthase 0.957 0.155 0.788 1e-55
383853810 790 PREDICTED: alpha,alpha-trehalose-phospha 0.957 0.169 0.788 1e-55
>gi|242025293|ref|XP_002433060.1| alpha,alpha-trehalose-phosphate synthase subunit, putative [Pediculus humanus corporis] gi|212518576|gb|EEB20322.1| alpha,alpha-trehalose-phosphate synthase subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 119/137 (86%), Positives = 127/137 (92%), Gaps = 1/137 (0%)

Query: 1   MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDE 60
           MNLVAKEFVACQIN PPGVLIVSPFAGAGE MHEAL+CNPYEID AAEVIHRALTMPEDE
Sbjct: 377 MNLVAKEFVACQINTPPGVLIVSPFAGAGEMMHEALVCNPYEIDDAAEVIHRALTMPEDE 436

Query: 61  RTLRMNYLRKREKVHDVNYWMRSFLKGMGTLITEDGDDVLPTTMQPVTLEDFDEYLSKYI 120
           RTLRMNYLR+REKVHDVNYWMRSFLK MGTLITEDG++ LPTTMQPVTL+DFDEYL+KYI
Sbjct: 437 RTLRMNYLRRREKVHDVNYWMRSFLKAMGTLITEDGEETLPTTMQPVTLDDFDEYLAKYI 496

Query: 121 GTHEQAWALLLDYDGEL 137
           G+  +  ALLLDYDG L
Sbjct: 497 GSSHK-LALLLDYDGTL 512

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|256708537|gb|ACV20871.1| trehalose 6-phosphate synthase [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|388540222|gb|AFK64819.1| trehalose phosphate synthase [Sogatella furcifera] Back     alignment and taxonomy information
>gi|380851042|gb|AFE85961.1| trehalose phosphate synthase [Sogatella furcifera] Back     alignment and taxonomy information
>gi|157327041|gb|ABV44614.1| trehalose-6-phosphate synthase [Locusta migratoria manilensis] Back     alignment and taxonomy information
>gi|256862182|gb|ACV32626.1| trehalose 6-phosphate synthase [Diabolocatantops pinguis] Back     alignment and taxonomy information
>gi|193713833|ref|XP_001945523.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307174674|gb|EFN65057.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307206697|gb|EFN84652.1| Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383853810|ref|XP_003702415.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] A-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
FB|FBgn0027560 809 Tps1 "Trehalose-6-phosphate sy 0.95 0.164 0.700 2.2e-45
TIGR_CMR|GSU_2337747 GSU_2337 "glycosyl transferase 0.564 0.105 0.487 4.8e-14
UNIPROTKB|P31677474 otsA [Escherichia coli K-12 (t 0.692 0.204 0.402 2.6e-13
UNIPROTKB|O06353500 otsA "Trehalose-phosphate synt 0.621 0.174 0.386 2.7e-12
DICTYBASE|DDB_G0287657 733 tpsA "alpha,alpha-trehalose-ph 0.9 0.171 0.330 3.1e-12
ASPGD|ASPL0000027021504 tpsA [Emericella nidulans (tax 0.771 0.214 0.345 2.6e-11
CGD|CAL0004028478 TPS1 [Candida albicans (taxid: 0.607 0.177 0.395 3e-11
UNIPROTKB|Q92410478 TPS1 "Alpha,alpha-trehalose-ph 0.607 0.177 0.395 3e-11
POMBASE|SPAC328.03513 tps1 "alpha,alpha-trehalose-ph 0.6 0.163 0.376 4.1e-10
TAIR|locus:2137712 795 TPS4 "trehalose-6-phosphatase 0.592 0.104 0.415 1.3e-09
FB|FBgn0027560 Tps1 "Trehalose-6-phosphate synthase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 483 (175.1 bits), Expect = 2.2e-45, P = 2.2e-45
 Identities = 96/137 (70%), Positives = 112/137 (81%)

Query:     1 MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDE 60
             MNLVAKEFVACQINE PGVL++SPFAGAGE MHEAL+CNPYE++ AAEVIHRALTMPEDE
Sbjct:   409 MNLVAKEFVACQINEVPGVLVISPFAGAGEMMHEALLCNPYEVNEAAEVIHRALTMPEDE 468

Query:    61 RTLRMNYLRKREKVHDVNYWMRSFLKGMGTLITEDGDDVLPTTMQPVTLEDFDEYLSKYI 120
             R LRM  LR+RE   DV++WMR FLK +G L   + DDV  T MQPV+++DFD+YL KYI
Sbjct:   469 RVLRMARLRRREAECDVSHWMRCFLKAVGAL---EMDDVGTTIMQPVSVDDFDDYLLKYI 525

Query:   121 GTHEQAWALLLDYDGEL 137
             G + +  ALLLDYDG L
Sbjct:   526 GYNHKL-ALLLDYDGTL 541
GO:0003825 "alpha,alpha-trehalose-phosphate synthase (UDP-forming) activity" evidence=ISS;NAS
GO:0005992 "trehalose biosynthetic process" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
TIGR_CMR|GSU_2337 GSU_2337 "glycosyl transferase, group 20 family protein" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P31677 otsA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|O06353 otsA "Trehalose-phosphate synthase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287657 tpsA "alpha,alpha-trehalose-phosphate synthase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000027021 tpsA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0004028 TPS1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q92410 TPS1 "Alpha,alpha-trehalose-phosphate synthase [UDP-forming]" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
POMBASE|SPAC328.03 tps1 "alpha,alpha-trehalose-phosphate synthase [UDP-forming]" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
TAIR|locus:2137712 TPS4 "trehalose-6-phosphatase synthase S4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
cd03788460 cd03788, GT1_TPS, Trehalose-6-Phosphate Synthase ( 3e-37
PRK14501 726 PRK14501, PRK14501, putative bifunctional trehalos 2e-34
TIGR02400456 TIGR02400, trehalose_OtsA, alpha,alpha-trehalose-p 2e-31
COG0380486 COG0380, OtsA, Trehalose-6-phosphate synthase [Car 3e-28
pfam00982470 pfam00982, Glyco_transf_20, Glycosyltransferase fa 5e-27
PRK10117474 PRK10117, PRK10117, trehalose-6-phosphate synthase 2e-23
PLN03064 934 PLN03064, PLN03064, alpha,alpha-trehalose-phosphat 2e-16
PLN03063 797 PLN03063, PLN03063, alpha,alpha-trehalose-phosphat 8e-16
TIGR02398487 TIGR02398, gluc_glyc_Psyn, glucosylglycerol-phosph 2e-13
PLN02205 854 PLN02205, PLN02205, alpha,alpha-trehalose-phosphat 1e-10
>gnl|CDD|99963 cd03788, GT1_TPS, Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information 
 Score =  131 bits (332), Expect = 3e-37
 Identities = 50/86 (58%), Positives = 62/86 (72%), Gaps = 1/86 (1%)

Query: 1   MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDE 60
           MNLVAKE+VACQ ++ PGVLI+S FAGA E++  AL+ NPY+ID  A+ IHRALTMP +E
Sbjct: 373 MNLVAKEYVACQ-DDDPGVLILSEFAGAAEELSGALLVNPYDIDEVADAIHRALTMPLEE 431

Query: 61  RTLRMNYLRKREKVHDVNYWMRSFLK 86
           R  R   LR+  + HDV  W  SFL 
Sbjct: 432 RRERHRKLREYVRTHDVQAWANSFLD 457

It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain. Length = 460
>gnl|CDD|184712 PRK14501, PRK14501, putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>gnl|CDD|233848 TIGR02400, trehalose_OtsA, alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>gnl|CDD|223457 COG0380, OtsA, Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|216227 pfam00982, Glyco_transf_20, Glycosyltransferase family 20 Back     alignment and domain information
>gnl|CDD|182249 PRK10117, PRK10117, trehalose-6-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|215556 PLN03064, PLN03064, alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>gnl|CDD|215555 PLN03063, PLN03063, alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>gnl|CDD|131451 TIGR02398, gluc_glyc_Psyn, glucosylglycerol-phosphate synthase Back     alignment and domain information
>gnl|CDD|177855 PLN02205, PLN02205, alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 140
PLN02205 854 alpha,alpha-trehalose-phosphate synthase [UDP-form 100.0
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 100.0
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 100.0
PRK10117474 trehalose-6-phosphate synthase; Provisional 100.0
PF00982474 Glyco_transf_20: Glycosyltransferase family 20; In 99.97
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 99.97
COG0380486 OtsA Trehalose-6-phosphate synthase [Carbohydrate 99.97
TIGR02398487 gluc_glyc_Psyn glucosylglycerol-phosphate synthase 99.97
KOG1050|consensus 732 99.95
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 99.87
cd03788460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a 99.76
PLN02580 384 trehalose-phosphatase 97.46
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 97.16
cd04951360 GT1_WbdM_like This family is most closely related 97.06
cd03814364 GT1_like_2 This family is most closely related to 96.7
PLN03017 366 trehalose-phosphatase 96.65
cd03809365 GT1_mtfB_like This family is most closely related 96.62
cd03798377 GT1_wlbH_like This family is most closely related 96.6
PLN02151 354 trehalose-phosphatase 96.58
cd03823359 GT1_ExpE7_like This family is most closely related 96.54
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 96.52
cd03800398 GT1_Sucrose_synthase This family is most closely r 96.39
cd03794394 GT1_wbuB_like This family is most closely related 96.23
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 96.18
cd03807365 GT1_WbnK_like This family is most closely related 96.17
cd03820348 GT1_amsD_like This family is most closely related 96.17
cd03818396 GT1_ExpC_like This family is most closely related 96.16
cd03801374 GT1_YqgM_like This family is most closely related 96.16
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 96.14
cd03822366 GT1_ecORF704_like This family is most closely rela 95.98
cd03808359 GT1_cap1E_like This family is most closely related 95.97
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 95.95
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 95.84
cd04962371 GT1_like_5 This family is most closely related to 95.77
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 95.53
cd03819355 GT1_WavL_like This family is most closely related 95.42
cd04946407 GT1_AmsK_like This family is most closely related 95.32
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 95.26
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 95.17
cd03821375 GT1_Bme6_like This family is most closely related 95.13
cd03825365 GT1_wcfI_like This family is most closely related 95.0
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 94.98
cd03813475 GT1_like_3 This family is most closely related to 94.94
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 94.73
cd03804351 GT1_wbaZ_like This family is most closely related 94.73
cd03805392 GT1_ALG2_like This family is most closely related 94.51
PLN00142815 sucrose synthase 94.46
TIGR02470784 sucr_synth sucrose synthase. This model represents 94.39
cd03817374 GT1_UGDG_like This family is most closely related 93.87
PHA01630331 putative group 1 glycosyl transferase 93.71
PLN02949463 transferase, transferring glycosyl groups 93.32
PRK10307412 putative glycosyl transferase; Provisional 93.27
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 92.65
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 92.59
cd04949372 GT1_gtfA_like This family is most closely related 92.12
cd03796398 GT1_PIG-A_like This family is most closely related 91.61
cd03795357 GT1_like_4 This family is most closely related to 91.33
cd03812358 GT1_CapH_like This family is most closely related 91.3
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 90.99
cd03806419 GT1_ALG11_like This family is most closely related 90.91
PHA01633335 putative glycosyl transferase group 1 90.68
PLN02779 286 haloacid dehalogenase-like hydrolase family protei 90.41
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 90.39
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 90.14
cd03816415 GT1_ALG1_like This family is most closely related 90.01
cd03802335 GT1_AviGT4_like This family is most closely relate 89.76
TIGR01672 237 AphA HAD superfamily (subfamily IIIB) phosphatase, 89.39
PRK13225 273 phosphoglycolate phosphatase; Provisional 87.46
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 85.06
PRK11133 322 serB phosphoserine phosphatase; Provisional 84.65
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 84.45
PRK00654466 glgA glycogen synthase; Provisional 84.12
PLN02575 381 haloacid dehalogenase-like hydrolase 83.85
cd04955363 GT1_like_6 This family is most closely related to 82.86
PRK06698 459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 81.23
PLN02605382 monogalactosyldiacylglycerol synthase 81.22
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information 
Probab=100.00  E-value=5.1e-42  Score=312.00  Aligned_cols=137  Identities=33%  Similarity=0.552  Sum_probs=121.7

Q ss_pred             CCCcceeeeecccCC--------------CCeeEEeCcCcchhhhhccCceeCCCCHHHHHHHHHHHhCCCHHHHHHHHH
Q psy9705           1 MNLVAKEFVACQINE--------------PPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDERTLRMN   66 (140)
Q Consensus         1 MNLva~Eyv~~q~~~--------------~~g~LiLSEfaG~a~~L~~ai~VNP~d~~~~A~ai~~AL~m~~~er~~r~~   66 (140)
                      |||||||||+||+++              ++|+||||||||||.+|+|||+|||||++++|+||++||+||++||+.||+
T Consensus       448 MNLva~Eyia~~~~~~~~~~~~~~~~~~~~~gvLiLSEfaGaa~~L~~Ai~VNP~d~~~~a~ai~~AL~m~~~Er~~R~~  527 (854)
T PLN02205        448 MNLIPYEYIISRQGNEKLDKLLGLEPSTPKKSMLVVSEFIGCSPSLSGAIRVNPWNIDAVADAMDSALEMAEPEKQLRHE  527 (854)
T ss_pred             ccccchheeEEccCccccccccccccccCCCCceEeeeccchhHHhCcCeEECCCCHHHHHHHHHHHHcCCHHHHHHHHH
Confidence            999999999999752              489999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhcCChhHHHHHHHHHHHHhhHhh-----CCCCCCCcccccccc------cHHHHHHHHHccCCCceEEEEeccc
Q psy9705          67 YLRKREKVHDVNYWMRSFLKGMGTLITED-----GDDVLPTTMQPVTLE------DFDEYLSKYIGTHEQAWALLLDYDG  135 (140)
Q Consensus        67 ~l~~~V~~~~~~~W~~~~l~~l~~~~~~~-----~~~~~~~~~~p~~~~------~~~~~~~~Y~~s~~R~rl~~lDydG  135 (140)
                      +++++|.+||+.+|+++||.+|.++++.+     .+.|++..++.+.++      +++.++++|+++++|  +|||||||
T Consensus       528 ~~~~~v~~~d~~~W~~~fl~~l~~~~~~~~~~~~~~~g~g~~~~~~~~~~~~~~l~~~~i~~~y~~~~~r--lI~LDyDG  605 (854)
T PLN02205        528 KHYRYVSTHDVGYWARSFLQDLERTCRDHSRRRCWGIGFGLSFRVVALDPNFRKLSMEHIVSAYKRTTTR--AILLDYDG  605 (854)
T ss_pred             HHHHHHhhCCHHHHHHHHHHHHHHHHHHHhhhhhcccccccccccccccccccccCHHHHHHHHHhhcCe--EEEEecCC
Confidence            99999999999999999999999885433     234555666553332      668899999999988  99999999


Q ss_pred             cccC
Q psy9705         136 ELWL  139 (140)
Q Consensus       136 TL~~  139 (140)
                      ||+|
T Consensus       606 TLlp  609 (854)
T PLN02205        606 TLMP  609 (854)
T ss_pred             cccC
Confidence            9996

>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PRK10117 trehalose-6-phosphate synthase; Provisional Back     alignment and domain information
>PF00982 Glyco_transf_20: Glycosyltransferase family 20; InterPro: IPR001830 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>COG0380 OtsA Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase Back     alignment and domain information
>KOG1050|consensus Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
2wtx_A474 Insight Into The Mechanism Of Enzymatic Glycosyltra 7e-15
1uqu_A482 Trehalose-6-Phosphate From E. Coli Bound With Udp-G 7e-15
1gz5_A456 Trehalose-6-Phosphate Synthase. Otsa Length = 456 5e-13
>pdb|2WTX|A Chain A, Insight Into The Mechanism Of Enzymatic Glycosyltransfer With Retention Through The Synthesis And Analysis Of Bisubstrate Glycomimetics Of Trehalose-6-Phosphate Synthase Length = 474 Back     alignment and structure 
Iteration: 1

 Score = 75.9 bits (185), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 55/97 (56%)
Query: 1   MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDE 60
           MNLVAKE+VA Q    PGVL++S FAGA  ++  ALI NPY+ D  A  + RALTM   E
Sbjct: 364 MNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAALDRALTMSLAE 423
Query: 61  RTLRMNYLRKREKVHDVNYWMRSFLKGMGTLITEDGD 97
           R  R   +      +D+N+W   F+  +  ++    +
Sbjct: 424 RISRHAEMLDVIVKNDINHWQECFISDLKQIVPRSAE 460
>pdb|1UQU|A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose. Length = 482 Back     alignment and structure
>pdb|1GZ5|A Chain A, Trehalose-6-Phosphate Synthase. Otsa Length = 456 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
1uqt_A482 Alpha, alpha-trehalose-phosphate synthase; glycosy 6e-43
3t5t_A496 Putative glycosyltransferase; GTB fold, pseudoglyc 7e-39
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* Length = 482 Back     alignment and structure
 Score =  146 bits (370), Expect = 6e-43
 Identities = 39/119 (32%), Positives = 59/119 (49%)

Query: 1   MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDE 60
           MNLVAKE+VA Q    PGVL++S FAGA  ++  ALI NPY+ D  A  + RALTM   E
Sbjct: 364 MNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAALDRALTMSLAE 423

Query: 61  RTLRMNYLRKREKVHDVNYWMRSFLKGMGTLITEDGDDVLPTTMQPVTLEDFDEYLSKY 119
           R  R   +      +D+N+W   F+  +  ++    +      +        + +   +
Sbjct: 424 RISRHAEMLDVIVKNDINHWQECFISDLKQIVPRSAESQQRDKVATFPKLALEHHHHHH 482
>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 3t7d_A* Length = 496 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
3t5t_A496 Putative glycosyltransferase; GTB fold, pseudoglyc 99.89
1uqt_A482 Alpha, alpha-trehalose-phosphate synthase; glycosy 99.78
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 97.46
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 97.23
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 97.2
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 97.2
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 97.03
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 96.9
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 96.88
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 96.85
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 96.73
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 96.58
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 95.78
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 95.57
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 95.43
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 95.41
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 95.41
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 93.21
3l7y_A 304 Putative uncharacterized protein SMU.1108C; hydrol 92.26
3ij5_A 211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 91.56
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 91.52
3nuq_A 282 Protein SSM1, putative nucleotide phosphatase; sup 91.38
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 91.28
2qlt_A 275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 89.66
2b82_A 211 APHA, class B acid phosphatase; DDDD acid phosphat 88.84
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 88.09
4eze_A 317 Haloacid dehalogenase-like hydrolase; magnesium bi 87.72
3nb0_A725 Glycogen [starch] synthase isoform 2; glycogen syn 87.46
3nvb_A 387 Uncharacterized protein; protein FKBH, protein fkb 86.45
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 85.11
2i33_A 258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 84.63
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 83.66
3vue_A536 GBSS-I, granule-bound starch synthase 1, chloropla 80.64
>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A* Back     alignment and structure
Probab=99.89  E-value=1.2e-23  Score=181.47  Aligned_cols=93  Identities=22%  Similarity=0.259  Sum_probs=87.5

Q ss_pred             CCCcceeeeecccCCCCeeEEeCcCcchhhhhc-cCceeCCCCHHHHHHHHHHHhCCCHHHHHHHHHHHHHHhhcCChhH
Q psy9705           1 MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMH-EALICNPYEIDAAAEVIHRALTMPEDERTLRMNYLRKREKVHDVNY   79 (140)
Q Consensus         1 MNLva~Eyv~~q~~~~~g~LiLSEfaG~a~~L~-~ai~VNP~d~~~~A~ai~~AL~m~~~er~~r~~~l~~~V~~~~~~~   79 (140)
                      ||||++||++|+. + +|+||+|||+|+++.|+ ++++|||||++++|+||.+||+||++||++|+++++++|.+||+.+
T Consensus       384 fgLv~~EamA~~~-~-~g~lVlSe~aGa~~~l~~~allVnP~D~~~lA~AI~~aL~m~~~er~~r~~~~~~~V~~~d~~~  461 (496)
T 3t5t_A          384 QNLSTFEAPLVNE-R-DADVILSETCGAAEVLGEYCRSVNPFDLVEQAEAISAALAAGPRQRAEAAARRRDAARPWTLEA  461 (496)
T ss_dssp             CCSHHHHHHHHCS-S-CCEEEEETTBTTHHHHGGGSEEECTTBHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHTTCBHHH
T ss_pred             CChhHHHHHHhCC-C-CCCEEEeCCCCCHHHhCCCEEEECCCCHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHCCHHH
Confidence            8999999999963 3 79999999999999996 6999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhhHhh
Q psy9705          80 WMRSFLKGMGTLITED   95 (140)
Q Consensus        80 W~~~~l~~l~~~~~~~   95 (140)
                      |+++|+.+|..++...
T Consensus       462 W~~~fl~~L~~~~~~~  477 (496)
T 3t5t_A          462 WVQAQLDGLAADHAAR  477 (496)
T ss_dssp             HHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHhhcccch
Confidence            9999999999886443
>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 140
d1uqta_456 c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA 3e-25
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Length = 456 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Trehalose-6-phosphate synthase, OtsA
domain: Trehalose-6-phosphate synthase, OtsA
species: Escherichia coli [TaxId: 562]

 Score = 97.3 bits (241), Expect = 3e-25
 Identities = 39/88 (44%), Positives = 52/88 (59%)

Query: 1   MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDE 60
           MNLVAKE+VA Q    PGVL++S FAGA  ++  ALI NPY+ D  A  + RALTM   E
Sbjct: 363 MNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAALDRALTMSLAE 422

Query: 61  RTLRMNYLRKREKVHDVNYWMRSFLKGM 88
           R  R   +      +D+N+W   F+  +
Sbjct: 423 RISRHAEMLDVIVKNDINHWQECFISDL 450

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
d1uqta_456 Trehalose-6-phosphate synthase, OtsA {Escherichia 99.91
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 97.52
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 97.23
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 97.12
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 92.86
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 88.81
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Trehalose-6-phosphate synthase, OtsA
domain: Trehalose-6-phosphate synthase, OtsA
species: Escherichia coli [TaxId: 562]

Probab=99.91  E-value=2.4e-25  Score=186.81  Aligned_cols=91  Identities=43%  Similarity=0.657  Sum_probs=88.0

Q ss_pred             CCCcceeeeecccCCCCeeEEeCcCcchhhhhccCceeCCCCHHHHHHHHHHHhCCCHHHHHHHHHHHHHHhhcCChhHH
Q psy9705           1 MNLVAKEFVACQINEPPGVLIVSPFAGAGEQMHEALICNPYEIDAAAEVIHRALTMPEDERTLRMNYLRKREKVHDVNYW   80 (140)
Q Consensus         1 MNLva~Eyv~~q~~~~~g~LiLSEfaG~a~~L~~ai~VNP~d~~~~A~ai~~AL~m~~~er~~r~~~l~~~V~~~~~~~W   80 (140)
                      ||||++||++|+.+.++|+||+|||+|+++.|+++++|||||++++|+||++||+||++||++|+++++++|.+||+++|
T Consensus       363 ~~lv~~Ea~a~~~p~~~g~lIlS~~~G~~~~l~~g~lVnP~d~~~~A~ai~~aL~~~~~er~~~~~~~~~~v~~~~~~~W  442 (456)
T d1uqta_         363 MNLVAKEYVAAQDPANPGVLVLSQFAGAANELTSALIVNPYDRDEVAAALDRALTMSLAERISRHAEMLDVIVKNDINHW  442 (456)
T ss_dssp             CCHHHHHHHHHSCTTSCCEEEEETTBGGGGTCTTSEEECTTCHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHTCHHHH
T ss_pred             CCcHHHHHHHhCCCCCCCcEEEeCCCCCHHHhCCeEEECcCCHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHCCHHHH
Confidence            89999999999986558999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHh
Q psy9705          81 MRSFLKGMGTL   91 (140)
Q Consensus        81 ~~~~l~~l~~~   91 (140)
                      +++||.+|.++
T Consensus       443 ~~~fl~~l~~~  453 (456)
T d1uqta_         443 QECFISDLKQI  453 (456)
T ss_dssp             HHHHHHHHHHS
T ss_pred             HHHHHHHHHhh
Confidence            99999999876
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure