Psyllid ID: psy9821
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 78 | ||||||
| 307181027 | 3047 | Multiple epidermal growth factor-like do | 0.910 | 0.023 | 0.633 | 3e-20 | |
| 307200226 | 3025 | Multiple epidermal growth factor-like do | 0.910 | 0.023 | 0.619 | 5e-20 | |
| 322792677 | 2797 | hypothetical protein SINV_14129 [Solenop | 0.910 | 0.025 | 0.619 | 1e-19 | |
| 383864510 | 3039 | PREDICTED: LOW QUALITY PROTEIN: multiple | 0.897 | 0.023 | 0.591 | 1e-19 | |
| 340729098 | 3028 | PREDICTED: multiple epidermal growth fac | 0.910 | 0.023 | 0.591 | 1e-19 | |
| 350401390 | 3022 | PREDICTED: multiple epidermal growth fac | 0.910 | 0.023 | 0.591 | 2e-19 | |
| 380013693 | 3035 | PREDICTED: multiple epidermal growth fac | 0.910 | 0.023 | 0.591 | 5e-19 | |
| 345483939 | 3046 | PREDICTED: multiple epidermal growth fac | 0.910 | 0.023 | 0.619 | 6e-19 | |
| 195434397 | 2938 | GK15317 [Drosophila willistoni] gi|19416 | 0.897 | 0.023 | 0.586 | 3e-18 | |
| 195472897 | 2898 | GE18731 [Drosophila yakuba] gi|194174835 | 0.692 | 0.018 | 0.740 | 7e-18 |
| >gi|307181027|gb|EFN68801.1| Multiple epidermal growth factor-like domains 8 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Score = 102 bits (254), Expect = 3e-20, Method: Compositional matrix adjust.
Identities = 45/71 (63%), Positives = 57/71 (80%)
Query: 8 SCAVAVAARHNISVYEEDARWSYSLCPDVDECGLGLHDCHKDAKCTNTHGSYSCQCKRGF 67
+C+V + N S+ +++ W+Y+ CPDVDEC LGLHDCH DA CTNTHGS+SCQCKRGF
Sbjct: 1266 NCSVVINEDRNSSLKADESGWAYAQCPDVDECDLGLHDCHPDALCTNTHGSFSCQCKRGF 1325
Query: 68 HGDGKTSCTKT 78
+GDGK +CTKT
Sbjct: 1326 NGDGKENCTKT 1336
|
Source: Camponotus floridanus Species: Camponotus floridanus Genus: Camponotus Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307200226|gb|EFN80520.1| Multiple epidermal growth factor-like domains 8 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322792677|gb|EFZ16551.1| hypothetical protein SINV_14129 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383864510|ref|XP_003707721.1| PREDICTED: LOW QUALITY PROTEIN: multiple epidermal growth factor-like domains protein 8-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340729098|ref|XP_003402845.1| PREDICTED: multiple epidermal growth factor-like domains protein 8-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350401390|ref|XP_003486136.1| PREDICTED: multiple epidermal growth factor-like domains protein 8-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|380013693|ref|XP_003690884.1| PREDICTED: multiple epidermal growth factor-like domains protein 8 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|345483939|ref|XP_001604319.2| PREDICTED: multiple epidermal growth factor-like domains protein 8-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|195434397|ref|XP_002065189.1| GK15317 [Drosophila willistoni] gi|194161274|gb|EDW76175.1| GK15317 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195472897|ref|XP_002088734.1| GE18731 [Drosophila yakuba] gi|194174835|gb|EDW88446.1| GE18731 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 78 | ||||||
| FB|FBgn0031981 | 2898 | CG7466 [Drosophila melanogaste | 0.897 | 0.024 | 0.586 | 2.6e-20 | |
| ZFIN|ZDB-GENE-090730-1 | 2774 | megf8 "multiple EGF-like-domai | 0.897 | 0.025 | 0.521 | 1.3e-14 | |
| UNIPROTKB|E1BPS6 | 2772 | MEGF8 "Uncharacterized protein | 0.897 | 0.025 | 0.507 | 2.5e-13 | |
| UNIPROTKB|E2RM39 | 2787 | MEGF8 "Uncharacterized protein | 0.897 | 0.025 | 0.507 | 3.2e-13 | |
| UNIPROTKB|F1RGK2 | 2789 | MEGF8 "Uncharacterized protein | 0.897 | 0.025 | 0.507 | 3.2e-13 | |
| RGD|621190 | 2788 | Megf8 "multiple EGF-like-domai | 0.679 | 0.019 | 0.603 | 4.1e-13 | |
| MGI|MGI:2446294 | 2789 | Megf8 "multiple EGF-like-domai | 0.679 | 0.019 | 0.603 | 4.1e-13 | |
| UNIPROTKB|Q7Z7M0 | 2845 | MEGF8 "Multiple epidermal grow | 0.679 | 0.018 | 0.584 | 1.1e-12 | |
| WB|WBGene00017028 | 1090 | dex-1 [Caenorhabditis elegans | 0.884 | 0.063 | 0.416 | 2.1e-10 | |
| UNIPROTKB|P41950 | 1090 | D1044.2 "EGF-like domain-conta | 0.884 | 0.063 | 0.416 | 2.1e-10 |
| FB|FBgn0031981 CG7466 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 258 (95.9 bits), Expect = 2.6e-20, P = 2.6e-20
Identities = 44/75 (58%), Positives = 58/75 (77%)
Query: 4 FISDSCAVAVAARHNISVYEEDARWSYSLCPDVDECGLGLHDCHKDAKCTNTHGSYSCQC 63
+ + +C++A+ N S + DA W+Y+ CPDVDECGLGLHDCHK+AKCTNT GSY+C C
Sbjct: 1162 YSAGNCSLAL----NSSSHH-DAEWAYAQCPDVDECGLGLHDCHKEAKCTNTQGSYNCHC 1216
Query: 64 KRGFHGDGKTSCTKT 78
+RG+ GDGK SC +T
Sbjct: 1217 RRGYIGDGKFSCVRT 1231
|
|
| ZFIN|ZDB-GENE-090730-1 megf8 "multiple EGF-like-domains 8" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BPS6 MEGF8 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RM39 MEGF8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RGK2 MEGF8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|621190 Megf8 "multiple EGF-like-domains 8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2446294 Megf8 "multiple EGF-like-domains 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7Z7M0 MEGF8 "Multiple epidermal growth factor-like domains protein 8" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00017028 dex-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P41950 D1044.2 "EGF-like domain-containing protein D1044.2" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 78 | |||
| pfam12947 | 36 | pfam12947, EGF_3, EGF domain | 2e-08 | |
| pfam07645 | 42 | pfam07645, EGF_CA, Calcium-binding EGF domain | 6e-08 | |
| cd00054 | 38 | cd00054, EGF_CA, Calcium-binding EGF-like domain, | 9e-07 | |
| smart00179 | 39 | smart00179, EGF_CA, Calcium-binding EGF-like domai | 3e-06 | |
| cd01475 | 224 | cd01475, vWA_Matrilin, VWA_Matrilin: In cartilagin | 1e-05 | |
| cd00053 | 36 | cd00053, EGF, Epidermal growth factor domain, foun | 0.001 |
| >gnl|CDD|205157 pfam12947, EGF_3, EGF domain | Back alignment and domain information |
|---|
Score = 45.2 bits (108), Expect = 2e-08
Identities = 18/35 (51%), Positives = 22/35 (62%)
Query: 39 CGLGLHDCHKDAKCTNTHGSYSCQCKRGFHGDGKT 73
C CH +A CTNT GS++C CK G+ GDG T
Sbjct: 1 CAENNGGCHPNATCTNTGGSFTCTCKSGYTGDGVT 35
|
This family includes a variety of EGF-like domain homologues. This family includes the C-terminal domain of the malaria parasite MSP1 protein. Length = 36 |
| >gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain | Back alignment and domain information |
|---|
| >gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|238752 cd01475, vWA_Matrilin, VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >gnl|CDD|238010 cd00053, EGF, Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 98.62 | |
| KOG4289|consensus | 2531 | 98.58 | ||
| KOG1214|consensus | 1289 | 98.54 | ||
| KOG1219|consensus | 4289 | 98.43 | ||
| KOG1214|consensus | 1289 | 98.32 | ||
| KOG1219|consensus | 4289 | 98.28 | ||
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 97.97 | |
| KOG4289|consensus | 2531 | 97.93 | ||
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 97.92 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 97.7 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.53 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.45 | |
| KOG4260|consensus | 350 | 97.31 | ||
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 97.3 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.2 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 97.18 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 97.13 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.07 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 96.97 | |
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 96.95 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 96.92 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 96.87 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 96.45 | |
| KOG1217|consensus | 487 | 96.19 | ||
| KOG1217|consensus | 487 | 96.14 | ||
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 95.46 | |
| KOG1225|consensus | 525 | 93.88 | ||
| cd01475 | 224 | vWA_Matrilin VWA_Matrilin: In cartilaginous plate, | 93.55 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 93.25 | |
| KOG4260|consensus | 350 | 91.78 | ||
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 91.78 | |
| KOG1225|consensus | 525 | 90.72 | ||
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 88.83 | |
| PF12946 | 37 | EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 | 81.93 | |
| KOG1226|consensus | 783 | 81.26 | ||
| PF09064 | 34 | Tme5_EGF_like: Thrombomodulin like fifth domain, E | 80.71 |
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
Probab=98.62 E-value=7.4e-08 Score=41.31 Aligned_cols=35 Identities=49% Similarity=1.128 Sum_probs=31.1
Q ss_pred CcccCCCCCCCCCCCCEEEeCCCCeEeeCCCCcee
Q psy9821 35 DVDECGLGLHDCHKDAKCTNTHGSYSCQCKRGFHG 69 (78)
Q Consensus 35 ~~~~c~~~~~~c~~~~~C~~~~~~~~c~C~~g~~~ 69 (78)
+++||....+.|.....|+|+.|+|.|.|+.||..
T Consensus 1 DidEC~~~~~~C~~~~~C~N~~Gsy~C~C~~Gy~~ 35 (42)
T PF07645_consen 1 DIDECAEGPHNCPENGTCVNTEGSYSCSCPPGYEL 35 (42)
T ss_dssp ESSTTTTTSSSSSTTSEEEEETTEEEEEESTTEEE
T ss_pred CccccCCCCCcCCCCCEEEcCCCCEEeeCCCCcEE
Confidence 47888887788987899999999999999999984
|
Many of these proteins require calcium for their biological function and a calcium-binding site has been found at the N terminus of some EGF-like domains []. Calcium-binding may be crucial for numerous protein-protein interactions. For human coagulation factor IX it has been shown [] that the calcium-ligands form a pentagonal bipyramid. The first, third and fourth conserved negatively charged or polar residues are side chain ligands. The latter is possibly hydroxylated (see aspartic acid and asparagine hydroxylation site) []. A conserved aromatic residue, as well as the second conserved negative residue, are thought to be involved in stabilising the calcium-binding site. As in non-calcium binding EGF-like domains, there are six conserved cysteines and the structure of both types is very similar as calcium-binding induces only strictly local structural changes []. +------------------+ +---------+ | | | | nxnnC-x(3,14)-C-x(3,7)-CxxbxxxxaxC-x(1,6)-C-x(8,13)-Cx | | +------------------+ 'n': negatively charged or polar residue [DEQN] 'b': possibly beta-hydroxylated residue [DN] 'a': aromatic amino acid 'C': cysteine, involved in disulphide bond 'x': any amino acid. ; GO: 0005509 calcium ion binding; PDB: 2VJ3_A 1TOZ_A 1LMJ_A 1UZQ_A 1UZK_A 1UZJ_B 1UZP_A 1EMO_A 1EMN_A 2RR0_A .... |
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF09064 Tme5_EGF_like: Thrombomodulin like fifth domain, EGF-like; InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 78 | ||||
| 1toz_A | 116 | Nmr Structure Of The Human Notch-1 Ligand Binding R | 6e-05 | ||
| 2vj3_A | 135 | Human Notch-1 Egfs 11-13 Length = 135 | 6e-05 | ||
| 2bo2_A | 143 | Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune Syst | 8e-05 |
| >pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 | Back alignment and structure |
|
| >pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 | Back alignment and structure |
| >pdb|2BO2|A Chain A, Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune System Molecule, In Complex With Calcium. Length = 143 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 78 | |||
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 4e-12 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 2e-11 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 7e-07 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 6e-09 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 2e-08 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 2e-08 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 3e-08 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 6e-07 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 7e-07 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 6e-04 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 2e-06 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 4e-06 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 1e-05 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 8e-04 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 3e-06 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 1e-05 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 2e-05 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 3e-05 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 5e-04 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 1e-04 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 5e-04 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 6e-04 |
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 | Back alignment and structure |
|---|
Score = 58.2 bits (140), Expect = 4e-12
Identities = 9/39 (23%), Positives = 16/39 (41%)
Query: 35 DVDECGLGLHDCHKDAKCTNTHGSYSCQCKRGFHGDGKT 73
C H C A+C + + C+C + G+G+
Sbjct: 4 AQQTCANNRHQCSVHAECRDYATGFCCRCVANYTGNGRQ 42
|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 99.27 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.2 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 99.14 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 99.09 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.09 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 99.05 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 99.01 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 99.01 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.0 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 98.98 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 98.97 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 98.96 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 98.94 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 98.93 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 98.92 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 98.91 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.89 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.85 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.83 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.8 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 98.79 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 98.78 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.77 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.71 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.69 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.67 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.61 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 98.4 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 98.36 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 98.33 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.28 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.06 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.04 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 98.02 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 97.99 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.99 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 97.97 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 97.96 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 97.96 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 97.94 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 97.91 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 97.78 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 97.78 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.76 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 97.74 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 97.65 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 97.62 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 97.56 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.51 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.48 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 97.41 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 97.41 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 97.38 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.36 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 97.35 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.31 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.29 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 97.29 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 97.27 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.25 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 97.22 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.2 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.17 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 97.17 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 97.15 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.07 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.05 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 97.04 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.02 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 97.0 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 96.97 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 96.89 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 96.88 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 96.81 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 96.8 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 96.8 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 96.71 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 96.71 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 96.69 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 96.69 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 96.65 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 96.65 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 96.63 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 96.54 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 96.51 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 96.41 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 96.41 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 96.34 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 96.23 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 96.07 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 96.06 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 96.01 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 95.98 | |
| 3v64_C | 349 | Agrin; beta propeller, laminin-G, signaling, prote | 95.56 | |
| 1gl4_A | 285 | Nidogen-1, entactin; immunoglobulin-like domain, e | 95.5 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 95.24 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 95.11 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 95.11 | |
| 3f1s_B | 283 | Vitamin K-dependent protein Z; PZ, ZPI, complex, s | 95.02 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 94.92 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 94.82 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 94.76 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 94.57 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 94.55 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 94.28 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 94.15 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 93.81 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 93.78 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 93.77 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 93.71 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 93.71 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 93.31 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 93.29 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 92.31 | |
| 1nzi_A | 159 | Complement C1S component; calcium, innate immunity | 92.29 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 92.26 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 92.06 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 91.77 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 91.75 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 91.53 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 91.36 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 91.09 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 90.82 | |
| 4a0p_A | 628 | LRP6, LRP-6, low-density lipoprotein receptor-rela | 90.66 | |
| 1ijq_A | 316 | LDL receptor, low-density lipoprotein receptor; be | 90.55 | |
| 3s94_A | 619 | LRP-6, low-density lipoprotein receptor-related pr | 90.43 | |
| 3sov_A | 318 | LRP-6, low-density lipoprotein receptor-related pr | 87.99 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 86.26 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 83.91 | |
| 3fby_A | 551 | COMP, cartilage oligomeric matrix protein; signatu | 83.65 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 82.38 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 80.47 |
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
Probab=99.27 E-value=6.4e-12 Score=60.54 Aligned_cols=66 Identities=24% Similarity=0.557 Sum_probs=52.9
Q ss_pred cccc-cccccCCcceeecCCCCC--CCCCCCcccCCCCCCCCCCCCEEEeCCCCeEeeCCCCceeCCCCce
Q psy9821 8 SCAV-AVAARHNISVYEEDARWS--YSLCPDVDECGLGLHDCHKDAKCTNTHGSYSCQCKRGFHGDGKTSC 75 (78)
Q Consensus 8 ~C~~-~~~~~~~~~~c~c~~g~~--~~~C~~~~~c~~~~~~c~~~~~C~~~~~~~~c~C~~g~~~~~~~~c 75 (78)
.|.+ .|.+..++|.|.|++||. |..|+++++|.. ..+|.. +.|++..++|.|.|+.||.+.....|
T Consensus 13 ~C~~g~C~n~~g~y~C~C~~Gy~~~g~~C~dideC~~-~~~C~~-~~C~n~~g~y~C~C~~G~~g~~~~~C 81 (82)
T 1emn_A 13 VCKHGQCINTDGSYRCECPFGYILAGNECVDTDECSV-GNPCGN-GTCKNVIGGFECTCEEGFEPGPMMTC 81 (82)
T ss_dssp SCSSSEECCCSSCCCEECCTTEEEETTEEEECCGGGT-CCTTSS-SCEEECSSSEEECCSSSSCCCSSSCC
T ss_pred CcCCCEEEecCCCEEEECCCCeECCCCccCCcccccC-CCCCCC-CEeECCCCCEEeECCCCeEeCCCCcc
Confidence 4443 566778999999999996 889999999974 457864 58999999999999999987654333
|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* | Back alignment and structure |
|---|
| >1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 | Back alignment and structure |
|---|
| >3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* | Back alignment and structure |
|---|
| >3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >3fby_A COMP, cartilage oligomeric matrix protein; signature domain, cell adhesion, disease mutation, dwarfism, EGF-like domain, glycoprotein, secreted; HET: NAG MAN; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 78 | ||||
| d1gl4a2 | 40 | g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 | 3e-09 | |
| d2vj3a1 | 42 | g.3.11.1 (A:411-452) Neurogenic locus notch homolo | 8e-08 | |
| d1emoa1 | 43 | g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa | 3e-07 | |
| d1lmja1 | 44 | g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens | 8e-07 | |
| d1uzka2 | 43 | g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa | 1e-05 | |
| d1apqa_ | 53 | g.3.11.1 (A:) Complement protease C1R {Human (Homo | 1e-05 | |
| d1lmja2 | 42 | g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien | 3e-05 | |
| d1uzka1 | 43 | g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa | 1e-04 | |
| d1dx5i3 | 40 | g.3.11.1 (I:423-462) Thrombomodulin, different EGF | 3e-04 | |
| d1szba2 | 45 | g.3.11.1 (A:124-168) Mannose-binding protein assoc | 6e-04 | |
| d1nt0a3 | 45 | g.3.11.1 (A:120-164) Mannose-binding protein assoc | 6e-04 | |
| d1edmb_ | 39 | g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens | 0.001 | |
| d3bpse1 | 40 | g.3.11.1 (E:293-332) Low density lipoprotein (LDL) | 0.001 | |
| d1i0ua2 | 41 | g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r | 0.002 | |
| d2c4fl1 | 37 | g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrof | 0.003 |
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-like domain of nidogen-1 domain: EGF-like domain of nidogen-1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 45.6 bits (108), Expect = 3e-09
Identities = 9/35 (25%), Positives = 16/35 (45%)
Query: 39 CGLGLHDCHKDAKCTNTHGSYSCQCKRGFHGDGKT 73
C H C A+C + + C+C + G+G+
Sbjct: 2 CANNRHQCSVHAECRDYATGFCCRCVANYTGNGRQ 36
|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Length = 37 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 78 | |||
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.87 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.78 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.59 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.55 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.39 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 98.38 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 98.32 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.31 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.3 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 98.29 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.27 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 98.27 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 98.26 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 98.23 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 98.22 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.22 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.07 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 98.06 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.02 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 97.88 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 97.86 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 97.86 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.84 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 97.83 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 97.82 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 97.82 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.79 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 97.79 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 97.73 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.73 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 97.73 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.72 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 97.69 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 97.68 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.64 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 97.64 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.61 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 97.58 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 97.51 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 97.49 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.48 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.48 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.47 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.46 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 97.46 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.39 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 97.27 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 97.22 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 97.18 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.15 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 97.14 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 97.1 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.09 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.09 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.01 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 96.99 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 96.94 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.89 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 96.88 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 96.88 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 96.76 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 96.68 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 96.43 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.35 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 96.29 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 96.06 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 96.02 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 95.73 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 95.5 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 95.4 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 94.89 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 94.49 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 94.28 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 90.49 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 90.18 | |
| d1dx5i1 | 43 | Thrombomodulin, different EGF-like domains {Human | 87.78 | |
| d1dx5i2 | 35 | Thrombomodulin, different EGF-like domains {Human | 83.0 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 82.94 |
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Fibrillin-1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.87 E-value=1.2e-09 Score=45.49 Aligned_cols=43 Identities=35% Similarity=0.672 Sum_probs=34.1
Q ss_pred CCCCcccCCCCCCCCCCCCEEEeCCCCeEeeCCCCceeCCCCceee
Q psy9821 32 LCPDVDECGLGLHDCHKDAKCTNTHGSYSCQCKRGFHGDGKTSCTK 77 (78)
Q Consensus 32 ~C~~~~~c~~~~~~c~~~~~C~~~~~~~~c~C~~g~~~~~~~~c~~ 77 (78)
.|.+++||......+ .+.|+|++|+|.|.|+.||..++.. |.|
T Consensus 1 sCvDidEC~~~~~~~--~~~C~Nt~Gsy~C~C~~Gy~~~g~~-C~D 43 (43)
T d1emoa1 1 SAVDMDECKEPDVCK--HGQCINTDGSYRCECPFGYILAGNE-CVD 43 (43)
T ss_dssp CCCCCCSSSSTTSCS--SSCCCCCSSCCCCCCCTTEEESSSC-EEE
T ss_pred CCcceeccCCcCCCC--CCEeECCCCCeEeECCCCcccCCCc-ccC
Confidence 478999998654433 4789999999999999999987654 654
|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i1 g.3.11.1 (I:345-387) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i2 g.3.11.1 (I:388-422) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|