Psyllid ID: psy988


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------41
MDKTVRLWHISRKECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVWNEVEGQTKLITAANFCENGKFAVVGSYDGRCIFYTTDQLKYHTQIHVRSTRGKNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLVSADFNGVIRVFLNKTKPKHSSLPVSALA
ccccEEEEEccccEEEEEEcccccEEEEEEccccccEEEEccccccEEEEEcccccEEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEEEEEEcccccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEEEcccccEEEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEccccccccccccEEccccEEEEEEccccccEEEEEcccccEEEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEccccEEEEEEEcccccEEEEEEEEcccccEEEEccccccEEEEEcccccEEEEEccccccccccccccccccEEEEEEccccccEEEEcccccccccccEEEEEcccccEEEEEccccccEEcccccccc
cccEEEEEEcccccEEEEEcccccEEEEEEccccccEEEEEccccEEEEEEcccccEEEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccEEEEcccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEccccccccEEEEEccccccEEEEEEcccccEEEEEccccccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccccEEEEEccccccEEEEEEcccccEEEEEccccccccccEEEEEcccccEEEEEEccccccccEccccccc
MDKTVRLWHISRkeclccfqhidfvtaicfhprddryflsgsldgklrlwnipdkkvAVWNEVEGQTKLITAAnfcengkfavvgsydgrcifyttdqlkyhtqihvrstrgknatgrkisgiepmpgedkilvtsndsrirlydlrdlnlsckykgyVNVSSQIKAsfshdgkyivsgsenQCIYIWKTHHdyakfssvrrdrndfwegikAHNAVvtcavfapcpeliiaqmepdksestgyvlnatgrkisgiepmpgedkilvtsndsrirlydlrdlnlsckykgyVNVSSQIKAsfshdgkyivsgsenQCIYIWKTHHdyakfssvrrdrndfwegikAHNAVvtcavfapcpeliiaqmepdksestgyVLVSADFNGVIRVFLNktkpkhsslpvsala
MDKTVRLWHISRKECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVWNEVEGQTKLITAANFCENGKFAVVGSYDGRCIFYTTDQLkyhtqihvrstrgknatgrkisgiepmpgedkilvtsndsrirlYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLNATGrkisgiepmpgedKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLVSADFNGVIRVFLNktkpkhsslpvsala
MDKTVRLWHISRKECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVWNEVEGQTKLITAANFCENGKFAVVGSYDGRCIFYTTDQLKYHTQIHVRSTRGKNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLVSADFNGVIRVFLNKTKPKHSSLPVSALA
****VRLWHISRKECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVWNEVEGQTKLITAANFCENGKFAVVGSYDGRCIFYTTDQLKYHTQIHVRS**********************ILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQM********GYVLNATGRKI**********KILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQME*****STGYVLVSADFNGVIRVFLN***************
MDKTVRLWHISRKECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVWNEVEGQTKLITAANFCENGKFAVVGSYDGRCIFYTTDQLKYHTQIHVRSTRGKNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIA******SESTGYVLVSADFNGVIRVFLNKTKP***********
MDKTVRLWHISRKECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVWNEVEGQTKLITAANFCENGKFAVVGSYDGRCIFYTTDQLKYHTQIHVRSTRGKNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLVSADFNGVIRVFLNKTKP***********
MDKTVRLWHISRKECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVWNEVEGQTKLITAANFCENGKFAVVGSYDGRCIFYTTDQLKYHTQIHVRSTRGKNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLVSADFNGVIRVFLNKT*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKTVRLWHISRKECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVWNEVEGQTKLITAANFCENGKFAVVGSYDGRCIFYTTDQLKYHTQIHVRSTRGKNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLVSADFNGVIRVFLNKTKPKHSSLPVSALA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query408 2.2.26 [Sep-21-2011]
Q9XSC3912 WD repeat-containing prot yes N/A 0.681 0.304 0.705 1e-123
Q6NVE8915 WD repeat-containing prot yes N/A 0.683 0.304 0.700 1e-123
Q5JSH3913 WD repeat-containing prot yes N/A 0.683 0.305 0.700 1e-122
Q9R037908 WD repeat-containing prot yes N/A 0.674 0.302 0.703 1e-121
Q498F0912 WD repeat-containing prot N/A N/A 0.588 0.263 0.809 1e-119
Q6LA54 933 Uncharacterized WD repeat yes N/A 0.453 0.198 0.528 2e-59
Q03177 834 WD repeat-containing prot yes N/A 0.458 0.224 0.368 4e-28
O60136586 Uncharacterized WD repeat no N/A 0.700 0.488 0.308 4e-28
P32330 852 2-deoxy-glucose resistant no N/A 0.455 0.218 0.317 9e-22
Q8YRI11526 Uncharacterized WD repeat yes N/A 0.625 0.167 0.256 7e-17
>sp|Q9XSC3|WDR44_BOVIN WD repeat-containing protein 44 OS=Bos taurus GN=WDR44 PE=1 SV=1 Back     alignment and function desciption
 Score =  442 bits (1138), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 208/295 (70%), Positives = 240/295 (81%), Gaps = 17/295 (5%)

Query: 1   MDKTVRLWHISRKECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVW 60
           MDKTVRLWHISR+ECLCCFQHIDFVTAI FHPRDDRYFLSGSLDGKLRLWNIPDKKVA+W
Sbjct: 625 MDKTVRLWHISRRECLCCFQHIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALW 684

Query: 61  NEVEGQTKLITAANFCENGKFAVVGSYDGRCIFYTTDQLKYHTQIHVRSTRGKNATGRKI 120
           NEV+GQTKLITAANFC+NGK+AV+G+YDGRCIFY T+ LKYHTQIHVRSTRG+N  GRKI
Sbjct: 685 NEVDGQTKLITAANFCQNGKYAVIGTYDGRCIFYDTEHLKYHTQIHVRSTRGRNKVGRKI 744

Query: 121 SGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGS 180
           +GIEP+PGE+KILVTSNDSRIRLYDLRDL+LS KYKGYVN SSQIKASFSHD  Y+VSGS
Sbjct: 745 TGIEPLPGENKILVTSNDSRIRLYDLRDLSLSMKYKGYVNSSSQIKASFSHDFNYLVSGS 804

Query: 181 ENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIA-QMEPDKS 239
           E++ +YIW T+HD +KF+SVRRDRNDFWEGIKAHNAVVT A+FAP P L+++  ++ +KS
Sbjct: 805 EDKYVYIWSTYHDLSKFTSVRRDRNDFWEGIKAHNAVVTSAIFAPNPSLMLSLDVQSEKS 864

Query: 240 ESTGYVLNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNV 294
           E      N  G     +E MP           S I   D  ++ LS  + G + V
Sbjct: 865 EG-----NEKGEDAEVLETMP-----------SGIMKTDNTEVLLSADFTGAIKV 903




Downstream effector for RAB11. May be involved in vesicle recycling.
Bos taurus (taxid: 9913)
>sp|Q6NVE8|WDR44_MOUSE WD repeat-containing protein 44 OS=Mus musculus GN=Wdr44 PE=1 SV=1 Back     alignment and function description
>sp|Q5JSH3|WDR44_HUMAN WD repeat-containing protein 44 OS=Homo sapiens GN=WDR44 PE=1 SV=1 Back     alignment and function description
>sp|Q9R037|WDR44_RAT WD repeat-containing protein 44 OS=Rattus norvegicus GN=Wdr44 PE=1 SV=1 Back     alignment and function description
>sp|Q498F0|WDR44_XENLA WD repeat-containing protein 44 OS=Xenopus laevis GN=wdr44 PE=2 SV=1 Back     alignment and function description
>sp|Q6LA54|YF48_SCHPO Uncharacterized WD repeat-containing protein C3H5.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H5.08c PE=1 SV=2 Back     alignment and function description
>sp|Q03177|YMZ2_YEAST WD repeat-containing protein YMR102C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR102C PE=1 SV=1 Back     alignment and function description
>sp|O60136|YNS5_SCHPO Uncharacterized WD repeat-containing protein C18H10.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC18H10.05 PE=4 SV=1 Back     alignment and function description
>sp|P32330|DGR2_YEAST 2-deoxy-glucose resistant protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DGR2 PE=1 SV=1 Back     alignment and function description
>sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
328703990 929 PREDICTED: WD repeat-containing protein 0.602 0.264 0.894 1e-136
307203415 1006 WD repeat-containing protein 44 [Harpegn 0.382 0.155 0.944 1e-135
332023075 1001 WD repeat-containing protein 44 [Acromyr 0.595 0.242 0.907 1e-134
380016247 969 PREDICTED: WD repeat-containing protein 0.384 0.162 0.944 1e-134
328783506 970 PREDICTED: WD repeat-containing protein 0.384 0.161 0.944 1e-134
350403695 971 PREDICTED: WD repeat-containing protein 0.382 0.160 0.944 1e-134
340725321 971 PREDICTED: WD repeat-containing protein 0.382 0.160 0.944 1e-134
345493186 1006 PREDICTED: WD repeat-containing protein 0.468 0.189 0.940 1e-134
383859736 970 PREDICTED: WD repeat-containing protein 0.382 0.160 0.940 1e-134
157137813 971 wd-repeat protein [Aedes aegypti] gi|108 0.578 0.243 0.919 1e-133
>gi|328703990|ref|XP_001948245.2| PREDICTED: WD repeat-containing protein 44-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  489 bits (1259), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 221/247 (89%), Positives = 237/247 (95%), Gaps = 1/247 (0%)

Query: 1   MDKTVRLWHISRKECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVW 60
           MDKTVRLWHISR+ECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVW
Sbjct: 654 MDKTVRLWHISRRECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVW 713

Query: 61  NEVEGQTKLITAANFCENGKFAVVGSYDGRCIFYTTDQLKYHTQIHVRSTRGKNATGRKI 120
           NEVEGQTKLITAANFC+NGKFAVVGSYDGRCIFYTTDQL+YHTQIHVRSTRG+N+TGRKI
Sbjct: 714 NEVEGQTKLITAANFCQNGKFAVVGSYDGRCIFYTTDQLRYHTQIHVRSTRGRNSTGRKI 773

Query: 121 SGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGS 180
           SGIEPMPGEDK+LVTSNDSRIRLYDLRDLNLSCKYKGYVN+SSQIKASFSHDGKYIV GS
Sbjct: 774 SGIEPMPGEDKVLVTSNDSRIRLYDLRDLNLSCKYKGYVNISSQIKASFSHDGKYIVCGS 833

Query: 181 ENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDK-S 239
           ENQCIY+WKTHHDY+KF+SVRRDRND+WEGIKAHNAVVTCA+FAP PE++  QM+ D+ S
Sbjct: 834 ENQCIYVWKTHHDYSKFTSVRRDRNDYWEGIKAHNAVVTCAIFAPNPEVVFRQMKTDENS 893

Query: 240 ESTGYVL 246
              GYV 
Sbjct: 894 GQDGYVF 900




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307203415|gb|EFN82490.1| WD repeat-containing protein 44 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332023075|gb|EGI63340.1| WD repeat-containing protein 44 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380016247|ref|XP_003692099.1| PREDICTED: WD repeat-containing protein 44-like [Apis florea] Back     alignment and taxonomy information
>gi|328783506|ref|XP_392050.4| PREDICTED: WD repeat-containing protein 44-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350403695|ref|XP_003486879.1| PREDICTED: WD repeat-containing protein 44-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340725321|ref|XP_003401020.1| PREDICTED: WD repeat-containing protein 44-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|345493186|ref|XP_001604905.2| PREDICTED: WD repeat-containing protein 44-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383859736|ref|XP_003705348.1| PREDICTED: WD repeat-containing protein 44-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|157137813|ref|XP_001664046.1| wd-repeat protein [Aedes aegypti] gi|108869643|gb|EAT33868.1| AAEL013866-PA [Aedes aegypti] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query408
UNIPROTKB|Q9XSC3912 WDR44 "WD repeat-containing pr 0.644 0.288 0.752 3.7e-116
UNIPROTKB|Q5JSH3913 WDR44 "WD repeat-containing pr 0.691 0.308 0.711 1.6e-115
MGI|MGI:1919654915 Wdr44 "WD repeat domain 44" [M 0.683 0.304 0.700 5.4e-115
RGD|727965908 Wdr44 "WD repeat domain 44" [R 0.588 0.264 0.809 4.3e-111
WB|WBGene000063691043 sym-4 [Caenorhabditis elegans 0.710 0.278 0.541 1.7e-86
POMBASE|SPAC3H5.08c 933 SPAC3H5.08c "WD repeat protein 0.531 0.232 0.482 1.8e-57
ASPGD|ASPL0000061877 947 srgL [Emericella nidulans (tax 0.526 0.227 0.519 7.9e-57
TAIR|locus:2090146883 AT3G15470 "AT3G15470" [Arabido 0.487 0.225 0.447 1e-43
TAIR|locus:2153443825 AT5G54200 "AT5G54200" [Arabido 0.580 0.287 0.388 2.5e-41
TAIR|locus:2040731903 AT2G37670 "AT2G37670" [Arabido 0.715 0.323 0.333 2.7e-37
UNIPROTKB|Q9XSC3 WDR44 "WD repeat-containing protein 44" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 1094 (390.2 bits), Expect = 3.7e-116, Sum P(2) = 3.7e-116
 Identities = 204/271 (75%), Positives = 233/271 (85%)

Query:     1 MDKTVRLWHISRKECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVW 60
             MDKTVRLWHISR+ECLCCFQHIDFVTAI FHPRDDRYFLSGSLDGKLRLWNIPDKKVA+W
Sbjct:   625 MDKTVRLWHISRRECLCCFQHIDFVTAIAFHPRDDRYFLSGSLDGKLRLWNIPDKKVALW 684

Query:    61 NEVEGQTKLITAANFCENGKFAVVGSYDGRCIFYTTDQLKYHTQIHVRSTRGKNATGRKI 120
             NEV+GQTKLITAANFC+NGK+AV+G+YDGRCIFY T+ LKYHTQIHVRSTRG+N  GRKI
Sbjct:   685 NEVDGQTKLITAANFCQNGKYAVIGTYDGRCIFYDTEHLKYHTQIHVRSTRGRNKVGRKI 744

Query:   121 SGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGS 180
             +GIEP+PGE+KILVTSNDSRIRLYDLRDL+LS KYKGYVN SSQIKASFSHD  Y+VSGS
Sbjct:   745 TGIEPLPGENKILVTSNDSRIRLYDLRDLSLSMKYKGYVNSSSQIKASFSHDFNYLVSGS 804

Query:   181 ENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIA-QMEPDKS 239
             E++ +YIW T+HD +KF+SVRRDRNDFWEGIKAHNAVVT A+FAP P L+++  ++ +KS
Sbjct:   805 EDKYVYIWSTYHDLSKFTSVRRDRNDFWEGIKAHNAVVTSAIFAPNPSLMLSLDVQSEKS 864

Query:   240 ESTGYVLNATGRKISGIEPMPGEDKILVTSN 270
             E      N  G     +E MP    I+ T N
Sbjct:   865 EG-----NEKGEDAEVLETMPSG--IMKTDN 888


GO:0048471 "perinuclear region of cytoplasm" evidence=IEA
GO:0010008 "endosome membrane" evidence=IEA
GO:0005829 "cytosol" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IEA
UNIPROTKB|Q5JSH3 WDR44 "WD repeat-containing protein 44" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1919654 Wdr44 "WD repeat domain 44" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|727965 Wdr44 "WD repeat domain 44" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00006369 sym-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
POMBASE|SPAC3H5.08c SPAC3H5.08c "WD repeat protein, human WDR44 family" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
ASPGD|ASPL0000061877 srgL [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2090146 AT3G15470 "AT3G15470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2153443 AT5G54200 "AT5G54200" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2040731 AT2G37670 "AT2G37670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6NVE8WDR44_MOUSENo assigned EC number0.70060.68380.3049yesN/A
Q9XSC3WDR44_BOVINNo assigned EC number0.70500.68130.3048yesN/A
Q9R037WDR44_RATNo assigned EC number0.70340.67400.3028yesN/A
Q5JSH3WDR44_HUMANNo assigned EC number0.70060.68380.3055yesN/A
Q6LA54YF48_SCHPONo assigned EC number0.52820.45340.1982yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-25
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-24
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 9e-23
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-20
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-17
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-10
smart0032040 smart00320, WD40, WD40 repeats 2e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-05
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 9e-05
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  103 bits (259), Expect = 3e-25
 Identities = 70/325 (21%), Positives = 119/325 (36%), Gaps = 69/325 (21%)

Query: 2   DKTVRLWHISRKECLCCFQ-HIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVW 60
           D T+++W +   E L   + H   V  +     D  Y  SGS D  +RLW++   +    
Sbjct: 30  DGTIKVWDLETGELLRTLKGHTGPVRDVAASA-DGTYLASGSSDKTIRLWDLETGECV-- 86

Query: 61  NEVEGQTKLITAANFCENGKFAVVGSYDGRCIFYTTDQLKYHTQIHVRSTRGKNATGRKI 120
             + G T  +++  F  +G+     S D     +  +  K      + + RG       +
Sbjct: 87  RTLTGHTSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKC-----LTTLRGHTDWVNSV 141

Query: 121 SGIEPMPGEDKILVT-SNDSRIRLYDLRDLNLSCKYKG-YVNVSSQIKASFSHDGKYIVS 178
           +       +   + + S D  I+L+DLR         G    V+S    +FS DG+ ++S
Sbjct: 142 A----FSPDGTFVASSSQDGTIKLWDLRTGKCVATLTGHTGEVNS---VAFSPDGEKLLS 194

Query: 179 GSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDK 238
            S +  I +W    D +    +          ++ H   V    F+P   L+ +      
Sbjct: 195 SSSDGTIKLW----DLSTGKCLGT--------LRGHENGVNSVAFSPDGYLLAS------ 236

Query: 239 SESTGYVLNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVN-VSSQ 297
                                         S D  IR++DLR         G+ N V+S 
Sbjct: 237 -----------------------------GSEDGTIRVWDLRTGECVQTLSGHTNSVTS- 266

Query: 298 IKASFSHDGKYIVSGSENQCIYIWK 322
              ++S DGK + SGS +  I IW 
Sbjct: 267 --LAWSPDGKRLASGSADGTIRIWD 289


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 408
KOG0271|consensus480 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG0286|consensus343 100.0
KOG0272|consensus459 100.0
KOG0315|consensus311 100.0
KOG0318|consensus603 100.0
KOG0319|consensus 775 100.0
KOG0279|consensus315 100.0
KOG0315|consensus311 100.0
KOG0282|consensus503 100.0
KOG0293|consensus519 100.0
KOG0295|consensus406 100.0
KOG0296|consensus399 100.0
KOG0279|consensus315 100.0
KOG0273|consensus524 100.0
KOG0284|consensus464 100.0
KOG0265|consensus338 100.0
KOG0645|consensus312 100.0
KOG0319|consensus 775 100.0
KOG0286|consensus343 100.0
KOG0263|consensus707 100.0
KOG0306|consensus 888 100.0
KOG0318|consensus603 100.0
KOG0291|consensus 893 100.0
KOG0273|consensus524 100.0
KOG0291|consensus 893 100.0
KOG0285|consensus460 100.0
KOG0266|consensus456 100.0
KOG0316|consensus307 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0281|consensus499 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0295|consensus406 100.0
KOG0306|consensus 888 100.0
KOG0284|consensus464 100.0
KOG0643|consensus327 100.0
KOG0276|consensus 794 100.0
KOG0645|consensus312 100.0
KOG0263|consensus707 100.0
KOG0292|consensus 1202 100.0
KOG0285|consensus460 100.0
KOG0278|consensus334 100.0
KOG0281|consensus499 100.0
KOG1407|consensus313 100.0
KOG0266|consensus456 100.0
KOG0316|consensus307 100.0
KOG0313|consensus423 100.0
KOG1446|consensus311 100.0
KOG0275|consensus508 100.0
KOG0296|consensus399 100.0
KOG0276|consensus 794 100.0
KOG0283|consensus712 100.0
KOG0282|consensus503 100.0
KOG0292|consensus 1202 100.0
KOG0277|consensus311 100.0
KOG0640|consensus430 100.0
KOG0313|consensus423 100.0
KOG0288|consensus459 100.0
KOG1408|consensus 1080 100.0
KOG0772|consensus 641 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0265|consensus338 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0289|consensus506 100.0
KOG1539|consensus 910 100.0
KOG0293|consensus519 100.0
KOG0641|consensus350 100.0
KOG0973|consensus 942 100.0
KOG0305|consensus484 100.0
KOG0277|consensus311 100.0
KOG0300|consensus481 100.0
KOG0268|consensus433 100.0
KOG0647|consensus347 100.0
KOG1539|consensus 910 100.0
KOG1407|consensus313 100.0
KOG2096|consensus420 100.0
KOG0275|consensus508 100.0
PTZ00420 568 coronin; Provisional 100.0
KOG0274|consensus537 100.0
KOG0305|consensus484 100.0
KOG0310|consensus 487 100.0
KOG0283|consensus 712 100.0
PTZ00421 493 coronin; Provisional 100.0
KOG2106|consensus626 100.0
KOG1063|consensus 764 100.0
KOG0274|consensus537 100.0
KOG1408|consensus 1080 100.0
KOG0278|consensus334 100.0
KOG0299|consensus479 100.0
KOG0288|consensus459 100.0
KOG2048|consensus 691 100.0
PTZ00421493 coronin; Provisional 100.0
KOG1332|consensus299 100.0
KOG0294|consensus362 100.0
KOG1036|consensus323 100.0
KOG0973|consensus 942 100.0
KOG2106|consensus626 100.0
KOG0301|consensus 745 100.0
KOG0640|consensus430 99.98
KOG2055|consensus514 99.98
KOG1446|consensus311 99.98
KOG4283|consensus397 99.98
KOG0294|consensus362 99.98
KOG0289|consensus506 99.98
KOG0646|consensus 476 99.98
KOG0268|consensus433 99.98
KOG1036|consensus323 99.98
KOG0310|consensus487 99.98
KOG0308|consensus 735 99.97
KOG1273|consensus405 99.97
KOG0639|consensus705 99.97
KOG0643|consensus327 99.97
KOG0264|consensus422 99.97
KOG0772|consensus641 99.97
KOG0308|consensus 735 99.97
KOG2048|consensus 691 99.97
PTZ00420 568 coronin; Provisional 99.97
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.97
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.97
KOG0647|consensus347 99.97
KOG0299|consensus479 99.97
KOG1274|consensus 933 99.97
KOG2055|consensus514 99.97
KOG0646|consensus476 99.97
KOG1063|consensus764 99.97
KOG0264|consensus422 99.97
KOG0321|consensus 720 99.96
KOG0639|consensus705 99.96
KOG0641|consensus350 99.96
KOG1332|consensus299 99.96
KOG0300|consensus481 99.96
KOG2445|consensus361 99.96
KOG0650|consensus733 99.96
KOG4328|consensus498 99.96
KOG0301|consensus 745 99.96
KOG0321|consensus 720 99.95
KOG1445|consensus 1012 99.95
KOG0269|consensus 839 99.95
KOG0267|consensus 825 99.95
KOG4378|consensus 673 99.95
KOG4283|consensus397 99.94
KOG0269|consensus 839 99.94
KOG1274|consensus 933 99.94
KOG2919|consensus406 99.94
KOG2096|consensus420 99.94
KOG0267|consensus 825 99.93
KOG1538|consensus 1081 99.93
KOG1009|consensus434 99.93
KOG1034|consensus385 99.93
KOG1273|consensus405 99.93
KOG4328|consensus498 99.93
KOG4227|consensus 609 99.93
KOG0302|consensus440 99.93
KOG0307|consensus 1049 99.92
KOG0307|consensus 1049 99.92
KOG1188|consensus376 99.92
KOG1007|consensus370 99.92
KOG0270|consensus463 99.92
KOG1963|consensus 792 99.92
KOG1034|consensus385 99.92
KOG0302|consensus440 99.92
KOG1009|consensus434 99.92
KOG1445|consensus 1012 99.92
PRK11028330 6-phosphogluconolactonase; Provisional 99.92
KOG0650|consensus733 99.91
KOG0270|consensus463 99.91
PRK11028330 6-phosphogluconolactonase; Provisional 99.91
KOG1587|consensus555 99.91
KOG0642|consensus577 99.91
KOG1240|consensus1431 99.91
KOG4378|consensus 673 99.9
KOG0322|consensus323 99.9
COG2319466 FOG: WD40 repeat [General function prediction only 99.9
KOG2919|consensus406 99.9
KOG2445|consensus361 99.9
KOG1007|consensus370 99.9
KOG1963|consensus 792 99.9
KOG2110|consensus391 99.89
KOG0649|consensus325 99.89
KOG1517|consensus1387 99.89
KOG1538|consensus 1081 99.89
KOG0290|consensus364 99.89
COG2319466 FOG: WD40 repeat [General function prediction only 99.89
KOG1587|consensus555 99.89
KOG2394|consensus 636 99.88
KOG1334|consensus559 99.88
KOG1310|consensus 758 99.88
KOG1188|consensus376 99.88
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.88
KOG0303|consensus472 99.87
KOG1523|consensus361 99.87
KOG0642|consensus577 99.87
KOG2110|consensus391 99.86
KOG0322|consensus323 99.86
KOG0644|consensus 1113 99.86
KOG4497|consensus447 99.85
PRK01742429 tolB translocation protein TolB; Provisional 99.85
KOG4497|consensus447 99.85
KOG4227|consensus 609 99.84
PRK01742429 tolB translocation protein TolB; Provisional 99.84
KOG2111|consensus346 99.84
KOG1524|consensus 737 99.84
KOG1517|consensus1387 99.84
KOG0290|consensus364 99.84
KOG0771|consensus398 99.83
KOG0303|consensus472 99.82
KOG0649|consensus325 99.82
KOG0771|consensus398 99.82
KOG1524|consensus 737 99.81
KOG2139|consensus445 99.81
PRK03629429 tolB translocation protein TolB; Provisional 99.81
KOG2139|consensus445 99.79
KOG0644|consensus 1113 99.78
KOG1334|consensus559 99.78
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.78
KOG2111|consensus346 99.77
KOG1523|consensus361 99.77
KOG2321|consensus 703 99.77
KOG1240|consensus1431 99.76
PRK04922433 tolB translocation protein TolB; Provisional 99.76
KOG1272|consensus 545 99.76
PRK04922433 tolB translocation protein TolB; Provisional 99.75
KOG1310|consensus 758 99.75
PRK02889427 tolB translocation protein TolB; Provisional 99.74
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.74
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.74
PRK05137435 tolB translocation protein TolB; Provisional 99.74
PRK02889427 tolB translocation protein TolB; Provisional 99.73
KOG3881|consensus412 99.72
KOG3881|consensus412 99.72
PRK05137435 tolB translocation protein TolB; Provisional 99.72
KOG1272|consensus 545 99.71
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.71
KOG2394|consensus636 99.71
KOG2315|consensus 566 99.7
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.69
KOG1354|consensus433 99.69
KOG0974|consensus 967 99.69
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.68
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.67
KOG2315|consensus566 99.67
PRK03629429 tolB translocation protein TolB; Provisional 99.66
PRK00178430 tolB translocation protein TolB; Provisional 99.66
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.66
KOG1409|consensus404 99.65
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.65
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.64
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.64
KOG2314|consensus 698 99.64
PRK04792448 tolB translocation protein TolB; Provisional 99.63
KOG1354|consensus433 99.63
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.63
KOG0974|consensus 967 99.63
KOG2041|consensus 1189 99.62
PRK04792448 tolB translocation protein TolB; Provisional 99.61
PRK00178430 tolB translocation protein TolB; Provisional 99.61
KOG2321|consensus 703 99.61
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.6
PRK01029428 tolB translocation protein TolB; Provisional 99.58
PRK01029428 tolB translocation protein TolB; Provisional 99.57
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.55
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.55
KOG0280|consensus339 99.55
KOG2314|consensus698 99.53
COG4946668 Uncharacterized protein related to the periplasmic 99.52
COG4946668 Uncharacterized protein related to the periplasmic 99.52
KOG1409|consensus 404 99.5
KOG4547|consensus 541 99.48
KOG1912|consensus 1062 99.47
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.45
KOG1912|consensus 1062 99.44
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.42
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.42
KOG4547|consensus 541 99.41
KOG0309|consensus 1081 99.4
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 99.4
PLN029191057 haloacid dehalogenase-like hydrolase family protei 99.39
KOG4532|consensus344 99.38
KOG1064|consensus2439 99.37
KOG4190|consensus1034 99.37
KOG1064|consensus2439 99.36
KOG0280|consensus339 99.3
KOG3914|consensus 390 99.29
KOG2041|consensus 1189 99.29
PRK04043419 tolB translocation protein TolB; Provisional 99.28
KOG4190|consensus1034 99.27
KOG0882|consensus 558 99.27
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.26
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.25
PRK04043419 tolB translocation protein TolB; Provisional 99.25
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.23
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.19
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 99.18
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.17
KOG3914|consensus390 99.15
KOG4714|consensus319 99.15
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.15
KOG4532|consensus344 99.14
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 99.11
KOG2695|consensus425 99.09
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 99.09
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 99.04
KOG2695|consensus425 99.03
KOG4649|consensus354 99.02
KOG1832|consensus 1516 99.02
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 99.0
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 99.0
KOG1645|consensus463 99.0
KOG4714|consensus319 98.98
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.98
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.98
KOG2066|consensus 846 98.97
KOG3617|consensus 1416 98.95
KOG0309|consensus 1081 98.95
KOG1920|consensus 1265 98.93
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.92
KOG0882|consensus 558 98.9
KOG2114|consensus 933 98.87
PRK02888 635 nitrous-oxide reductase; Validated 98.81
KOG1920|consensus 1265 98.79
KOG1645|consensus463 98.74
KOG1275|consensus 1118 98.74
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.72
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.72
KOG1832|consensus 1516 98.72
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.69
KOG2066|consensus 846 98.68
KOG3617|consensus 1416 98.67
KOG3621|consensus 726 98.64
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.63
KOG1275|consensus 1118 98.62
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.62
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.61
COG3490366 Uncharacterized protein conserved in bacteria [Fun 98.55
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.53
KOG2114|consensus 933 98.52
KOG4649|consensus354 98.51
PRK02888635 nitrous-oxide reductase; Validated 98.49
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.49
KOG1008|consensus 783 98.49
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.43
KOG1897|consensus 1096 98.37
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 98.34
COG3391381 Uncharacterized conserved protein [Function unknow 98.31
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.29
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 98.26
KOG1008|consensus 783 98.26
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 98.23
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 98.23
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.22
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.21
KOG3621|consensus 726 98.2
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.16
KOG1897|consensus 1096 98.16
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.15
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 98.13
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.1
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.09
COG3391381 Uncharacterized conserved protein [Function unknow 98.06
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 98.05
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.03
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.96
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.95
KOG2444|consensus238 97.95
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 97.94
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.94
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.94
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.92
KOG4640|consensus 665 97.92
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.91
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.9
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.9
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.88
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.87
KOG4640|consensus 665 97.86
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.84
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.84
PF14727418 PHTB1_N: PTHB1 N-terminus 97.73
PRK13616591 lipoprotein LpqB; Provisional 97.64
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 97.63
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.61
PRK13616591 lipoprotein LpqB; Provisional 97.56
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 97.54
PHA02713557 hypothetical protein; Provisional 97.53
KOG4441|consensus571 97.5
PHA02713557 hypothetical protein; Provisional 97.49
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.35
KOG4441|consensus571 97.34
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 97.3
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.29
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.28
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.27
KOG2395|consensus644 97.27
KOG2079|consensus 1206 97.26
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.24
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.23
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.2
KOG2079|consensus 1206 97.17
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 97.11
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 97.03
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.94
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.93
KOG2395|consensus644 96.89
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.86
KOG4499|consensus310 96.79
KOG4499|consensus310 96.72
PHA03098534 kelch-like protein; Provisional 96.66
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.65
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 96.63
KOG2444|consensus238 96.56
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.55
PHA03098534 kelch-like protein; Provisional 96.35
KOG3630|consensus 1405 96.2
COG5167776 VID27 Protein involved in vacuole import and degra 96.12
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 96.12
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 96.03
PHA02790480 Kelch-like protein; Provisional 96.03
PF13449326 Phytase-like: Esterase-like activity of phytase 95.95
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 95.89
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 95.89
KOG3630|consensus 1405 95.85
KOG2280|consensus 829 95.8
PRK13684334 Ycf48-like protein; Provisional 95.76
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 95.72
PF14727418 PHTB1_N: PTHB1 N-terminus 95.7
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 95.69
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 95.62
PHA02790480 Kelch-like protein; Provisional 95.54
PRK10115 686 protease 2; Provisional 95.51
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 95.51
COG3823262 Glutamine cyclotransferase [Posttranslational modi 95.51
KOG1916|consensus 1283 95.46
COG5167776 VID27 Protein involved in vacuole import and degra 95.45
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 95.37
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.27
COG5276370 Uncharacterized conserved protein [Function unknow 95.26
KOG2377|consensus 657 95.14
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 95.11
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 95.04
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 94.95
COG3823262 Glutamine cyclotransferase [Posttranslational modi 94.92
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 94.91
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 94.83
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 94.82
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.82
KOG1983|consensus 993 94.74
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 94.69
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 94.33
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 94.22
KOG2280|consensus 829 94.14
KOG1898|consensus1205 94.08
PF07569 219 Hira: TUP1-like enhancer of split; InterPro: IPR01 93.81
COG4590 733 ABC-type uncharacterized transport system, permeas 93.71
PF08801422 Nucleoporin_N: Nup133 N terminal like; InterPro: I 93.51
PLN00033398 photosystem II stability/assembly factor; Provisio 93.49
KOG4460|consensus 741 93.25
KOG1916|consensus 1283 93.25
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 93.12
PF13449326 Phytase-like: Esterase-like activity of phytase 93.09
KOG4460|consensus 741 92.98
KOG1900|consensus 1311 92.85
KOG2247|consensus 615 92.81
PRK10115 686 protease 2; Provisional 92.56
KOG2377|consensus 657 92.56
COG3292 671 Predicted periplasmic ligand-binding sensor domain 92.4
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 92.3
COG4590 733 ABC-type uncharacterized transport system, permeas 91.61
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 91.49
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 91.38
PLN00033398 photosystem II stability/assembly factor; Provisio 91.3
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 91.24
PRK13684334 Ycf48-like protein; Provisional 91.13
KOG2247|consensus 615 91.08
PLN02193470 nitrile-specifier protein 90.98
KOG1900|consensus 1311 90.97
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 90.47
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 89.99
PF11635 753 Med16: Mediator complex subunit 16; InterPro: IPR0 89.89
COG5276370 Uncharacterized conserved protein [Function unknow 89.49
KOG1983|consensus 993 89.24
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 88.86
PF12768281 Rax2: Cortical protein marker for cell polarity 88.85
PLN02153341 epithiospecifier protein 88.63
PF11725 1774 AvrE: Pathogenicity factor; InterPro: IPR021085 Th 88.45
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 88.41
PF08801422 Nucleoporin_N: Nup133 N terminal like; InterPro: I 88.1
PF12768281 Rax2: Cortical protein marker for cell polarity 87.96
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 87.86
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 87.66
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 87.37
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 87.34
KOG4659|consensus 1899 87.02
KOG1898|consensus 1205 86.65
KOG3616|consensus 1636 86.45
COG1520370 FOG: WD40-like repeat [Function unknown] 85.92
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 85.44
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 85.42
KOG1896|consensus1366 85.2
PLN02153341 epithiospecifier protein 84.51
>KOG0271|consensus Back     alignment and domain information
Probab=100.00  E-value=8.1e-58  Score=353.28  Aligned_cols=318  Identities=19%  Similarity=0.330  Sum_probs=280.5

Q ss_pred             EeCCceEEEEEcCCCCCEEEEEeCCCcEEEEecCCCCceeeeeecCCceeeEEEEEecCCCEEEEEecCCEEEEEeccCC
Q psy988           20 QHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVWNEVEGQTKLITAANFCENGKFAVVGSYDGRCIFYTTDQL   99 (408)
Q Consensus        20 ~h~~~v~~~~~sp~~~~~l~t~~~dg~i~iw~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~dg~i~iw~~~~~   99 (408)
                      +|.++|.|+.|+| ++..||+|+.|.++++||+.+....  .+.++|...|.|++|+|||+.||+|+.||+|++||..++
T Consensus       113 GH~e~Vl~~~fsp-~g~~l~tGsGD~TvR~WD~~TeTp~--~t~KgH~~WVlcvawsPDgk~iASG~~dg~I~lwdpktg  189 (480)
T KOG0271|consen  113 GHGEAVLSVQFSP-TGSRLVTGSGDTTVRLWDLDTETPL--FTCKGHKNWVLCVAWSPDGKKIASGSKDGSIRLWDPKTG  189 (480)
T ss_pred             CCCCcEEEEEecC-CCceEEecCCCceEEeeccCCCCcc--eeecCCccEEEEEEECCCcchhhccccCCeEEEecCCCC
Confidence            3999999999999 9999999999999999999998776  799999999999999999999999999999999999988


Q ss_pred             eeeEEEEEeeccccccCCCCeEEEeeCC-----CCCeEEEeeCCCeEEEEEccCcccceeecCccccccceEEEEecCCC
Q psy988          100 KYHTQIHVRSTRGKNATGRKISGIEPMP-----GEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGK  174 (408)
Q Consensus       100 ~~~~~~~~~~~~~~~~~~~~v~~~~~~~-----~~~~l~~~~~dg~i~i~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  174 (408)
                      ++...       ...+|...|++++|.|     ..++|++++.||.++|||+..+.++..+.+|...  ++|+.|--+| 
T Consensus       190 ~~~g~-------~l~gH~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~~~~~~lsgHT~~--VTCvrwGG~g-  259 (480)
T KOG0271|consen  190 QQIGR-------ALRGHKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGTCVRTLSGHTAS--VTCVRWGGEG-  259 (480)
T ss_pred             Ccccc-------cccCcccceeEEeecccccCCCccceecccCCCCEEEEEccCceEEEEeccCccc--eEEEEEcCCc-
Confidence            65432       2356778999999976     5678999999999999999999999999998876  8899997665 


Q ss_pred             EEEEeecCceEEEeeeccceeeeeecccCCCccccccccccceEEEEEEeCC-----------cc---------------
Q psy988          175 YIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPC-----------PE---------------  228 (408)
Q Consensus       175 ~l~~~~~dg~i~i~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~-----------~~---------------  228 (408)
                      +|++|+.|++|++|+...            +.+.+.+++|...|+.++++.+           ++               
T Consensus       260 liySgS~DrtIkvw~a~d------------G~~~r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~r  327 (480)
T KOG0271|consen  260 LIYSGSQDRTIKVWRALD------------GKLCRELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALER  327 (480)
T ss_pred             eEEecCCCceEEEEEccc------------hhHHHhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHH
Confidence            899999999999999854            4567888999999998887732           22               


Q ss_pred             ----------eeeee--------cCCCCCCCceeeecCCCceeeeeccCCCCCeEEEecCCCeEEEEEcCCCeeeeEEee
Q psy988          229 ----------LIIAQ--------MEPDKSESTGYVLNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKG  290 (408)
Q Consensus       229 ----------~~~~~--------~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~~~~  290 (408)
                                .++.+        +.+...........+|..-|..+.||||++++++++.|..|++||.++|+.+.+|.+
T Consensus       328 Y~~~~~~~~erlVSgsDd~tlflW~p~~~kkpi~rmtgHq~lVn~V~fSPd~r~IASaSFDkSVkLW~g~tGk~lasfRG  407 (480)
T KOG0271|consen  328 YEAVLKDSGERLVSGSDDFTLFLWNPFKSKKPITRMTGHQALVNHVSFSPDGRYIASASFDKSVKLWDGRTGKFLASFRG  407 (480)
T ss_pred             HHHhhccCcceeEEecCCceEEEecccccccchhhhhchhhheeeEEECCCccEEEEeecccceeeeeCCCcchhhhhhh
Confidence                      23333        222334455566778889999999999999999999999999999999999999999


Q ss_pred             ccceeceeEEEEcCCCCEEEEecCCceEEEeeccccCccccccccCccccceeeeeeccceEEEEecCCchhhhhccCCC
Q psy988          291 YVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPD  370 (408)
Q Consensus       291 ~~~~~~v~~~~~s~~~~~l~~~~~dg~i~iw~~~~~~~~~~~~~~~~~~~~~~~~~h~~~v~~~~~~~~~~~~~~~~~~~  370 (408)
                      |..  .|..++|+.|.++|++|+.|.++++|++++.            ++...+.+|.+.|.++.|+|            
T Consensus       408 Hv~--~VYqvawsaDsRLlVS~SkDsTLKvw~V~tk------------Kl~~DLpGh~DEVf~vDwsp------------  461 (480)
T KOG0271|consen  408 HVA--AVYQVAWSADSRLLVSGSKDSTLKVWDVRTK------------KLKQDLPGHADEVFAVDWSP------------  461 (480)
T ss_pred             ccc--eeEEEEeccCccEEEEcCCCceEEEEEeeee------------eecccCCCCCceEEEEEecC------------
Confidence            877  8899999999999999999999999999987            67788999999999999999            


Q ss_pred             CCCCcccEEEEEecCCeEEEEe
Q psy988          371 KSESTGYVLVSADFNGVIRVFL  392 (408)
Q Consensus       371 ~~s~~~~~l~s~~~dg~v~iw~  392 (408)
                          ||..+++|+.|..+++|.
T Consensus       462 ----DG~rV~sggkdkv~~lw~  479 (480)
T KOG0271|consen  462 ----DGQRVASGGKDKVLRLWR  479 (480)
T ss_pred             ----CCceeecCCCceEEEeec
Confidence                999999999999999995



>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG3630|consensus Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PF08801 Nucleoporin_N: Nup133 N terminal like; InterPro: IPR014908 Nucleoporins are the main components of the nuclear pore complex (NPC) in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2377|consensus Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>KOG1900|consensus Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1983|consensus Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PF11725 AvrE: Pathogenicity factor; InterPro: IPR021085 This family is secreted by Gram-negative Gammaproteobacteria such as Pseudomonas syringae of tomato and Erwinia amylovora (Fire blight bacteria), amongst others Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PF08801 Nucleoporin_N: Nup133 N terminal like; InterPro: IPR014908 Nucleoporins are the main components of the nuclear pore complex (NPC) in eukaryotic cells, and mediate bidirectional nucleocytoplasmic transport, especially of mRNA and proteins Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>KOG4659|consensus Back     alignment and domain information
>KOG1898|consensus Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG1896|consensus Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query408
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 3e-14
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 5e-07
2h9l_A329 Wdr5delta23 Length = 329 3e-14
2h9l_A329 Wdr5delta23 Length = 329 5e-07
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 3e-14
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 6e-07
2gnq_A336 Structure Of Wdr5 Length = 336 3e-14
2gnq_A336 Structure Of Wdr5 Length = 336 9e-07
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 3e-14
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 5e-07
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 3e-14
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 9e-07
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 3e-14
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 6e-07
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 3e-14
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 5e-07
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 3e-14
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 5e-07
2g99_A308 Structural Basis For The Specific Recognition Of Me 3e-14
2g99_A308 Structural Basis For The Specific Recognition Of Me 5e-07
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 3e-14
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 6e-07
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 3e-14
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 5e-07
2g9a_A311 Structural Basis For The Specific Recognition Of Me 3e-14
2g9a_A311 Structural Basis For The Specific Recognition Of Me 5e-07
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 3e-14
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 6e-07
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 3e-14
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 3e-07
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 5e-14
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 5e-07
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 6e-14
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 6e-07
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 3e-13
2ymu_A 577 Structure Of A Highly Repetitive Propeller Structur 4e-05
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 6e-07
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 6e-07
2ynp_A 604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 2e-06
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 2e-06
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 3e-06
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 2e-05
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 2e-04
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 3e-05
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 4e-05
3zey_7318 High-resolution Cryo-electron Microscopy Structure 1e-04
3zey_7318 High-resolution Cryo-electron Microscopy Structure 2e-04
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 1e-04
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 1e-04
3jpx_A402 Eed: A Novel Histone Trimethyllysine Binder Within 2e-04
3iiy_A365 Crystal Structure Of Eed In Complex With A Trimethy 3e-04
3iiw_A365 Crystal Structure Of Eed In Complex With A Trimethy 3e-04
3jzn_A366 Structure Of Eed In Apo Form Length = 366 3e-04
2qxv_A361 Structural Basis Of Ezh2 Recognition By Eed Length 3e-04
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 3e-04
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 7e-04
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure

Iteration: 1

Score = 76.3 bits (186), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 65/242 (26%), Positives = 109/242 (45%), Gaps = 27/242 (11%) Query: 2 DKTVRLWHISRKECLCCFQ-HIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVW 60 DKT+++W +S +CL + H ++V F+P+ + +SGS D +R+W++ K Sbjct: 91 DKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSN-LIVSGSFDESVRIWDVKTGKCL-- 147 Query: 61 NEVEGQTKLITAANFCENGKFAVVGSYDGRC-IFYTTDQLKYHTQIHVRSTRGKNATGRK 119 + + ++A +F +G V SYDG C I+ T T I + Sbjct: 148 KTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI--------DDDNPP 199 Query: 120 ISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFS-HDGKYIVS 178 +S ++ P IL + D+ ++L+D Y G+ N I A+FS GK+IVS Sbjct: 200 VSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVS 259 Query: 179 GSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELII-AQMEPD 237 GSE+ +YIW + + ++ H VV P +I A +E D Sbjct: 260 GSEDNLVYIWNLQ------------TKEIVQKLQGHTDVVISTACHPTENIIASAALEND 307 Query: 238 KS 239 K+ Sbjct: 308 KT 309
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3JPX|A Chain A, Eed: A Novel Histone Trimethyllysine Binder Within The Eed-Ezh2 Polycomb Complex Length = 402 Back     alignment and structure
>pdb|3IIY|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H1k26 Peptide Length = 365 Back     alignment and structure
>pdb|3IIW|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H3k27 Peptide Length = 365 Back     alignment and structure
>pdb|3JZN|A Chain A, Structure Of Eed In Apo Form Length = 366 Back     alignment and structure
>pdb|2QXV|A Chain A, Structural Basis Of Ezh2 Recognition By Eed Length = 361 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 100.0
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 100.0
1k32_A 1045 Tricorn protease; protein degradation, substrate g 100.0
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 100.0
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.97
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.97
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.97
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.97
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.97
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.97
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.97
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.97
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.96
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.96
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.96
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.96
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.96
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.96
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.96
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.96
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.95
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.95
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.95
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.95
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.94
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.94
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.94
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.94
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.94
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.93
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.93
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.93
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.92
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.92
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.92
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.91
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.91
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.9
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.89
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.89
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.89
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.89
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.88
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.88
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.86
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.86
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.86
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.85
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.85
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.85
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.85
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.84
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.84
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.83
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.82
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.82
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.82
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.81
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.81
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.81
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.8
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.79
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.79
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.79
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.79
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.78
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.78
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.77
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.76
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.76
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.75
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.75
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.74
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.74
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.73
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.73
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.73
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.72
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.72
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.71
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.67
2qe8_A343 Uncharacterized protein; structural genomics, join 99.67
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.66
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.66
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.65
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.63
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.62
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.61
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.61
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.6
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.59
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.58
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.55
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.54
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.54
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.53
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.53
2ece_A462 462AA long hypothetical selenium-binding protein; 99.52
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.51
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.51
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.51
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.5
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 99.46
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.44
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.43
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.43
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.39
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 99.38
2qe8_A343 Uncharacterized protein; structural genomics, join 99.31
2ece_A462 462AA long hypothetical selenium-binding protein; 99.31
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.29
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 99.26
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 99.24
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 99.24
4a2l_A 795 BT_4663, two-component system sensor histidine kin 99.23
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 99.22
4a2l_A 795 BT_4663, two-component system sensor histidine kin 99.21
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.21
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.2
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.19
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.18
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.17
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 99.15
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.13
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.09
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 99.09
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.09
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.09
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 99.08
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 99.07
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.07
3v9f_A 781 Two-component system sensor histidine kinase/RESP 99.07
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 99.06
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 99.05
3v9f_A 781 Two-component system sensor histidine kinase/RESP 99.04
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 99.01
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.99
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.95
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.95
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.94
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.9
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.89
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.86
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 98.83
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.83
3v65_B386 Low-density lipoprotein receptor-related protein; 98.82
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.81
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.78
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.77
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.71
3kya_A496 Putative phosphatase; structural genomics, joint c 98.68
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.67
3v65_B386 Low-density lipoprotein receptor-related protein; 98.67
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.64
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.62
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.6
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.59
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.56
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.54
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.52
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.52
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.45
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.42
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.41
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.37
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.34
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.32
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 98.28
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.26
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.25
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.24
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 98.24
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 98.17
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.16
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.16
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.15
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.1
3kya_A496 Putative phosphatase; structural genomics, joint c 98.07
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 98.03
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.02
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 98.0
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 98.0
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.96
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.96
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.92
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 97.89
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.85
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 97.85
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.8
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.74
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 97.73
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.69
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.66
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.65
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.63
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.6
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.55
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 97.46
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.43
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.32
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 97.3
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.29
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.24
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 97.22
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 97.16
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.12
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.1
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 96.96
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 96.93
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.89
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 96.87
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.86
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 96.67
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 96.65
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 96.57
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.54
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.42
3ott_A 758 Two-component system sensor histidine kinase; beta 96.16
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 96.12
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 96.03
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 95.33
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 95.32
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 95.21
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 94.91
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 94.14
3ott_A 758 Two-component system sensor histidine kinase; beta 94.03
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 93.68
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 93.54
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 92.02
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 91.41
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 90.15
1zi0_A307 DNA gyrase subunit A; beta pinwheel, topoisomerase 89.87
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 84.66
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 83.73
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 83.66
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, be 82.57
3l6v_A370 GYRA, DNA gyrase subunit A; gyrase A C-terminal do 82.46
3kci_A389 Probable E3 ubiquitin-protein ligase HERC2; WD40, 80.39
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
Probab=100.00  E-value=7.2e-53  Score=384.67  Aligned_cols=357  Identities=16%  Similarity=0.234  Sum_probs=273.4

Q ss_pred             CceEEEEeccCCeeEeEEE-eCCceEEEEEcCCCCCEEEEEeCCCcEEEEecCCCCceeeee------------------
Q psy988            2 DKTVRLWHISRKECLCCFQ-HIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVWNE------------------   62 (408)
Q Consensus         2 Dg~i~vwd~~~~~~~~~~~-h~~~v~~~~~sp~~~~~l~t~~~dg~i~iw~~~~~~~~~~~~------------------   62 (408)
                      +++|+|||+.+++....+. |.+.|++++|+| ++++||+|+.||+|+|||+.+++......                  
T Consensus        38 ~~~v~l~~~~~~~~~~~~~~h~~~v~~~~~sp-dg~~lasg~~d~~v~lWd~~~~~~~~~~~~~~~~~~v~~v~fs~dg~  116 (611)
T 1nr0_A           38 GTSVYTVPVGSLTDTEIYTEHSHQTTVAKTSP-SGYYCASGDVHGNVRIWDTTQTTHILKTTIPVFSGPVKDISWDSESK  116 (611)
T ss_dssp             TTEEEEEETTCSSCCEEECCCSSCEEEEEECT-TSSEEEEEETTSEEEEEESSSTTCCEEEEEECSSSCEEEEEECTTSC
T ss_pred             CCEEEEecCCCcccCeEecCCCCceEEEEECC-CCcEEEEEeCCCCEEEeECCCCcceeeEeecccCCceEEEEECCCCC
Confidence            4689999999888888886 999999999999 99999999999999999986543222122                  


Q ss_pred             --------------------------ecCCceeeEEEEEecCCC-EEEEEecCCEEEEEeccCCeeeEEEEEeecccccc
Q psy988           63 --------------------------VEGQTKLITAANFCENGK-FAVVGSYDGRCIFYTTDQLKYHTQIHVRSTRGKNA  115 (408)
Q Consensus        63 --------------------------~~~~~~~v~~~~~~~~~~-~l~~~~~dg~i~iw~~~~~~~~~~~~~~~~~~~~~  115 (408)
                                                +.+|...|.+++|+|++. .|++++.|++|++||..+.+....        ..+
T Consensus       117 ~l~~~~~~~~~~~~v~~wd~~~~~~~l~gh~~~v~~v~f~p~~~~~l~s~s~D~~v~lwd~~~~~~~~~--------l~~  188 (611)
T 1nr0_A          117 RIAAVGEGRERFGHVFLFDTGTSNGNLTGQARAMNSVDFKPSRPFRIISGSDDNTVAIFEGPPFKFKST--------FGE  188 (611)
T ss_dssp             EEEEEECCSSCSEEEEETTTCCBCBCCCCCSSCEEEEEECSSSSCEEEEEETTSCEEEEETTTBEEEEE--------ECC
T ss_pred             EEEEEECCCCceeEEEEeeCCCCcceecCCCCCceEEEECCCCCeEEEEEeCCCeEEEEECCCCeEeee--------ecc
Confidence                                      345566666777777665 477888888888888776543322        235


Q ss_pred             CCCCeEEEeeCCCCCeEEEeeCCCeEEEEEccCcccceeec-------CccccccceEEEEecCCCEEEEeecCceEEEe
Q psy988          116 TGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYK-------GYVNVSSQIKASFSHDGKYIVSGSENQCIYIW  188 (408)
Q Consensus       116 ~~~~v~~~~~~~~~~~l~~~~~dg~i~i~d~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~l~~~~~dg~i~i~  188 (408)
                      |...|.+++|+|++++|++++.|+.|++||+.+++....+.       +|.  ..+.+++|+|++++|++++.|++|++|
T Consensus       189 H~~~V~~v~fspdg~~las~s~D~~i~lwd~~~g~~~~~~~~~~~~~~~h~--~~V~~v~~spdg~~l~s~s~D~~v~lW  266 (611)
T 1nr0_A          189 HTKFVHSVRYNPDGSLFASTGGDGTIVLYNGVDGTKTGVFEDDSLKNVAHS--GSVFGLTWSPDGTKIASASADKTIKIW  266 (611)
T ss_dssp             CSSCEEEEEECTTSSEEEEEETTSCEEEEETTTCCEEEECBCTTSSSCSSS--SCEEEEEECTTSSEEEEEETTSEEEEE
T ss_pred             ccCceEEEEECCCCCEEEEEECCCcEEEEECCCCcEeeeeccccccccccC--CCEEEEEECCCCCEEEEEeCCCeEEEE
Confidence            67899999999999999999999999999999988777663       343  458899999999999999999999999


Q ss_pred             eeccceeeeeeccc-------------------------------CCCccccccccccceEEEEEEeCCcceeeeecCCC
Q psy988          189 KTHHDYAKFSSVRR-------------------------------DRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPD  237 (408)
Q Consensus       189 d~~~~~~~~~~~~~-------------------------------~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~  237 (408)
                      |++++.........                               ........+.+|...|.+++|+|+++++++...+.
T Consensus       267 d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~s~s~d~~i~~~~~~~~~~~~~~~gh~~~v~~l~~spdg~~l~s~s~D~  346 (611)
T 1nr0_A          267 NVATLKVEKTIPVGTRIEDQQLGIIWTKQALVSISANGFINFVNPELGSIDQVRYGHNKAITALSSSADGKTLFSADAEG  346 (611)
T ss_dssp             ETTTTEEEEEEECCSSGGGCEEEEEECSSCEEEEETTCCEEEEETTTTEEEEEECCCSSCEEEEEECTTSSEEEEEETTS
T ss_pred             eCCCCceeeeecCCCCccceeEEEEEcCCEEEEEeCCCcEEEEeCCCCCcceEEcCCCCCEEEEEEeCCCCEEEEEeCCC
Confidence            99876543221100                               01123345568999999999999999988754322


Q ss_pred             C-------CCCc-------------------------------eeeec--------------------------------
Q psy988          238 K-------SEST-------------------------------GYVLN--------------------------------  247 (408)
Q Consensus       238 ~-------~~~~-------------------------------~~~~~--------------------------------  247 (408)
                      .       ....                               ..++.                                
T Consensus       347 ~v~~Wd~~~~~~~~~~~~~h~~~v~~~~~s~~~~l~s~s~d~~v~~w~~~~~~~~~~~~~~~~~~~~~~~~~~s~dg~~~  426 (611)
T 1nr0_A          347 HINSWDISTGISNRVFPDVHATMITGIKTTSKGDLFTVSWDDHLKVVPAGGSGVDSSKAVANKLSSQPLGLAVSADGDIA  426 (611)
T ss_dssp             CEEEEETTTCCEEECSSCSCSSCEEEEEECTTSCEEEEETTTEEEEECSSSSSSCTTSCCEEECSSCEEEEEECTTSSCE
T ss_pred             cEEEEECCCCceeeecccCCcceEEEEEECCCCcEEEEEcCCceEEeecCCccccccceeeeecCCCCcEEEEeCCCcEE
Confidence            1       0000                               00000                                


Q ss_pred             -------------------CCCceeeeeccCCCCCeEEEecCCCeEEEEEcCCCeeeeE-EeeccceeceeEEEEcCCCC
Q psy988          248 -------------------ATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCK-YKGYVNVSSQIKASFSHDGK  307 (408)
Q Consensus       248 -------------------~~~~~i~~~~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~-~~~~~~~~~v~~~~~s~~~~  307 (408)
                                         .+...+.+++|+|++++|++|+.|++|++||+.+++.... ..+|  ...|.+++|+|||+
T Consensus       427 ~~~~~~~v~~~~~~~~~~~~~~~~v~~va~spdg~~lasgs~D~~v~lwd~~~~~~~~~~~~~h--~~~v~~v~fspdg~  504 (611)
T 1nr0_A          427 VAACYKHIAIYSHGKLTEVPISYNSSCVALSNDKQFVAVGGQDSKVHVYKLSGASVSEVKTIVH--PAEITSVAFSNNGA  504 (611)
T ss_dssp             EEEESSEEEEEETTEEEEEECSSCEEEEEECTTSCEEEEEETTSEEEEEEEETTEEEEEEEEEC--SSCEEEEEECTTSS
T ss_pred             EEEeCceEEEEeCCceeeeecCCCceEEEEeCCCCEEEEeCCCCeEEEEEccCCceeeeeccCC--CCceEEEEECCCCC
Confidence                               0224467899999999999999999999999987654321 1344  44899999999999


Q ss_pred             EEEEecCCceEEEeeccccCccccccccCccccce--eeeeeccceEEEEecCCchhhhhccCCCCCCCcccEEEEEecC
Q psy988          308 YIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWE--GIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLVSADFN  385 (408)
Q Consensus       308 ~l~~~~~dg~i~iw~~~~~~~~~~~~~~~~~~~~~--~~~~h~~~v~~~~~~~~~~~~~~~~~~~~~s~~~~~l~s~~~d  385 (408)
                      +|++++.|+.|++|++.+..           +++.  .+.+|...|.+++|+|                ||++||+|+.|
T Consensus       505 ~las~s~d~~v~~w~~~~~~-----------~~~~~~~~~~H~~~V~~v~fsp----------------dg~~lasgs~D  557 (611)
T 1nr0_A          505 FLVATDQSRKVIPYSVANNF-----------ELAHTNSWTFHTAKVACVSWSP----------------DNVRLATGSLD  557 (611)
T ss_dssp             EEEEEETTSCEEEEEGGGTT-----------EESCCCCCCCCSSCEEEEEECT----------------TSSEEEEEETT
T ss_pred             EEEEEcCCCCEEEEEcCCCC-----------ceeeeeeeeecccceeEEEECC----------------CCCEEEEEECC
Confidence            99999999999999998621           2222  2345999999999999                99999999999


Q ss_pred             CeEEEEeCCCCCC
Q psy988          386 GVIRVFLNKTKPK  398 (408)
Q Consensus       386 g~v~iw~~~~~~~  398 (408)
                      ++|++|++.++..
T Consensus       558 ~~v~lW~~~~~~~  570 (611)
T 1nr0_A          558 NSVIVWNMNKPSD  570 (611)
T ss_dssp             SCEEEEETTCTTS
T ss_pred             CcEEEEECCCccc
Confidence            9999999987653



>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1zi0_A DNA gyrase subunit A; beta pinwheel, topoisomerase, spiralling beta pinwheel, DNA wrapping, isomerase, DNA bindng protein; HET: DNA; 2.60A {Escherichia coli} Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>3l6v_A GYRA, DNA gyrase subunit A; gyrase A C-terminal domain, GYRA C-terminal domain, DNA wrapping, beta-strand-bearing proline, ATP-binding; HET: DNA; 2.19A {Xanthomonas campestris PV} Back     alignment and structure
>3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 408
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-22
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-14
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-17
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 8e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-15
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.001
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.002
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-15
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 8e-15
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-14
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 6e-06
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.004
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-14
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 4e-07
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-05
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-13
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 6e-04
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-11
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 7e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-11
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 6e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-04
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.004
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-11
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-06
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-10
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-10
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-04
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.002
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-09
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-09
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 1e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-09
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 3e-07
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-09
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.003
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-09
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 9e-06
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.001
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-06
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-05
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 1e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 6e-06
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 2e-05
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 5e-04
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 94.4 bits (233), Expect = 2e-22
 Identities = 57/332 (17%), Positives = 111/332 (33%), Gaps = 30/332 (9%)

Query: 6   RLWHISRKECLCCFQHIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVWNEVEG 65
           + W     E      H   VT + FHP      +S S D  +++W+           ++G
Sbjct: 1   KEWIPRPPEKYALSGHRSPVTRVIFHP-VFSVMVSASEDATIKVWDYETGDFE--RTLKG 57

Query: 66  QTKLITAANFCENGKFAVVGSYDGRCIFYTTDQLKYHTQIHVRSTRGKNATGRKISGIEP 125
            T  +   +F  +GK     S D     +     +    +H       +        +  
Sbjct: 58  HTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSS--------VSI 109

Query: 126 MPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCI 185
           MP  D I+  S D  I++++++       + G  +         + DG  I S S +Q +
Sbjct: 110 MPNGDHIVSASRDKTIKMWEVQTGYCVKTFTG--HREWVRMVRPNQDGTLIASCSNDQTV 167

Query: 186 YIWKTHHDYAK---------FSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIA---- 232
            +W       K            +       +  I       T     P P L+      
Sbjct: 168 RVWVVATKECKAELREHRHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDK 227

Query: 233 --QMEPDKSESTGYVLNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKG 290
             +M    +      L      + G+    G   IL  ++D  +R++D ++         
Sbjct: 228 TIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNA 287

Query: 291 YVNVSSQIKASFSHDGKYIVSGSENQCIYIWK 322
           + +  + +   F     Y+V+GS +Q + +W+
Sbjct: 288 HEHFVTSL--DFHKTAPYVVTGSVDQTVKVWE 317


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query408
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 100.0
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.98
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.96
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.96
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.96
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.96
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.96
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.95
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.93
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.92
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.92
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.92
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.9
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.9
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.89
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.81
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.81
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.77
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.74
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.65
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.6
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.55
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.49
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.48
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.45
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.42
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.41
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.4
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.36
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.33
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.33
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.33
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.31
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.31
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.25
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.22
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.19
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.04
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.93
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.77
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.74
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 98.54
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.4
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 98.34
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 98.28
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 98.11
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 98.08
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 98.08
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 98.01
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 98.0
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 98.0
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.81
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.73
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.72
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.61
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.45
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.43
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.39
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 97.39
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 97.36
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 97.32
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 97.21
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 97.15
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.81
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.7
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.41
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 96.16
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.67
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 95.15
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 94.22
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 92.8
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 91.67
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 89.23
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 88.5
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 86.28
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=3.4e-48  Score=324.18  Aligned_cols=315  Identities=20%  Similarity=0.306  Sum_probs=266.1

Q ss_pred             EEeccCCeeEeEEE-eCCceEEEEEcCCCCCEEEEEeCCCcEEEEecCCCCceeeeeecCCceeeEEEEEecCCCEEEEE
Q psy988            7 LWHISRKECLCCFQ-HIDFVTAICFHPRDDRYFLSGSLDGKLRLWNIPDKKVAVWNEVEGQTKLITAANFCENGKFAVVG   85 (408)
Q Consensus         7 vwd~~~~~~~~~~~-h~~~v~~~~~sp~~~~~l~t~~~dg~i~iw~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~   85 (408)
                      .|.....+ ...+. |.+.|++++|+| ++++||||+.||+|+|||+.+++..  ..+.+|...|.+++|+|++.+++++
T Consensus         2 ~w~p~~~~-~~~L~GH~~~I~~l~~sp-~~~~l~s~s~Dg~i~iWd~~~~~~~--~~~~~h~~~V~~~~~~~~~~~~~~~   77 (317)
T d1vyhc1           2 EWIPRPPE-KYALSGHRSPVTRVIFHP-VFSVMVSASEDATIKVWDYETGDFE--RTLKGHTDSVQDISFDHSGKLLASC   77 (317)
T ss_dssp             CCCCCSSC-SCEEECCSSCEEEEEECS-SSSEEEEEESSSCEEEEETTTCCCC--EEECCCSSCEEEEEECTTSSEEEEE
T ss_pred             ccCCCCCc-cEEEcCCCCCeEEEEEcC-CCCEEEEEeCCCeEEEEECCCCCEE--EEEeCCCCcEEEEeeeccccccccc
Confidence            46554443 34454 999999999999 9999999999999999999998876  6889999999999999999999999


Q ss_pred             ecCCEEEEEeccCCeeeEEEEEeeccccccCCCCeEEEeeCCCCCeEEEeeCCCeEEEEEccCcccceeecCccccccce
Q psy988           86 SYDGRCIFYTTDQLKYHTQIHVRSTRGKNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQI  165 (408)
Q Consensus        86 ~~dg~i~iw~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~~~~~dg~i~i~d~~~~~~~~~~~~~~~~~~~~  165 (408)
                      ..++.+.+|+....+....        ...+...+.++.++|+++.+++++.|+.+++||+++++....+..+...  +.
T Consensus        78 ~~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~--~~  147 (317)
T d1vyhc1          78 SADMTIKLWDFQGFECIRT--------MHGHDHNVSSVSIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREW--VR  147 (317)
T ss_dssp             ETTSCCCEEETTSSCEEEC--------CCCCSSCEEEEEECSSSSEEEEEETTSEEEEEETTTCCEEEEEECCSSC--EE
T ss_pred             ccccccccccccccccccc--------cccccccceeeeccCCCceEEeeccCcceeEeecccceeeeEEccCCCc--ce
Confidence            9999999999887654322        2345578999999999999999999999999999999988888776554  67


Q ss_pred             EEEEecCCCEEEEeecCceEEEeeeccceeeeeecccCCCccccccccccceEEEEEEeCCcceeeeecCCCCCCCceee
Q psy988          166 KASFSHDGKYIVSGSENQCIYIWKTHHDYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYV  245 (408)
Q Consensus       166 ~~~~~~~~~~l~~~~~dg~i~i~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~  245 (408)
                      ++++++++++|++++.|+.|++|+..+..            ....+..+...+.++.++|++.......           
T Consensus       148 ~~~~~~~~~~l~~~~~d~~v~~~~~~~~~------------~~~~~~~~~~~i~~~~~~~~~~~~~~~~-----------  204 (317)
T d1vyhc1         148 MVRPNQDGTLIASCSNDQTVRVWVVATKE------------CKAELREHRHVVECISWAPESSYSSISE-----------  204 (317)
T ss_dssp             EEEECTTSSEEEEEETTSCEEEEETTTCC------------EEEEECCCSSCEEEEEECCSCGGGGGGG-----------
T ss_pred             eeecccCCCEEEEEeCCCeEEEEeeccce------------eeEEEecCCCCceEEEEeeccccceeec-----------
Confidence            89999999999999999999999997643            3345677888999999999877654321           


Q ss_pred             ecCCCceeeeeccCCCCCeEEEecCCCeEEEEEcCCCeeeeEEeeccceeceeEEEEcCCCCEEEEecCCceEEEeeccc
Q psy988          246 LNATGRKISGIEPMPGEDKILVTSNDSRIRLYDLRDLNLSCKYKGYVNVSSQIKASFSHDGKYIVSGSENQCIYIWKTHH  325 (408)
Q Consensus       246 ~~~~~~~i~~~~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~~~~dg~i~iw~~~~  325 (408)
                          ............+.++++++.|+.|++||+++++++..+.+|..  .+.+++|+|++++|++|+.||.|++||+.+
T Consensus       205 ----~~~~~~~~~~~~~~~~~~~~~d~~i~~~~~~~~~~~~~~~~~~~--~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~  278 (317)
T d1vyhc1         205 ----ATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDN--WVRGVLFHSGGKFILSCADDKTLRVWDYKN  278 (317)
T ss_dssp             ----CCSCC-------CCEEEEEETTSEEEEEETTTTEEEEEEECCSS--CEEEEEECSSSSCEEEEETTTEEEEECCTT
T ss_pred             ----cccceeeeeccCCceeEeccCCCEEEEEECCCCcEEEEEeCCCC--CEEEEEECCCCCEEEEEECCCeEEEEECCC
Confidence                12223334456788899999999999999999999999988765  889999999999999999999999999988


Q ss_pred             cCccccccccCccccceeeeeeccceEEEEecCCchhhhhccCCCCCCCcccEEEEEecCCeEEEEe
Q psy988          326 DYAKFSSVRRDRNDFWEGIKAHNAVVTCAVFAPCPELIIAQMEPDKSESTGYVLVSADFNGVIRVFL  392 (408)
Q Consensus       326 ~~~~~~~~~~~~~~~~~~~~~h~~~v~~~~~~~~~~~~~~~~~~~~~s~~~~~l~s~~~dg~v~iw~  392 (408)
                      +            +++..+.+|.+.|++++|+|                ++++|+||+.||+|+|||
T Consensus       279 ~------------~~~~~~~~h~~~V~~~~~s~----------------~~~~l~s~s~Dg~i~iWd  317 (317)
T d1vyhc1         279 K------------RCMKTLNAHEHFVTSLDFHK----------------TAPYVVTGSVDQTVKVWE  317 (317)
T ss_dssp             S------------CCCEEEECCSSCEEEEEECS----------------SSSCEEEEETTSEEEEEC
T ss_pred             C------------cEEEEEcCCCCCEEEEEEcC----------------CCCEEEEEeCCCeEEEeC
Confidence            6            67788999999999999999                999999999999999997



>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure