K7EJ46 SIM22_HUMAN
Gene name: SMIM22
Protein name: Small integral membrane protein 22
List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ZTR6 | ZNF516-DT | 0.77324 | |
| 2 | Q9Y3D2 | MSRB2 | 0.74329 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 ... |
| 3 | Q8NHX9 | TPCN2 | 0.74029 | catabolic process GO:0009056 homeostatic process GO:0042592 signal transduction GO:0007165 ... |
| 4 | Q13253 | NOG | 0.73106 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q9UK05 | GDF2 | 0.725 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 6 | Q9NZ38 | IDI2-AS1 | 0.70711 | |
| 7 | Q9Y263 | PLAA | 0.70711 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 8 | Q6UW01 | CBLN3 | 0.67267 | |
| 9 | P54652 | HSPA2 | 0.67204 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 10 | P0DH78 | RNF224 | 0.65465 |
20 40 60 80 100 AA: MAVSTEELEATVQEVLGRLKSHQFFQSTWDTVAFIVFLTFMGTVLLLLLLVVAHCCCCSSPGPRRESPRKVSPWKVSPAGLWDLHGTVLGVEAEGEGSGG STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDD.........................................................................................DDD.DD DO_IUPRED2A: ...................................................................DDDD.......................DDDDDD DO_SPOTD: DD........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DD............................. ...............DDDD.......................DDDDDD CONSENSUS_MOBI: ............................... .......DDDDDDDDDDDDDDDDDDDDDDDD................. RICH_fLPS_[G]: GeGsGG
120 AA: KGAHPPREQRANLLGPAVLLVQERPKGVDNLALEP STMI: DO_DISOPRED3: DDDDDD............................. DO_IUPRED2A: DDDDDDDD.......................DD.. DO_SPOTD: DDDDDDDDDDD..................DDDDDD CONSENSUS: DDDDDDDD.......................DD.. CONSENSUS_MOBI: ................................... RICH_fLPS_[G]: kGah