O15428 PINL_HUMAN

Gene name: PIN1P1
Protein name: Putative PIN1-like protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q66K80 RUSC1-AS1 0.71001
2 Q9UII2 ATP5IF1 0.70197 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
3 Q5T319 FAM182B 0.69954
4 Q15465 SHH 0.66716 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
5 Q7RTY9 PRSS41 0.66066
6 Q8N9U9 SPANXA2-OT1 0.65168 cell cycle GO:0007049
cell death GO:0008219
reproduction GO:0000003
7 P57738 TCTA 0.65065 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
8 Q9NWW5 CLN6 0.65021 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
homeostatic process GO:0042592
...
9 O15552 FFAR2 0.64892 cell differentiation GO:0030154
cell-cell signaling GO:0007267
homeostatic process GO:0042592
...
10 P19622 EN2 0.64537 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...

                                           20                  40                  60                  80
AA:                      MADEEKLPPGWEKRMSRPSGRGYYFNHITNPSQWERPSGNSSSGGKIWQGEPARVRRSHLLVKPVKAALDLAAGNHPDQGGGPGADQRLHPEDQGRREGL
STMI:                                                                                                                        
DO_DISOPRED3:            DDD................................................................DDDDDDDDDD......D.......DDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDD.................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDD.................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AG]:                                                                                 AAldlAAGnhpdqGGGpGA               
RICH_[AL]:                                                                   ArvrrshLLvkpvkAALdLAA                           
RICH_[G]:                                                                                         GnhpdqGGGpGadqrlhpedqGrreG 
RICH_fLPS_[G]:                                                                                    GnhpdqGGGpG                
RICH_MOBI_[G]:                                                                                    GnhpdqGGGpGadqrlhpedqGrreG 
RICH_MOBI_[N]:                                    NhitNpsqwerpsgN                                                            
RICH_MOBI_[W]:                                            WerpsgnsssggkiW                                                    
RICH_MOBI_[GW]:                                           WerpsGnsssGGkiWqG