Q5T5A8 LCE3C_HUMAN

Gene name: LCE3C
Protein name: Late cornified envelope protein 3C

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5T5B0 LCE3E 0.85625 anatomical structure development GO:0048856
cell differentiation GO:0030154
2 Q9BYE3 LCE3D 0.83246 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
3 Q5TA77 LCE3B 0.74606 anatomical structure development GO:0048856
cell differentiation GO:0030154
response to stress GO:0006950
4 Q5T754 LCE1F 0.71955 anatomical structure development GO:0048856
cell differentiation GO:0030154
5 Q5T751 LCE1C 0.70888 anatomical structure development GO:0048856
cell differentiation GO:0030154
6 Q5T7P2 LCE1A 0.69869 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
7 Q5T752 LCE1D 0.65179 anatomical structure development GO:0048856
cell differentiation GO:0030154
nervous system process GO:0050877
8 A0A1B0GTR4 SPRR5 0.64916
9 O14633 LCE2B 0.63902 anatomical structure development GO:0048856
cell differentiation GO:0030154
10 Q5T753 LCE1E 0.62217 anatomical structure development GO:0048856
cell differentiation GO:0030154

                                           20                  40                  60                  80      
AA:                      MSCQQNQQQCQPPPSCPSPKCPPKSPAQCLPPPSSDCALSSGGCGPSSESGCCLSHHRHFRSHQCRRQRSNSCDRGSGQQGGGSCRGHGSGGCC
STMI:                                                                                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDD.....................DDDDD..................DDDD.DDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..............................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDD.....................DDDDD..................DDDDDDDDDDDDDDDDDDDDDDDDDD.
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PQ]:                  QQnQQQcQPPPscPsPkcPP                                                                       
RICH_[C]:                  CqqnqqqCqpppsCpspkC                                                                         
RICH_[G]:                                                                                           GsGqqGGGscrGhGsGG  
RICH_[P]:                           PPPscPsPkcPP                                                                       
RICH_[CG]:                                                                                       CdrGsGqqGGGsCrGhGsGGC 
RICH_[CP]:                 CqqnqqqCqPPPsCPsPkCPP                                                                       
RICH_[CQ]:                 CQQnQQQCQpppsCpspkC                                                                         
RICH_fLPS_[Q]:           mscQQnQQQcQpppscpspk                                                                          
RICH_fLPS_[C]:            sCqqnqqqCqpppsCpspkC                                                                         
RICH_fLPS_[CQ]:          msCQQnQQQCQpppsCpspkC                                                                         
RICH_MOBI_[PQ]:             QQnQQQcQPPPscPsPkcPPksP                                                                    
RICH_MOBI_[C]:             CqqnqqqCqpppsCpspkCppkspaqC                                                       CrghgsggCC
RICH_MOBI_[G]:                                                                                      GsGqqGGGscrGhGsGG  
RICH_MOBI_[P]:                      PPPscPsPkcPPksPaqclPPP                                                             
RICH_MOBI_[R]:                                                                            RRqRsnscdRgsgqqgggscR        
RICH_MOBI_[CG]:                                                                          CrrqrsnsCdrGsGqqGGGsCrGhGsGGCC
RICH_MOBI_[CP]:            CqqnqqqCqPPPsCPsPkCPPksPaqClPPP                                                             
RICH_MOBI_[CQ]:            CQQnQQQCQpppsCpspkC                                                                         
RICH_MOBI_[CR]:                                                                          CRRqRsnsCdRgsgqqgggsCR        
RICH_MOBI_[GR]:                                                                           RRqRsnscdRGsGqqGGGscR        
RICH_fLPS_MOBI_[C]:                                                                      CrrqrsnsCdrgsgqqgggsC         
RICH_fLPS_MOBI_[G]:                                                                              cdrGsGqqGGGscrGhGsGG  
RICH_fLPS_MOBI_[GC]:                                                                             CdrGsGqqGGGsCrGhGsGGCC