Q9BYE3 LCE3D_HUMAN

Gene name: LCE3D
Protein name: Late cornified envelope protein 3D

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell differentiation GO:0030154

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5T5B0 LCE3E 0.86595 anatomical structure development GO:0048856
cell differentiation GO:0030154
2 Q5T5A8 LCE3C 0.83246 anatomical structure development GO:0048856
cell differentiation GO:0030154
response to stress GO:0006950
3 Q5T751 LCE1C 0.69164 anatomical structure development GO:0048856
cell differentiation GO:0030154
4 Q5TA77 LCE3B 0.6783 anatomical structure development GO:0048856
cell differentiation GO:0030154
response to stress GO:0006950
5 Q5T754 LCE1F 0.64693 anatomical structure development GO:0048856
cell differentiation GO:0030154
6 Q5T7P2 LCE1A 0.63574 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
7 Q5TA79 LCE2A 0.63317 anatomical structure development GO:0048856
cell differentiation GO:0030154
8 Q5T753 LCE1E 0.62067 anatomical structure development GO:0048856
cell differentiation GO:0030154
9 P0CZ25 DNAH10OS 0.61699
10 Q5T752 LCE1D 0.61217 anatomical structure development GO:0048856
cell differentiation GO:0030154
nervous system process GO:0050877

                                           20                  40                  60                  80        
AA:                      MSCQQNQQQCQPPPKCPSPKCPPKSPVQCLPPASSGCAPSSGGCGPSSEGGCFLNHHRRHHRCRRQRPNSCDRGSGQQGGGSGCGHGSGGCC
STMI:                                                                                                                
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDD.....................................DD.DDDDDD.DDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ............................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDD.....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PQ]:                  QQnQQQcQPPPkcPsPkcPP                                                                     
RICH_[C]:                  CqqnqqqCqpppkCpspkC                                                                       
RICH_[G]:                                                                                         GsGqqGGGsGcGhGsGG  
RICH_[P]:                           PPPkcPsPkcPP                                                                     
RICH_[R]:                                                                             RcRRqRpnscdR                   
RICH_[CG]:                                                                             CrrqrpnsCdrGsGqqGGGsGCGhGsGGCC
RICH_[CP]:                 CqqnqqqCqPPPkCPsPkCPP                                                                     
RICH_[CQ]:                 CQQnQQQCQpppkCpspkC                                                                       
RICH_[CR]:                                                                            RCRRqRpnsCdR                   
RICH_[GR]:                                                                            RcRRqRpnscdRGsGqqGGGsG         
RICH_fLPS_[Q]:           mscQQnQQQcQpppkcpspk                                                                        
RICH_fLPS_[C]:            sCqqnqqqCqpppkCpspkC                                                                       
RICH_fLPS_[CQ]:          msCQQnQQQCQpppkCpspkC                                                                       
RICH_MOBI_[PQ]:             QQnQQQcQPPPkcPsPkcPPksP                                                                  
RICH_MOBI_[C]:             CqqnqqqCqpppkCpspkCppkspvqC                                                               
RICH_MOBI_[G]:                                              GcapssGGcG                            GsGqqGGGsGcGhGsGG  
RICH_MOBI_[P]:                      PPPkcPsPkcPPksPvqclPPassgcaP                                                     
RICH_MOBI_[R]:                                                                          RRqRpnscdR                   
RICH_MOBI_[CG]:                                      ClppassGCapssGGCG                 CrrqrpnsCdrGsGqqGGGsGCGhGsGGCC
RICH_MOBI_[CK]:                        KCpspKCppK                                                                    
RICH_MOBI_[CP]:            CqqnqqqCqPPPkCPsPkCPPksPvqClPPassgCaP                                                     
RICH_MOBI_[CQ]:            CQQnQQQCQpppkCpspkC                                                                       
RICH_MOBI_[CR]:                                                                        CRRqRpnsCdR                   
RICH_MOBI_[GR]:                                                                         RRqRpnscdRGsGqqGGGsG         
RICH_MOBI_[GS]:                                           SSGcapSSGG                                                 
RICH_MOBI_[KP]:                        KcPsPKcPPK                                                                    
RICH_fLPS_MOBI_[P]:                 PPPkcPsPkcPPksPvqclPP                                                            
RICH_fLPS_MOBI_[Q]:      mscQQnQQQcQpppkcpspk                                                                        
RICH_fLPS_MOBI_[PQ]:        QQnQQQcQPPPkcPsPkcPPksPvQclPP                                                            
RICH_fLPS_MOBI_[C]:        CqqnqqqCqpppkCpspkCppkspvqClppassgCapssggC                                                
RICH_fLPS_MOBI_[CQP]:      CQQnQQQCQPPPkCPsPkCPPksPvQC