Q6UW78 UQCC3_HUMAN
Gene name: UQCC3
Protein name: Ubiquinol-cytochrome-c reductase complex assembly factor 3
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- generation of precursor metabolites and energy GO:0006091
- membrane organization GO:0061024
- protein-containing complex assembly GO:0065003
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ZTR6 | ZNF516-DT | 0.77324 | |
| 2 | Q9Y3D2 | MSRB2 | 0.74329 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 ... |
| 3 | Q8NHX9 | TPCN2 | 0.74029 | catabolic process GO:0009056 homeostatic process GO:0042592 signal transduction GO:0007165 ... |
| 4 | Q13253 | NOG | 0.73106 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q9UK05 | GDF2 | 0.725 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 6 | Q8NI37 | PPTC7 | 0.70711 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 7 | Q9Y263 | PLAA | 0.70711 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 8 | Q6UW01 | CBLN3 | 0.67267 | |
| 9 | P54652 | HSPA2 | 0.67204 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 10 | P0DH78 | RNF224 | 0.65465 |
20 40 60 80 AA: MDSLRKMLISVAMLGAGAGVGYALLVIVTPGERRKQEMLKEMPLQDPRSREEAARTQQLLLATLQEAATTQENVAWRKNWMVGGEGGAGGRSP STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDD..................................................................DDDDDDDDDDD DO_IUPRED2A: ...................................DDDDDDDDDDDDDDDDDD.DDD...D.......................DDDDDDDDD DO_SPOTD: DDDDD.DDD....................................................................DD.DDDDDDDDDDDDD CONSENSUS: DDDDDDD ......................................................DDDDDDDDDDD CONSENSUS_MOBI: ....... ................................................................. RICH_fLPS_[G]: GGeGGaGGrs