Q6ZPA2 YS039_HUMAN

Protein name: Putative uncharacterized protein FLJ26174

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A0A1B0GUX0 ATP6V1FNB 0.8865
2 P20809 IL11 0.87316 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
3 Q9Y6U7 RNF215 0.86761 catabolic process GO:0009056
response to stress GO:0006950
4 Q9NPA2 MMP25 0.86245 anatomical structure development GO:0048856
catabolic process GO:0009056
extracellular matrix organization GO:0030198
...
5 P0C7Q6 SLC35G6 0.84912
6 P04180 LCAT 0.84524 biosynthetic process GO:0009058
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
7 O43516 WIPF1 0.83499 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...
8 Q9Y6J3 SMAD5-AS1 0.83021 signal transduction GO:0007165
9 A0A0U1RRE5 NBDY 0.82656 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
10 A0A1B0GUC4 MYOCOS 0.82532

                                           20                  40                  60                  80                 100
AA:                      MVPLFITSDSALTYSPLPEPPPTPALGGQRGPPTCQCPDFPYPVPPSEGCPSGRLLLSLHWDWGRGAGGSWSGGAWPGSPGWRLARGPAHGASAESLGPL
STMI:                                                                                                                        
DO_DISOPRED3:            D...............DDD..DDDD..DD.......................................................................
DO_IUPRED2A:             ............DDDDDDDDDDDDDDDDDDDDD..DDDD.D............................DDD.D...D...DDDDDDDD...D..DD...
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D..DDDDDDDDDDDDDDD
CONSENSUS:               D...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................DDDDDDDDD....DDDDDDDDDDDDDDD...
CONSENSUS_MOBI:          ............DDDDDDDDDDDDDDDDDDDD....................................................................
RICH_[A]:                                                                                                    ArgpAhgAsA      
RICH_[P]:                               PlPePPPtPalggqrgPPtcqcPdfP                                                           
RICH_[CP]:                                PePPPtPalggqrgPPtCqCPdfP                                                           
RICH_fLPS_[P]:                         sPlPePPPtPalggqrgPPtcqcP                                                              
RICH_MOBI_[P]:                          PlPePPPtPalggqrgP                                                                    
RICH_fLPS_MOBI_[P]:                    sPlPePPPtP                                                                            

                                          120         
AA:                      GKALVTGWEGGWRGGQGGACSPWYFPIPAAL
STMI:                                                   
DO_DISOPRED3:            ...............................
DO_IUPRED2A:             .......DD......................
DO_SPOTD:                .........DDDDDDDDDD............
CONSENSUS:               ...............................
CONSENSUS_MOBI:          ...............................