Q8WVE7 T170A_HUMAN
Gene name: TMEM170A
Protein name: Transmembrane protein 170A
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- membrane organization GO:0061024
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ZTR6 | ZNF516-DT | 0.77324 | |
| 2 | Q9Y3D2 | MSRB2 | 0.74329 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 ... |
| 3 | Q8NHX9 | TPCN2 | 0.74029 | catabolic process GO:0009056 homeostatic process GO:0042592 signal transduction GO:0007165 ... |
| 4 | Q13253 | NOG | 0.73106 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q9UK05 | GDF2 | 0.725 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 6 | Q8NI37 | PPTC7 | 0.70711 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 7 | Q9Y263 | PLAA | 0.70711 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 8 | Q6UW01 | CBLN3 | 0.67267 | |
| 9 | P54652 | HSPA2 | 0.67204 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 10 | P0DH78 | RNF224 | 0.65465 |
20 40 60 80 100 AA: MEREGSGGSGGSAGLLQQILSLKVVPRVGNGTLCPNSTSLCSFPEMWYGVFLWALVSSLFFHVPAGLLALFTLRHHKYGRFMSVSILLMGIVGPITAGIL STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDD......................................................................................... DO_IUPRED2A: DDDD................................................................................................ DO_SPOTD: DDDDDDDDDDDDDD...................................................................................... CONSENSUS: DDDDDDDDDDD....................................... .............. CONSENSUS_MOBI: .................................................. .............. RICH_fLPS_[G]: ereGsGGsGG
120 140 AA: TSAAIAGVYRAAGKEMIPFEALTLGTGQTFCVLVVSFLRILATL STMI: MMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ............................................ DO_IUPRED2A: ............................................ DO_SPOTD: ..........................................DD CONSENSUS: .......... ....... CONSENSUS_MOBI: .......... .......