Q9Y4Z0 LSM4_HUMAN

Gene name: LSM4
Protein name: U6 snRNA-associated Sm-like protein LSm4

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
- nucleobase-containing compound catabolic process GO:0034655
- protein-containing complex assembly GO:0065003
- ribonucleoprotein complex assembly GO:0022618

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N9U9 SPANXA2-OT1 0.79176 cell cycle GO:0007049
cell death GO:0008219
reproduction GO:0000003
2 A6NHQ2 FBLL1 0.78798 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
3 Q8WW01 TSEN15 0.78582 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
4 Q96KJ9 COX4I2 0.776 generation of precursor metabolites and energy GO:0006091
response to stress GO:0006950
5 O14508 SOCS2 0.77494 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
6 Q6UB35 MTHFD1L 0.77005 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 Q96CM4 NXNL1 0.76893 homeostatic process GO:0042592
8 Q9Y5Y6 ST14 0.76831 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell death GO:0008219
...
9 P17342 NPR3 0.76814 anatomical structure development GO:0048856
cell population proliferation GO:0008283
circulatory system process GO:0003013
...
10 Q8TDH9 BLOC1S5 0.76688 anatomical structure development GO:0048856
cell differentiation GO:0030154
cytoskeleton-dependent intracellular transport GO:0030705
...

                                           20                  40                  60                  80                 100
AA:                      MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVKEEVVAKGRGRGGLQQQKQQK
STMI:                                                                                                                        
DO_DISOPRED3:            ......................................................................................DDDDDDDDDDDDDD
DO_IUPRED2A:             .................D...............................................................D....DDDDDDDDDDDDDD
DO_SPOTD:                .....................................................................................DDDDDDDDDDDDDDD
CONSENSUS:               ......................................................................................DDDDDDDDDDDDDD
CONSENSUS_MOBI:          ................................................................................DDDDDDDDDDDDDDDDDDDD
RICH_[G]:                                                                                                      GrGrGGlqqqkqqk
RICH_[GQ]:                                                                                                     GrGrGGlQQQkQQk
RICH_fLPS_[Q]:                                                                                                 grgrgglQQQkQQk
RICH_fLPS_[G]:                                                                                                 GrGrGGlqqqkqqk
RICH_fLPS_[GQ]:                                                                                                GrGrGGlQQQkQQk
RICH_MOBI_[G]:                                                                                                 GrGrGGlqqqkqqk
RICH_MOBI_[GQ]:                                                                                                GrGrGGlQQQkQQk
RICH_MOBI_[GV]:                                                                                            VVakGrGrGG        
RICH_fLPS_MOBI_[Q]:                                                                                          akgrgrgglQQQkQQ 
RICH_fLPS_MOBI_[G]:                                                                                            GrGrGGlqqqkqqk

                                          120 
AA:                      GRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
STMI:                                                           
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[G]:                GrGmGGaGrGvfGGrGrGGipGtGrGqpekkpGrqaG  
RICH_[R]:                 RgmggagRgvfggRgR                      
RICH_[GQ]:               GrGmGGaGrGvfGG                         
RICH_[GR]:               GRGmGGaGRGvfGGRGRGG                    
RICH_fLPS_[Q]:           g                                      
RICH_fLPS_[G]:           GrGmGGaGrGvfGGrGrGGipGtGrG             
RICH_fLPS_[GQ]:          GrGmGGaGrGvfGGrGrGGipGtGrGQ            
RICH_MOBI_[G]:           GrGmGGaGrGvfGGrGrGGipGtGrGqpekkpGrqaG  
RICH_MOBI_[R]:            RgmggagRgvfggRgR                      
RICH_MOBI_[GQ]:          GrGmGGaGrGvfGG                         
RICH_MOBI_[GR]:          GRGmGGaGRGvfGGRGRGG                    
RICH_fLPS_MOBI_[G]:      GrGmGGaGrGvfGGrGrGGipGtGrG