Citrus Sinensis ID: 000053
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 2576 | 2.2.26 [Sep-21-2011] | |||||||
| Q8BV79 | 2999 | TPR and ankyrin repeat-co | yes | no | 0.357 | 0.307 | 0.249 | 9e-64 | |
| O15050 | 2925 | TPR and ankyrin repeat-co | yes | no | 0.244 | 0.215 | 0.285 | 1e-61 | |
| Q00416 | 2231 | Helicase SEN1 OS=Saccharo | yes | no | 0.107 | 0.124 | 0.356 | 3e-43 | |
| B6SFA4 | 818 | Probable helicase MAGATAM | no | no | 0.115 | 0.363 | 0.347 | 4e-43 | |
| O94387 | 1944 | Uncharacterized ATP-depen | yes | no | 0.116 | 0.153 | 0.371 | 5e-43 | |
| Q92355 | 1687 | Helicase sen1 OS=Schizosa | no | no | 0.116 | 0.177 | 0.368 | 4e-42 | |
| Q86AS0 | 967 | Probable helicase DDB_G02 | no | no | 0.112 | 0.300 | 0.349 | 4e-40 | |
| P30771 | 971 | ATP-dependent helicase NA | no | no | 0.103 | 0.273 | 0.372 | 7e-40 | |
| Q9FJR0 | 1254 | Regulator of nonsense tra | no | no | 0.122 | 0.251 | 0.337 | 9e-38 | |
| Q9HEH1 | 1093 | Regulator of nonsense tra | N/A | no | 0.100 | 0.236 | 0.370 | 1e-36 |
| >sp|Q8BV79|TRNK1_MOUSE TPR and ankyrin repeat-containing protein 1 OS=Mus musculus GN=Trank1 PE=2 SV=3 | Back alignment and function desciption |
|---|
Score = 247 bits (631), Expect = 9e-64, Method: Compositional matrix adjust.
Identities = 279/1119 (24%), Positives = 481/1119 (42%), Gaps = 197/1119 (17%)
Query: 962 YFQVLKVWDIL--------PLENVQNLLTR-LDNIFVKNLEVPKNWATTSNIV---RFKG 1009
Y +++++WDI+ + + + TR L + K L+ ++N+ R
Sbjct: 967 YTEIIRIWDIVLDHCKLSDSIMAICSAYTRGLSCVLRKKLKGINKGQVSANMKIQKRIPR 1026
Query: 1010 LADNESGSDYSGAASDGRSYAENSNVSDSLLLMKFYSLSLGVVRHLLSDRDARELDLPFE 1069
++ ++ S D + S V +MKF+S S + ++L+D A ++ PF
Sbjct: 1027 CYVEDTEAEKSLEQVDPEYFPPASAVETEYSIMKFHSFSTNMALNILNDMTA-TVEYPFR 1085
Query: 1070 VTDEQLDMI-LFPRS---TFILGRSGTGKTT-----------------------VLIMKL 1102
V + + +I L P+ ++GRSGTGKTT +L ++
Sbjct: 1086 VGELEYAVIDLNPKPLEPIILIGRSGTGKTTCCLYRLWKKFHVYWEKAEQAGSPLLSKQI 1145
Query: 1103 FQKEKLH--------------------NMALEGFFGVNNSSQETEA---------EKDLE 1133
K +L ++ +E G++ QE+EA D +
Sbjct: 1146 LPKRRLEVEPGKEGPGREEEEHEEEEGSIKVETVDGIDEE-QESEACAGGATVEPAGDSQ 1204
Query: 1134 KTERVI---------LRQLFVTVSPKLCFAVKQHISHMKSSTIGGKFATEGSLIDTDDID 1184
E + L Q+FVT + LC V+++ + ST K + +D +
Sbjct: 1205 GAEGCVPDHPHQLEHLHQIFVTKNHVLCQEVQRNFIELSKST---KATSHYKPLDPN--- 1258
Query: 1185 DAEKLKDIPNSFIDIPAKSYPLVITFHKFLMMLDGTLCNSYFERFHN------------- 1231
KL+D+ + +++PL +T + L++LD +L +F R +
Sbjct: 1259 -VHKLQDLRD-------ENFPLFVTSKQLLLLLDASLPKPFFLRNEDGSLKRTIVGWSTQ 1310
Query: 1232 ------IWK----------NYGQLQNSKSVFIETIIRKKEVNYERFSSSYWPHFNAQLAR 1275
W+ NY + + + + V +E F++ WP +
Sbjct: 1311 EEFSIPSWEEDDEEVEADGNYNEEEKATETQTGDSDPRVYVTFEVFTNEIWPKM-IKGRS 1369
Query: 1276 KLDPSRVFTEIISHIKGGLQSIEVVNGKLNREDYVNLSETRNSSLSRQKRERIYDIFESY 1335
+P+ ++ EI S +KG +++ +G+L E Y L R+ + ++ R IY +F Y
Sbjct: 1370 SYNPALIWKEIKSFLKGSFEALSCPHGRLTEEAYKKLGRKRSPNF-KEDRSEIYSLFCLY 1428
Query: 1336 EQMKMRNGEFDLADLVNDLHHRLKEESYKGDEFHFVYIDEVQDLTMSQVALFKYVCKNIE 1395
+Q++ + G FD D++ +L RL + H +Y DE+QD T +++AL C N
Sbjct: 1429 QQIRSQKGYFDEEDVLYNLSWRLSKLRVLPWSIHELYGDEIQDFTQAELALL-MKCINDP 1487
Query: 1396 EGFVFSGDTAQTIARGIDFRFQDIRSLFYKKFVLESRNNGNDGRQEKRQLSDIFNLRQNF 1455
+GDTAQ+I +G+ FRF D+ SLF+ SR+ D + R+ I L QN+
Sbjct: 1488 NAMFLTGDTAQSIMKGVAFRFSDLLSLFH----YASRST-VDKQCAVRKPKRIHQLYQNY 1542
Query: 1456 RTHVGVLNLAQSIIELLYRFFPHSVDILKPETSLIYGEPPILLESGDEENAILKIFGNTG 1515
R+H G+LNLA +++LL +FP S D L ++ L G P LL+S + + + GN
Sbjct: 1543 RSHSGILNLASGVVDLLQFYFPESFDRLPRDSGLFDGPKPTLLDSCSVSDLAILLRGNKR 1602
Query: 1516 EVGGNMVGFGAEQVILVRDDCVRKEISNYVGKQALVLTIVESKGLEFQDVLLYKFFSASP 1575
+ + FGA QVILV ++ +++I +G ALVLT+ E+KGLEF DVLLY FF+ S
Sbjct: 1603 KT--QPIEFGAHQVILVANEKAKEKIPEELG-LALVLTVYEAKGLEFDDVLLYNFFTDSE 1659
Query: 1576 LKNQWRVVYEYMKEQD-----------LLDSTSPGSFPSF--NEVKHNILCSELKQLYVA 1622
+W+++ + D L+ +SP S N + +L ELKQLY A
Sbjct: 1660 AYKEWKIISSFTPSSDSREEKWPLVDVPLERSSPSQARSLMVNPEMYKLLNGELKQLYTA 1719
Query: 1623 ITRTRQRLWIWENKEEFSKPMFDYWKKRFLVQVRRLDDS--LAQAMQV-ASSPEEWKSRG 1679
ITR R LWI++ E P F Y+ +R VQV + D++ +M V S+P EW +G
Sbjct: 1720 ITRARVNLWIFDENLEKRAPAFKYFIRRDFVQVVKTDENKDFDDSMFVKTSTPYEWIIQG 1779
Query: 1680 IKVCEIFKKFIIFVCLWLFYEQNYEMATICFEKAKDTYWEGRSKASGLKAAADRISSSNP 1739
+ + K Q +++A C++K D + + + A + +P
Sbjct: 1780 ----DYYAK-----------HQCWKVAAKCYQKG-DALEKEKLALAHYTALNMKSKKFSP 1823
Query: 1740 LEARIILREAAKIFEAIGKVDSAAKCFFDMGEYERAGTIYLERCEEPELEKAGECFSLAG 1799
E + E AK + + + KC E++ + + CE G
Sbjct: 1824 KEKELQYLELAKTYLECNEPKLSLKCLSYAKEFQLSAQL----CER------------LG 1867
Query: 1800 CYKLAADVYARGSFLAECLDVCSKGKLFDIGLQYISYWKQHADTDVGRVKSSKEMKK--- 1856
+ AA Y R + + + FD+ L+ + + + V+ +EM K
Sbjct: 1868 KIRDAAYFYKRSQCFQDAFRCFEQIQEFDLALRMYCQEELFEEAAIA-VEKYEEMLKNKT 1926
Query: 1857 ---------IEQDFLQSCALHFHKLNDNKSMMKFVRAFHSMDLIRNFLNSKGCFDELLVL 1907
Q +L++ A + N +K MM + D + FL S+ C E L
Sbjct: 1927 FPIPKLSYSASQFYLEAAAKYLSA-NKSKEMMAVLSKLDVEDQL-VFLKSRKCLAEAAEL 1984
Query: 1908 EEESESFMDAANIARLRGDILRTVDLLQKVGNFKEACNL 1946
+AA + + G +L L +F+ +C L
Sbjct: 1985 LNREGRREEAALLMKQHGCLLEAARLTAN-KDFQASCLL 2022
|
Mus musculus (taxid: 10090) |
| >sp|O15050|TRNK1_HUMAN TPR and ankyrin repeat-containing protein 1 OS=Homo sapiens GN=TRANK1 PE=2 SV=4 | Back alignment and function description |
|---|
| >sp|Q00416|SEN1_YEAST Helicase SEN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEN1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|B6SFA4|MAA3_ARATH Probable helicase MAGATAMA 3 OS=Arabidopsis thaliana GN=MAA3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O94387|YGSA_SCHPO Uncharacterized ATP-dependent helicase C29A10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.10c PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q92355|SEN1_SCHPO Helicase sen1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sen1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q86AS0|Y4399_DICDI Probable helicase DDB_G0274399 OS=Dictyostelium discoideum GN=DDB_G0274399 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P30771|NAM7_YEAST ATP-dependent helicase NAM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM7 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9HEH1|RENT1_NEUCR Regulator of nonsense transcripts 1 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=2E4.130 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 2576 | ||||||
| 359473525 | 2792 | PREDICTED: uncharacterized protein LOC10 | 0.969 | 0.894 | 0.574 | 0.0 | |
| 255555527 | 2820 | conserved hypothetical protein [Ricinus | 0.967 | 0.884 | 0.556 | 0.0 | |
| 359473527 | 2788 | PREDICTED: uncharacterized protein LOC10 | 0.958 | 0.885 | 0.554 | 0.0 | |
| 356510822 | 2812 | PREDICTED: uncharacterized protein LOC10 | 0.966 | 0.885 | 0.533 | 0.0 | |
| 297738290 | 6100 | unnamed protein product [Vitis vinifera] | 0.894 | 0.377 | 0.530 | 0.0 | |
| 449445371 | 2710 | PREDICTED: uncharacterized protein LOC10 | 0.931 | 0.885 | 0.512 | 0.0 | |
| 449526710 | 2474 | PREDICTED: uncharacterized protein LOC10 | 0.909 | 0.947 | 0.507 | 0.0 | |
| 359473531 | 2818 | PREDICTED: uncharacterized protein LOC10 | 0.894 | 0.817 | 0.477 | 0.0 | |
| 224099651 | 1950 | predicted protein [Populus trichocarpa] | 0.545 | 0.721 | 0.635 | 0.0 | |
| 449445385 | 2763 | PREDICTED: uncharacterized protein LOC10 | 0.794 | 0.740 | 0.442 | 0.0 |
| >gi|359473525|ref|XP_003631315.1| PREDICTED: uncharacterized protein LOC100265010 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 2949 bits (7646), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 1513/2632 (57%), Positives = 1905/2632 (72%), Gaps = 134/2632 (5%)
Query: 3 MEGEANNSRSKKKRAVPYDYGFTDTVFSWSLEDIFNEDLFKDKVKRIPFSFRSVGQYFES 62
ME E +N KKRA+ D + +FSWSLEDI N DL++++V+RIP +F + G YF S
Sbjct: 1 MEKEGSN----KKRAIAKDSRLIELLFSWSLEDISNNDLYRNQVERIPETFGTAGHYFGS 56
Query: 63 FVFPLLEETRANLMSGMEKISNAPFAQVVAFEDSKPYGSMLYDVKVDCWRNRFSNLGREP 122
++FPLLEE RA + S ME I +APFA+V +F++SKPYGS+LYDVKVD WRNRFS+ GREP
Sbjct: 57 YIFPLLEEIRAEMCSSMEDIHSAPFAEVTSFDESKPYGSLLYDVKVDNWRNRFSDHGREP 116
Query: 123 YKTLPGDILVLADAKPETASDLQRVGRMWTFVSVANVTEDENEIDTSPTYFKVNATKEIQ 182
YKTLPGDIL+L DAKPET SDLQRVGR WTF SV + +DENE ++S TYFKV +KE +
Sbjct: 117 YKTLPGDILILTDAKPETVSDLQRVGRTWTFASVTRIPDDENEDNSSSTYFKVKISKEYE 176
Query: 183 IDVSK-KSLFVIFLINRTSNRRIWNSLHMKGNLKIIKELLCTDS---------------- 225
+D K +S+FVIFLIN +N+RIWN+LHM GN+ II E+L +DS
Sbjct: 177 VDDEKQRSMFVIFLINIVTNKRIWNALHMSGNISIISEVLSSDSLVKENCCQCPVWSDGV 236
Query: 226 --------------------------------GATVQLIWGPPGTGKTKTVSMLLVILLQ 253
+V+LIWGPPGTGKTKTVS+LL LL+
Sbjct: 237 YAENFPMSSSSNLNESQTKAVVTCLRKIQCNHKPSVELIWGPPGTGKTKTVSVLLFKLLR 296
Query: 254 MKFRTLVCTPTIVAIKELASRVVKLVKESVERDCRDALFFPLGEILLLGNNERLKVDSGV 313
RTL C PT VA+ E+ASRV+KL KES E ++LF LG+IL+ GN +RLKV + +
Sbjct: 297 TNIRTLACAPTNVAVTEVASRVLKLTKESFE----NSLFCSLGDILIFGNKDRLKVGADI 352
Query: 314 EEIYLDYRVKRLADCFAPLTGWSHCFASMVEFLDNCVSQYHTYMENESMKQSEDINGDII 373
E+YLDYRV RL +CF PLTGW +CF SM++FL++CVS YH ++ENE +
Sbjct: 353 VEVYLDYRVDRLIECFGPLTGWRYCFNSMIDFLEDCVSHYHIFLENE-----------LR 401
Query: 374 KEKECGKEADASDVEIKPFLEFVRERFKCIINGDIIKEKECGKEADASDVEIKPFLEFVR 433
KEK C E ++ E+ F++ + ECG K F+EF R
Sbjct: 402 KEKSCSNEGGSTKEEV-----FMKNE---------LSSNECGSSKKVD----KSFIEFAR 443
Query: 434 ERFKCIAAPLRSCIFNFCTHIPKCYIGEDNFHVMATLISLLDSFETLLFEDNLVSEELEE 493
+RFK A PLR C+ FCTH+ K +I E NF M LI LLDSFE+LL +D++V EELE+
Sbjct: 444 DRFKATAGPLRRCVQIFCTHLSKDFILEQNFQNMVDLIRLLDSFESLLSKDDVVPEELEK 503
Query: 494 LLSHS-VDEDLSESIVDIKYLLHKRRSECHFVLRKLLSSFNELNLPSAVEKDLLEDLLKR 552
L SH +D S S D LL+ R EC VL+ L S N+L+LPS + E L+K
Sbjct: 504 LFSHQEAVQDSSPSFSDSSNLLYMSRGECLSVLKILRGSLNKLSLPSGMN----EGLIKE 559
Query: 553 FCLKRASLFFSTASSSYMLHSVAMKPLNFLVIDEAAQLKESESTIPLQLSGIKHAVLFGD 612
FC K ASL F TASSSY LHS MKPL+ LVIDEAAQLKE ESTIPLQL GI+HA+L GD
Sbjct: 560 FCFKMASLIFCTASSSYKLHSANMKPLDLLVIDEAAQLKECESTIPLQLPGIRHAILIGD 619
Query: 613 ECQLPAMVESKVSDEACFGRSLFERLSHLRHSKHLLSIQYRMHPSISFFPNSYFYENKIH 672
ECQLPAMV SKVS EA FGRSLFERLS L H KHLL++QYRMHPSISFFPNS FY N+I
Sbjct: 620 ECQLPAMVSSKVSKEAGFGRSLFERLSSLGHFKHLLNVQYRMHPSISFFPNSKFYFNQIL 679
Query: 673 DSPTVEKRSYEKRFLPGPMYGPYSFINVFGGRE-EFIEHSCRNMVEVSVVMKILLNLYKG 731
D+P V+ +SY K +L GPM+G YSFINV G E + + S +NM+EV++V+KI+ NLYK
Sbjct: 680 DAPNVKSKSYTKHYLSGPMFGSYSFINVRGKEEHDDVGKSRKNMIEVAIVIKIVRNLYKE 739
Query: 732 WINSKEKLSIGIVSPYIAQVAAIQEKLGSKYVNSAGFAVKVMSVDGFQGGEEDIIIISTV 791
W S +KLSIG++SPY AQV AIQ+KLG KY F+VKV +VDGFQGGEEDIIII TV
Sbjct: 740 WSGSNQKLSIGVISPYAAQVVAIQDKLGQKYEKLGNFSVKVKTVDGFQGGEEDIIIICTV 799
Query: 792 RSNNGGSIGFISNPRRVNVALTRARHCLWILGNERTLTRNRSVWKALVDDAKARQCFFNA 851
RSN GGSIGF+SNP+R NVALTRAR+CLWILGNERTL + S+W+ LV DAK R+CFFNA
Sbjct: 800 RSNTGGSIGFLSNPQRTNVALTRARYCLWILGNERTLANSESIWEDLVLDAKKRKCFFNA 859
Query: 852 DDDKDLGKSILEAKKELNELYELLNPGSTLFRSQRWKVNFSDNFLKSFRKLTSDQTKKLV 911
D+DKD+ +ILE K E ++L LL+ S LF+S WKV FSDNF KSF KL SD TKK V
Sbjct: 860 DEDKDIANAILEVKTEFDQLNHLLDGSSILFKSAMWKVLFSDNFKKSFVKLRSDHTKKSV 919
Query: 912 INLLLKLASGWRPEKRKVDSVCGSSLHIIKQFKVEGFYIICTIDIVKESKYFQVLKVWDI 971
+NLLLKL+SGWRP++ VD VC SS HI+KQFKVEG YI+C+IDIVK + QVL+VWDI
Sbjct: 920 LNLLLKLSSGWRPKRLNVDRVCESSSHILKQFKVEGLYIVCSIDIVKNT---QVLRVWDI 976
Query: 972 LPLENVQNLLTRLDNIFVKNLEVPKNWATTSNIVRFKGLADNESGSDYSGAASDGRSYAE 1031
LPLE V L RLDNIF +NLEVPK W T+ NI++FK ++ES + S SDG+SY E
Sbjct: 977 LPLEGVPKLAKRLDNIFQRNLEVPKTWPTSLNIIQFKN--NDESQGNESAGTSDGKSYVE 1034
Query: 1032 NSNVSDSLLLMKFYSLSLGVVRHLLSDRDARELDLPFEVTDEQLDMILFPRSTFILGRSG 1091
NS VS+SLLLMKFYSLS G+V HLLSD D RELDLPFEVTD++ ++IL+ RSTFILGRSG
Sbjct: 1035 NSKVSESLLLMKFYSLSSGMVSHLLSDHDGRELDLPFEVTDQEQEIILYCRSTFILGRSG 1094
Query: 1092 TGKTTVLIMKLFQKEKLHNMALEGFFG-----VNNSSQETEAEKDLEKTERVILRQLFVT 1146
TGKTTVL MKLFQKE+ H MA+EGF G N++ E + +T+ +LRQLFVT
Sbjct: 1095 TGKTTVLTMKLFQKEQQHRMAMEGFQGDKGNASTNATYRKEVGVSVGETQVAVLRQLFVT 1154
Query: 1147 VSPKLCFAVKQHISHMKSSTIGGKFATEGSLIDTDDIDDAEKLKDIPNSFIDIPAKSYPL 1206
VSPKLC+AVKQH+SH+KS G F+ E S + D +DDAE DI +S +DIP KSYPL
Sbjct: 1155 VSPKLCYAVKQHVSHLKSFAHGKNFSAEESSNNKDYVDDAELFDDIQDSLVDIPPKSYPL 1214
Query: 1207 VITFHKFLMMLDGTLCNSYFERFHNIWK-NYGQLQNSKSVFIETIIRKKEVNYERFSSSY 1265
V+TFHKFLMMLD TL NSYF+RFH++ + ++G+ ++ S+ ++T+IR KEV Y+RFSSSY
Sbjct: 1215 VVTFHKFLMMLDETLSNSYFDRFHDVRELSHGKSRSLSSIGMQTLIRTKEVTYDRFSSSY 1274
Query: 1266 WPHFNAQLARKLDPSRVFTEIISHIKGGLQSIEVVNGKLNREDYVNLSETRNSSLSRQKR 1325
WPHFN+QL +KLD S FTEIISHIKGGL+ V +GKL+REDYV LSE R S+LS QKR
Sbjct: 1275 WPHFNSQLTKKLDSSSAFTEIISHIKGGLKGGRVPDGKLSREDYVLLSEGRVSTLSGQKR 1334
Query: 1326 ERIYDIFESYEQMKMRNGEFDLADLVNDLHHRLKEESYKGDEFHFVYIDEVQDLTMSQVA 1385
ERIYDIF+ YE+MKM GEFDLADLV DLHHRL+++ Y GDE FVYIDEVQDLTM Q+A
Sbjct: 1335 ERIYDIFQDYEKMKMERGEFDLADLVIDLHHRLRQQRYMGDEMDFVYIDEVQDLTMRQIA 1394
Query: 1386 LFKYVCKNIEEGFVFSGDTAQTIARGIDFRFQDIRSLFYKKFVLESRNNGNDGRQEKRQL 1445
LFKYVC+N+ EGFVFSGDTAQTIARGIDFRFQDIRSLFY +FV+ES ++G DGR+EK Q+
Sbjct: 1395 LFKYVCRNVNEGFVFSGDTAQTIARGIDFRFQDIRSLFYNEFVMES-SDGRDGRKEKGQI 1453
Query: 1446 SDIFNLRQNFRTHVGVLNLAQSIIELLYRFFPHSVDILKPETSLIYGEPPILLESGDEEN 1505
S+IF+L QNFRTH GVL L+QS+I+LLYRFFP S+D+L PETS IYGE P+LLE G +EN
Sbjct: 1454 SEIFHLSQNFRTHAGVLKLSQSVIDLLYRFFPQSIDVLSPETSEIYGEAPVLLEPGKDEN 1513
Query: 1506 AILKIFGNTGEVGGNMVGFGAEQVILVRDDCVRKEISNYVGKQALVLTIVESKGLEFQDV 1565
AI+ +FGN+ +GG+MVGFGAEQVILVRDDC RKEIS+YVG+QALVLTI+E KGLEFQDV
Sbjct: 1514 AIITMFGNSQNIGGSMVGFGAEQVILVRDDCSRKEISDYVGEQALVLTILECKGLEFQDV 1573
Query: 1566 LLYKFFSASPLKNQWRVVYEYMKEQDLLDSTSPGSFPSFNEVKHNILCSELKQLYVAITR 1625
LLY FF +SPLKNQWRVVYEYMKEQ+LLDST+P S+PSF++ KHN++CSELKQLYVAITR
Sbjct: 1574 LLYNFFGSSPLKNQWRVVYEYMKEQNLLDSTAPRSYPSFSQEKHNVMCSELKQLYVAITR 1633
Query: 1626 TRQRLWIWENKEEFSKPMFDYWKKRFLVQVRRLDDSLAQAMQVASSPEEWKSRGIKVCEI 1685
TRQRLWI EN EE SKPMFDYWKK LVQV +LD+SLA M+VAS+PEEWK+ GIK
Sbjct: 1634 TRQRLWICENIEELSKPMFDYWKKLCLVQVTQLDESLANEMRVASTPEEWKATGIK---- 1689
Query: 1686 FKKFIIFVCLWLFYEQNYEMATICFEKAKDTYWEGRSKASGLKAAADRISSSNPLEARII 1745
L E +YEMAT CFE+A+DTYW +KA GLKAAA++ NP A +
Sbjct: 1690 -----------LLREHHYEMATRCFERAEDTYWARLAKAHGLKAAAEQKRHLNPEAAHVD 1738
Query: 1746 LREAAKIFEAIGKVDSAAKCFFDMGEYERAGTIYLERCEEPELEKAGECFSLAGCYKLAA 1805
LR+AA+IFE IG+ AAKCFF + EYERAG IYLE+C E ELEKAGECFSLA Y+LAA
Sbjct: 1739 LRKAAEIFEEIGEARPAAKCFFQLNEYERAGRIYLEKCGESELEKAGECFSLAALYELAA 1798
Query: 1806 DVYARGSFLAECLDVCSKGKLFDIGLQYISYWKQHADTDVGRVKSSKEMKKIEQDFLQSC 1865
+VYARG F +ECL C+KGK D+GL+YI YWKQHA T +K SKE+ KIEQ+FL+SC
Sbjct: 1799 EVYARGHFFSECLSACTKGKFLDMGLRYIHYWKQHATTSTFMIKRSKEIGKIEQEFLESC 1858
Query: 1866 ALHFHKLNDNKSMMKFVRAFHSMDLIRNFLNSKGCFDELLVLEEESESFMDAANIARLRG 1925
A H+H+L DN+ MM+FV+AFHSM+ RNFL + C DELL LEEE +FM+AANIA+L G
Sbjct: 1859 AHHYHELKDNRKMMEFVKAFHSMESKRNFLTTLDCLDELLRLEEELGNFMEAANIAKLSG 1918
Query: 1926 DILRTVDLLQKVGNFKEACNLTLNYVLSNSLWSSGSKGWPLKQFTQKKELLEKAKLLAKN 1985
+IL ++L K GN+++A L L YV +NSLW+SGS+GWPLKQF +K+ELL KA+L ++
Sbjct: 1919 EILLEAEMLGKAGNYRDASTLFLCYVFANSLWASGSRGWPLKQFVKKEELLTKARLFSER 1978
Query: 1986 ESNKFYNFVCTEADILSNDQSDLLIMNQQLNASKRHQSVNGETLSARKILDFHLHTISSK 2045
ES +FY FVC E ILSN+Q+ L MNQ L+ S+RH+SV GE LSARKI+D HL++ ++K
Sbjct: 1979 ESKQFYEFVCMEVSILSNEQTSLFEMNQCLSTSQRHKSVRGEILSARKIIDAHLNSNTTK 2038
Query: 2046 YVWEDEYVLVEK------ICNNRISVQTLIYFWNCWKDKIVNVLKYLECLK-SQNFNDYR 2098
Y W DE+V K + N ISV+TL+YFWN WK+ +VN+ + L + +Q+ +Y
Sbjct: 2039 YEWTDEWVSDLKQHSEVRLSQNCISVETLLYFWNVWKENVVNIFESLGLDETTQDVKNYS 2098
Query: 2099 SYGDFCLNYLGVWRQYNNTNIIYLLLNGDAEWVRDLNNGHALRSGNLASINVHQLVSAGR 2158
SYG+FC NY GV +Q N N+I+ LL DA W+R +++ R+G L ++ Q SA R
Sbjct: 2099 SYGEFCFNYFGVRKQCKNLNLIHALLIPDANWLRAVDDRFIRRTGKLVYVDADQFASAAR 2158
Query: 2159 NYWSSELFSVGTKVLDNLEALHKQSSENSPSVWCHVLCLAYIYEVAKFLLSSNYSSLQYH 2218
+YWSSEL SVGTKVL+NLE L+ S+ S S++C L +++EV++FLL + L+Y+
Sbjct: 2159 SYWSSELLSVGTKVLENLEVLYNYSTWKSLSLFCQSKLLVHMFEVSEFLLKLKFLDLRYN 2218
Query: 2219 -AKVLQKFIDQSTEHLFDFIFPLEWRESLNENMISLKGTKLYRNIIKEVFSKHIGLKGKL 2277
A+ LQKF+D ST IFPL+W++S ENM+SL+ T+L RN+++EV S I +K +
Sbjct: 2219 AARTLQKFLDISTRQFCSKIFPLDWKKSSTENMVSLRETELSRNLLEEVISTSISIKSEF 2278
Query: 2278 SYGQIGSAVVMILRTGKLGKDVYGRVAKRFDGYTPWKEFVESLSINMGLESYRGSVLQNH 2337
+YGQIG IL GKL ++Y ++A++F PWK F+++LS N+G + SV N
Sbjct: 2279 TYGQIGRVASWILGMGKLTTELYEKIAEKFAVNPPWKAFIKNLSGNIGSGFPQDSVPIN- 2337
Query: 2338 DDMKHASHVWKFYRALCDTYEANWRRVDYITPDCFLYLIERLLILLSSLKGCIVTTKSSF 2397
+ KH S V AL DTY A W + DYI+P FLYL++RLLIL++S +G TTKSS+
Sbjct: 2338 ESRKHVSLVLTLDGALRDTYNAYWGQSDYISPGYFLYLVDRLLILVTSFQGYCFTTKSSY 2397
Query: 2398 VDWLIYQEWSTNPTSSLFTDLHQSFGAVYEFIFNIVQQFLYSEKETMEWIKKSCTEIKDY 2457
++WLI+QEW++ P L + FGA +++ I Q LY ++ T+EWI+KS +Y
Sbjct: 2398 IEWLIFQEWNSFPNPGLVANPQFPFGATLDYVAYIAQDLLYKKQVTVEWIRKSNINFNEY 2457
Query: 2458 HSLVVLRLFVIVCLLHLNFGNS--LNLLVDLLGRINITKKLSWEFYDALRRRRKR---DI 2512
+ L+VLRL +I+CLL +N + + +L LL R +IT L +F D L RRRKR DI
Sbjct: 2458 YPLLVLRLVIIICLLCVNAKHEKYVEMLFGLLRRGDITSLLPRDFCDVLWRRRKRNQFDI 2517
Query: 2513 RI-VIAEAFEKIGNPLVVASLGGKCPGFACPNAIVVDMEIIRCKEDILGILF 2563
+ V+AEA K+ NPLV+ L +CP+AI +DM + +C+ED+L +LF
Sbjct: 2518 SVNVLAEALRKVDNPLVIVKLQRNSSEVSCPDAIFIDMTVNQCREDLLRVLF 2569
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255555527|ref|XP_002518800.1| conserved hypothetical protein [Ricinus communis] gi|223542181|gb|EEF43725.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359473527|ref|XP_002263192.2| PREDICTED: uncharacterized protein LOC100243095 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356510822|ref|XP_003524133.1| PREDICTED: uncharacterized protein LOC100802419 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297738290|emb|CBI27491.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449445371|ref|XP_004140446.1| PREDICTED: uncharacterized protein LOC101212468 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449526710|ref|XP_004170356.1| PREDICTED: uncharacterized protein LOC101229717 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|359473531|ref|XP_002269567.2| PREDICTED: uncharacterized protein LOC100251075 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224099651|ref|XP_002311566.1| predicted protein [Populus trichocarpa] gi|222851386|gb|EEE88933.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449445385|ref|XP_004140453.1| PREDICTED: uncharacterized protein LOC101214394 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 2576 | ||||||
| TAIR|locus:2018536 | 1065 | AT1G65780 [Arabidopsis thalian | 0.241 | 0.584 | 0.381 | 7.6e-154 | |
| TAIR|locus:2018561 | 1050 | AT1G65810 [Arabidopsis thalian | 0.177 | 0.434 | 0.493 | 2.4e-134 | |
| TAIR|locus:2166173 | 839 | AT5G37150 [Arabidopsis thalian | 0.130 | 0.399 | 0.502 | 7.6e-115 | |
| TAIR|locus:2135472 | 689 | AT4G05540 [Arabidopsis thalian | 0.120 | 0.449 | 0.529 | 6.8e-114 | |
| TAIR|locus:2166183 | 871 | AT5G37160 [Arabidopsis thalian | 0.119 | 0.354 | 0.525 | 1.5e-113 | |
| TAIR|locus:2173033 | 676 | AT5G52090 [Arabidopsis thalian | 0.130 | 0.495 | 0.497 | 5.5e-112 | |
| TAIR|locus:2152627 | 638 | AT5G37030 [Arabidopsis thalian | 0.108 | 0.437 | 0.556 | 8e-111 | |
| TAIR|locus:2166163 | 692 | AT5G37140 [Arabidopsis thalian | 0.123 | 0.458 | 0.523 | 4.8e-107 | |
| UNIPROTKB|F1NFZ0 | 2477 | TRANK1 "Uncharacterized protei | 0.251 | 0.262 | 0.299 | 1.6e-70 | |
| UNIPROTKB|B7WP88 | 2375 | TRANK1 "TPR and ankyrin repeat | 0.254 | 0.275 | 0.289 | 3.9e-61 |
| TAIR|locus:2018536 AT1G65780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1002 (357.8 bits), Expect = 7.6e-154, Sum P(3) = 7.6e-154
Identities = 253/664 (38%), Positives = 356/664 (53%)
Query: 421 SDVEIKPFLEFVRERFKCIAAPLRSCIFNFCTHIPKCYIGEDNFHVMATLISLLDSFETL 480
SD + F +++ E+F + L + CTH+P + M I L+ L
Sbjct: 420 SDTRPQSFQDYLPEKFSELRKDLDLHFSSLCTHLPTALLSSQAATRMYEAIDLVRDVTIL 479
Query: 481 LFEDNXXXXXXXXXXXXXXXXXXXXXIVDIKYLLHKRRSECHFVLRKLLSSFNEL-NLPS 539
D + E ++ KLL S E+ LP+
Sbjct: 480 AILDGVTGEGVKSVLIPNGEGSDRFSSQHVTV-------EDDYL--KLLRSIPEIFPLPA 530
Query: 540 AVEKDLLEDLLKRFCLKRASLFFSTASSSYMLHSVAMKPLNFLVIDEAAQLKESESTIPL 599
++ L+++L CL A L FSTAS S L++ P+ LVIDEAAQLKE ES+IP+
Sbjct: 531 VSDRHLIKEL----CLGHACLLFSTASCSARLYTGT--PIQLLVIDEAAQLKECESSIPM 584
Query: 600 QLSGIKHAVLFGDECQLPAMVESKVSDEACFGRSLFEXXXXXXXXXXXXXIQYRMHPSIS 659
QL G++H +L GDE QLPAMVES+++ EA FGRSLFE IQYRMH SIS
Sbjct: 585 QLPGLRHLILVGDERQLPAMVESQIALEAGFGRSLFERLALLGHKKYMLNIQYRMHCSIS 644
Query: 660 FFPNSYFYENKIHDSPTVEKRSYEKRFLPGPMYGPYSFINVFGGREEFIE---HSCRNMV 716
FPN Y KI D+PTV +R+Y K++LPG MYGPYSFIN+ GREE+ E S +N V
Sbjct: 645 SFPNKELYGKKILDAPTVRQRNYTKQYLPGEMYGPYSFINIAYGREEYGEGEGRSLKNNV 704
Query: 717 EVSVVMKILLNLYKGWINSKEKLSIGIVSPYIAQVAAIQEKLGSKYVNSAG--FAVKVMS 774
EV VV I+ NL + +K ++++G++SPY AQV AIQEK+ + AG F++++ +
Sbjct: 705 EVVVVAAIIANLLQVSEKTKTRINVGVISPYKAQVIAIQEKIQETSIGDAGGLFSLRIRT 764
Query: 775 VDGFQGGEEDIIIISTVRSNNGGSIGFISNPRRVNVALTRARHCLWILGNERTLTRNRSV 834
VDGFQGGEEDIII+STVRSN G +GF+ N RR NV LTRAR CLWILGNE TL ++SV
Sbjct: 765 VDGFQGGEEDIIIVSTVRSNGVGRVGFLGNRRRTNVLLTRARFCLWILGNEATLMNSKSV 824
Query: 835 WKALVDDAKARQCFFNADDDKDLGKSIXXXXXXXXXXXXXXXPGSTLFRSQRWKVNFSDN 894
W+ L+ DAK R CF +A +D+ L ++I P + +WK+ FSD
Sbjct: 825 WRNLIQDAKERGCFHSAGEDESLAQAIASTNIEFR-------P----LNNSKWKLCFSDE 873
Query: 895 FLKSFRKLTSDQTKKLVINLLLKLASGWRPEKRKVDSVCGSSLHIIKQFKVEGFY-IICT 953
F K ++ + +T + + N L +L+ GW E+ SS ++KQ K++ II
Sbjct: 874 FKKYVGEIKNPETYRKIKNFLERLSQGWLKEEETERENLVSSSQLLKQSKIDDVLRIIWA 933
Query: 954 IDIVKES-KYFQVLKVWDILPLENVQNLLTRLDNIFVKNLEVPKNWATTSNIVRFKGLAD 1012
+DI+KE Y QVLK+WD++P + L RLD + + K+ +G
Sbjct: 934 VDILKEDFHYDQVLKIWDVVPSSDAPEALKRLD---LNHTNYTKDEIEKCKARCIRG--- 987
Query: 1013 NEXXXXXXXXXXXXXXYAENSNVSDSLLLMKFYSLSLGVVRHLLSDRDARELDLPFEVTD 1072
+ E S+V S ++K + SL +V +LS + + P EV
Sbjct: 988 -DIVVPMRWSIESTNGIPEKSSVVCSSDVIKTFG-SLNLVGEMLSSVPSNDSVEPLEVEK 1045
Query: 1073 EQLD 1076
E+ D
Sbjct: 1046 EEQD 1049
|
|
| TAIR|locus:2018561 AT1G65810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166173 AT5G37150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135472 AT4G05540 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166183 AT5G37160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173033 AT5G52090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2152627 AT5G37030 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2166163 AT5G37140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NFZ0 TRANK1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7WP88 TRANK1 "TPR and ankyrin repeat-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.6.4 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00013394001 | SubName- Full=Chromosome undetermined scaffold_473, whole genome shotgun sequence; (2586 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 2576 | |||
| pfam13087 | 195 | pfam13087, AAA_12, AAA domain | 6e-73 | |
| COG1112 | 767 | COG1112, COG1112, Superfamily I DNA and RNA helica | 6e-40 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 1e-39 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 2e-12 | |
| pfam13086 | 220 | pfam13086, AAA_11, AAA domain | 5e-11 | |
| COG0210 | 655 | COG0210, UvrD, Superfamily I DNA and RNA helicases | 1e-06 | |
| COG1074 | 1139 | COG1074, RecB, ATP-dependent exoDNAse (exonuclease | 5e-05 | |
| pfam00580 | 267 | pfam00580, UvrD-helicase, UvrD/REP helicase N-term | 8e-05 | |
| pfam13245 | 73 | pfam13245, AAA_19, Part of AAA domain | 8e-05 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 6e-04 | |
| TIGR00376 | 637 | TIGR00376, TIGR00376, DNA helicase, putative | 7e-04 |
| >gnl|CDD|221913 pfam13087, AAA_12, AAA domain | Back alignment and domain information |
|---|
Score = 241 bits (618), Expect = 6e-73
Identities = 86/197 (43%), Positives = 114/197 (57%), Gaps = 6/197 (3%)
Query: 630 FGRSLFERLSHL-RHSKHLLSIQYRMHPSISFFPNSYFYENKIHDSPTVEKRSYEKRFLP 688
RSLFERL + +L QYRMHP IS FP+ FY K+ D +V +R F
Sbjct: 1 LDRSLFERLQEAGPEAVVMLDTQYRMHPDISEFPSELFYGGKLKDGESVAERPLPWDFHL 60
Query: 689 GPMYGPYSFINVFGGREEF-IEHSCRNMVEVSVVMKILLNLYKGWINSKEKLSIGIVSPY 747
GP FI+V G EE S N E +V++++ L K + IGI++PY
Sbjct: 61 PDPLGPLVFIDVDGSEEEEEKSTSYSNEAEAELVVQLVEKLLKSGPEKNKD--IGIITPY 118
Query: 748 IAQVAAIQEKLGSKYVNSAGFAVKVMSVDGFQGGEEDIIIISTVRSNNGGSIGFISNPRR 807
AQV I++ L K+ ++V +VDGFQG E+D+II STVRSN G IGF+S+PRR
Sbjct: 119 RAQVRLIKKLLKRKFGGEPD--IEVNTVDGFQGREKDVIIFSTVRSNEKGGIGFLSDPRR 176
Query: 808 VNVALTRARHCLWILGN 824
+NVALTRA+ L I+GN
Sbjct: 177 LNVALTRAKRGLIIVGN 193
|
This family of domains contain a P-loop motif that is characteristic of the AAA superfamily. Many of the proteins in this family are conjugative transfer proteins. Length = 195 |
| >gnl|CDD|224037 COG1112, COG1112, Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|221912 pfam13086, AAA_11, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|223288 COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|224000 COG1074, RecB, ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|216004 pfam00580, UvrD-helicase, UvrD/REP helicase N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|222005 pfam13245, AAA_19, Part of AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|232945 TIGR00376, TIGR00376, DNA helicase, putative | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2576 | |||
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 100.0 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 100.0 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 100.0 | |
| KOG1801 | 827 | consensus tRNA-splicing endonuclease positive effe | 100.0 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 100.0 | |
| KOG1807 | 1025 | consensus Helicases [Replication, recombination an | 100.0 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 100.0 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 100.0 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 100.0 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 100.0 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 100.0 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 100.0 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 100.0 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 100.0 | |
| COG1112 | 767 | Superfamily I DNA and RNA helicases and helicase s | 100.0 | |
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 100.0 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 100.0 | |
| PRK13909 | 910 | putative recombination protein RecB; Provisional | 100.0 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 100.0 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 100.0 | |
| PF13087 | 200 | AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP | 99.97 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 99.96 | |
| KOG1806 | 1320 | consensus DEAD box containing helicases [Replicati | 99.94 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 99.94 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 99.92 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 99.92 | |
| TIGR02773 | 1158 | addB_Gpos ATP-dependent nuclease subunit B. DNA re | 99.86 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 99.82 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 99.81 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 99.81 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 99.79 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 99.79 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 99.76 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 99.76 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 99.75 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 99.73 | |
| KOG1803 | 649 | consensus DNA helicase [Replication, recombination | 99.73 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 99.68 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 99.61 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 99.61 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 99.6 | |
| PF13361 | 351 | UvrD_C: UvrD-like helicase C-terminal domain; PDB: | 99.6 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 99.59 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 99.59 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 99.57 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 99.57 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 99.55 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 99.47 | |
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 99.46 | |
| KOG1802 | 935 | consensus RNA helicase nonsense mRNA reducing fact | 99.45 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 99.43 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 99.41 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 99.41 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 99.4 | |
| PRK13909 | 910 | putative recombination protein RecB; Provisional | 99.39 | |
| KOG1805 | 1100 | consensus DNA replication helicase [Replication, r | 99.39 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 99.39 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 99.38 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 99.35 | |
| PRK10876 | 1181 | recB exonuclease V subunit beta; Provisional | 99.35 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 99.34 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 99.3 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 99.25 | |
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 99.24 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 99.23 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 99.22 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 99.21 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 99.2 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 99.12 | |
| TIGR02774 | 1076 | rexB_recomb ATP-dependent nuclease subunit B. DNA | 99.05 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 99.02 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 98.99 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 98.99 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 98.97 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 98.95 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 98.87 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 98.84 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 98.81 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 98.8 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 98.76 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 98.73 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 98.73 | |
| PF13538 | 104 | UvrD_C_2: UvrD-like helicase C-terminal domain; PD | 98.71 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 98.7 | |
| PF13087 | 200 | AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP | 98.67 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 98.51 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 98.48 | |
| KOG1920 | 1265 | consensus IkappaB kinase complex, IKAP component [ | 98.42 | |
| KOG2108 | 853 | consensus 3'-5' DNA helicase [Replication, recombi | 98.39 | |
| KOG1807 | 1025 | consensus Helicases [Replication, recombination an | 98.34 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 98.33 | |
| COG3857 | 1108 | AddB ATP-dependent nuclease, subunit B [DNA replic | 98.32 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 98.25 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 98.23 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 98.16 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 98.03 | |
| KOG1920 | 1265 | consensus IkappaB kinase complex, IKAP component [ | 98.03 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 97.98 | |
| COG1112 | 767 | Superfamily I DNA and RNA helicases and helicase s | 97.94 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 97.9 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.75 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 97.72 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 97.69 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 97.63 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 97.56 | |
| KOG1806 | 1320 | consensus DEAD box containing helicases [Replicati | 97.54 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 97.52 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 97.52 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 97.45 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.45 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.44 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 97.43 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.41 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 97.4 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 97.35 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 97.35 | |
| KOG1804 | 775 | consensus RNA helicase [RNA processing and modific | 97.27 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 97.26 | |
| COG0507 | 696 | RecD ATP-dependent exoDNAse (exonuclease V), alpha | 97.24 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 97.24 | |
| PF13538 | 104 | UvrD_C_2: UvrD-like helicase C-terminal domain; PD | 97.18 | |
| TIGR02773 | 1158 | addB_Gpos ATP-dependent nuclease subunit B. DNA re | 97.18 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 97.15 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 97.09 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 97.06 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 97.04 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 96.99 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 96.99 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 96.97 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 96.96 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 96.9 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 96.9 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 96.89 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 96.82 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 96.81 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 96.72 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 96.66 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.58 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.47 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 96.41 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 96.37 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 96.33 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 96.33 | |
| TIGR03623 | 874 | probable DNA repair protein. Members of this prote | 96.27 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 96.27 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.27 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 96.26 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 96.22 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.18 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 96.16 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 96.09 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.04 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 96.0 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 95.97 | |
| PRK06526 | 254 | transposase; Provisional | 95.92 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 95.91 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 95.9 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 95.89 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 95.89 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 95.83 | |
| PRK08181 | 269 | transposase; Validated | 95.78 | |
| COG5290 | 1243 | IkappaB kinase complex, IKAP component [Transcript | 95.72 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 95.71 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 95.7 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 95.69 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 95.67 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 95.66 | |
| KOG0276 | 794 | consensus Vesicle coat complex COPI, beta' subunit | 95.65 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 95.63 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 95.57 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.55 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 95.54 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 95.52 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 95.51 | |
| KOG1801 | 827 | consensus tRNA-splicing endonuclease positive effe | 95.46 | |
| PRK08116 | 268 | hypothetical protein; Validated | 95.43 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.43 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 95.41 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 95.4 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 95.37 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 95.36 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 95.3 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 95.3 | |
| PRK08727 | 233 | hypothetical protein; Validated | 95.26 | |
| COG5290 | 1243 | IkappaB kinase complex, IKAP component [Transcript | 95.26 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 95.24 | |
| KOG2247 | 615 | consensus WD40 repeat-containing protein [General | 95.23 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 95.21 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 95.18 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.14 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.12 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 95.12 | |
| PF13361 | 351 | UvrD_C: UvrD-like helicase C-terminal domain; PDB: | 95.11 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 95.11 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 95.08 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 95.07 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 95.06 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 95.03 | |
| KOG2247 | 615 | consensus WD40 repeat-containing protein [General | 95.01 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 95.0 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 94.97 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 94.9 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 94.89 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 94.84 | |
| PF04840 | 319 | Vps16_C: Vps16, C-terminal region; InterPro: IPR00 | 94.78 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 94.76 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 94.74 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 94.73 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 94.72 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 94.71 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 94.58 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 94.54 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 94.46 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 94.44 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 94.44 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 94.41 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 94.4 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 94.4 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 94.4 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 94.34 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 94.34 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 94.33 | |
| smart00299 | 140 | CLH Clathrin heavy chain repeat homology. | 94.31 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 94.29 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 94.28 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 94.27 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 94.23 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 94.2 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 94.17 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 94.16 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 94.1 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 94.09 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 94.0 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 93.94 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 93.93 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 93.91 | |
| PRK13768 | 253 | GTPase; Provisional | 93.89 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 93.86 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 93.81 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 93.77 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 93.76 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 93.75 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 93.74 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 93.73 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 93.69 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 93.68 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 93.67 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 93.64 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 93.62 | |
| KOG2280 | 829 | consensus Vacuolar assembly/sorting protein VPS16 | 93.59 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 93.55 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 93.52 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 93.51 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 93.51 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 93.49 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 93.49 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 93.48 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 93.48 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 93.36 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 93.31 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 93.3 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 93.28 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 93.28 | |
| PF03308 | 266 | ArgK: ArgK protein; InterPro: IPR005129 Bacterial | 93.28 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 93.24 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 93.19 | |
| PHA02624 | 647 | large T antigen; Provisional | 93.18 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 93.18 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 93.14 | |
| PF04840 | 319 | Vps16_C: Vps16, C-terminal region; InterPro: IPR00 | 93.14 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 93.14 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 93.13 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 93.13 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 93.12 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 93.12 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 93.11 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 93.03 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 93.0 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 92.99 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 92.97 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 92.94 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 92.91 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 92.87 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 92.84 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 92.83 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.83 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 92.82 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 92.77 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 92.73 | |
| PF13173 | 128 | AAA_14: AAA domain | 92.67 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 92.66 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 92.59 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 92.57 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 92.57 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 92.56 | |
| PRK07667 | 193 | uridine kinase; Provisional | 92.56 | |
| cd01125 | 239 | repA Hexameric Replicative Helicase RepA. RepA is | 92.54 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 92.53 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 92.45 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 92.36 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 92.36 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 92.36 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 92.36 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 92.35 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 92.34 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 92.31 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 92.3 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 92.3 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 92.23 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 92.22 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 92.2 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 92.18 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 92.18 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 92.12 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 92.12 | |
| PHA02774 | 613 | E1; Provisional | 92.11 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 92.1 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 92.1 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 92.09 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 92.08 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 92.04 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 92.02 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 92.02 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 92.0 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 91.99 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 91.98 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 91.95 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 91.94 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 91.91 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 91.91 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 91.88 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 91.87 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 91.86 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 91.79 | |
| PRK06620 | 214 | hypothetical protein; Validated | 91.78 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 91.73 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 91.73 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 91.71 | |
| COG1703 | 323 | ArgK Putative periplasmic protein kinase ArgK and | 91.69 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 91.66 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 91.66 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 91.65 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 91.65 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 91.64 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 91.61 | |
| PF05729 | 166 | NACHT: NACHT domain | 91.52 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 91.51 | |
| PRK06696 | 223 | uridine kinase; Validated | 91.49 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 91.44 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 91.43 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 91.43 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 91.42 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 91.41 | |
| PTZ00424 | 401 | helicase 45; Provisional | 91.37 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 91.36 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 91.29 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 91.27 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 91.25 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 91.22 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 91.08 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 91.07 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 91.04 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 90.98 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 90.97 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 90.93 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 90.92 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 90.8 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 90.78 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 90.77 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 90.75 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 90.74 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 90.7 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 90.69 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 90.63 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 90.52 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 90.5 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 90.46 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 90.44 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 90.37 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 90.26 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 90.25 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 90.21 | |
| PRK13764 | 602 | ATPase; Provisional | 90.18 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 90.14 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 90.11 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 90.1 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 90.09 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 90.07 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 90.07 | |
| cd02034 | 116 | CooC The accessory protein CooC, which contains a | 90.05 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 90.05 | |
| PTZ00424 | 401 | helicase 45; Provisional | 90.03 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 90.03 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 89.98 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 89.98 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 89.86 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 89.79 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 89.77 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 89.73 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 89.72 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 89.67 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 89.65 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 89.65 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 89.63 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 89.61 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 89.59 | |
| PRK04301 | 317 | radA DNA repair and recombination protein RadA; Va | 89.57 | |
| PF05127 | 177 | Helicase_RecD: Helicase; InterPro: IPR007807 This | 89.53 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 89.52 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 89.48 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 89.47 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 89.46 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 89.45 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 89.42 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 89.39 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 89.36 | |
| cd02117 | 212 | NifH_like This family contains the NifH (iron prot | 89.24 | |
| PRK09302 | 509 | circadian clock protein KaiC; Reviewed | 89.18 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 89.17 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 89.11 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 89.09 | |
| PHA02244 | 383 | ATPase-like protein | 89.09 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 89.09 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 89.09 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 88.99 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 88.98 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 88.95 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 88.94 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 88.87 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 88.86 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 88.85 | |
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 88.8 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 88.77 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 88.71 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 88.68 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 88.65 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 88.64 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 88.64 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 88.62 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 88.58 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 88.58 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 88.58 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 88.56 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 88.56 | |
| cd00550 | 254 | ArsA_ATPase Oxyanion-translocating ATPase (ArsA). | 88.54 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 88.52 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 88.46 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 88.46 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 88.45 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 88.45 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 88.39 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 88.39 | |
| TIGR02236 | 310 | recomb_radA DNA repair and recombination protein R | 88.39 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 88.33 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 88.31 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 88.3 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 88.17 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 88.15 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 88.13 | |
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 88.11 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 88.1 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 88.09 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 88.08 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 88.04 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 88.02 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 87.99 | |
| PRK09087 | 226 | hypothetical protein; Validated | 87.96 | |
| cd02035 | 217 | ArsA ArsA ATPase functionas as an efflux pump loca | 87.93 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 87.91 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 87.89 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 87.83 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 87.79 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 87.79 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 87.77 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 87.73 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 87.69 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 87.61 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 87.6 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 87.55 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 87.55 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 87.54 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 87.51 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 87.45 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 87.36 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 87.35 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 87.3 | |
| PRK09694 | 878 | helicase Cas3; Provisional | 87.3 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 87.19 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 87.13 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 87.13 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 87.13 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 87.12 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 87.06 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 87.01 | |
| PRK01172 | 674 | ski2-like helicase; Provisional | 87.01 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 86.98 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 86.98 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 86.93 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 86.92 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 86.86 |
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.3e-66 Score=633.51 Aligned_cols=296 Identities=35% Similarity=0.489 Sum_probs=263.2
Q ss_pred HHHHHhcCCcEEEEccccchhhhhccCCCCCEEEEEcCCCCChhHHhhhccccCcceEEEecCCCCCCccccccchhhhh
Q 000053 550 LKRFCLKRASLFFSTASSSYMLHSVAMKPLNFLVIDEAAQLKESESTIPLQLSGIKHAVLFGDECQLPAMVESKVSDEAC 629 (2576)
Q Consensus 550 i~~~~l~~a~VI~~T~sss~~l~~~~~~~fD~VIIDEAsQ~~e~e~lipL~l~~~k~vILVGD~~QLpPvv~s~~~~~~~ 629 (2576)
.++.++.+|+||+|||.+++.... ....|..|+||||.|.+||++++|+.+ +++++||||||+||+|++..+.+..++
T Consensus 541 ~e~ell~~AdVIccTcv~Agd~rl-~~~kfr~VLiDEaTQatEpe~LiPlvl-G~kq~VlVGDh~QLgpvi~~kK~a~Ag 618 (935)
T KOG1802|consen 541 AEKELLNQADVICCTCVGAGDRRL-SKFKFRTVLIDEATQATEPECLIPLVL-GAKQLVLVGDHKQLGPVIMCKKAATAG 618 (935)
T ss_pred HHHHHHhhcCEEEEecccccchhh-ccccccEEEEecccccCCcchhhhhhh-cceeEEEeccccccCceeeeHHHHHhH
Confidence 667788999999999998776433 335799999999999999999999987 899999999999999999999999999
Q ss_pred ccccHHHHHhhccCCccccccccccCcccccccccccccCcccCCccccccccccccCCCCCCC-CcEEEEccCCcccc-
Q 000053 630 FGRSLFERLSHLRHSKHLLSIQYRMHPSISFFPNSYFYENKIHDSPTVEKRSYEKRFLPGPMYG-PYSFINVFGGREEF- 707 (2576)
Q Consensus 630 ~~~SLfeRL~~~g~~~~~L~~qYRmhp~I~~f~n~~fY~g~L~~~~~~~~~~~~~~~~~~~~~~-~~~fidv~~g~e~~- 707 (2576)
+.+||||||+..|+.+++|.+||||||.|++||+..||+|.|.++.....+......+|.|... |+.|... .|.|+.
T Consensus 619 l~qsLferli~lg~~P~~L~vQYRmhP~lSefpsn~fY~G~LqnGVT~~~R~~~g~~~pwp~p~~pl~fy~~-~g~eeis 697 (935)
T KOG1802|consen 619 LSQSLFERLISLGIKPIRLQVQYRMHPALSEFPSNMFYEGELQNGVTEIERSPLGVDFPWPQPDKPLFFYVC-YGQEEIS 697 (935)
T ss_pred HHHHHHHHHHhccCCceEEEEeeeeChhhhhcchhhhccchhhcCcchhhhccCCCCCCCCCCCCccceEEe-ccceeee
Confidence 9999999999999999999999999999999999999999999999888887766666665444 5556555 666655
Q ss_pred -ccccccCHHHHHHHHHHHHHHHhcccCCCCCCeEEEEcccHHHHHHHHHHhccccccCC--CCceEEccCCCCCCccCC
Q 000053 708 -IEHSCRNMVEVSVVMKILLNLYKGWINSKEKLSIGIVSPYIAQVAAIQEKLGSKYVNSA--GFAVKVMSVDGFQGGEED 784 (2576)
Q Consensus 708 -~~~S~~N~~Ea~~v~~lv~~L~~~~~~~~~~~sIgIITPY~aQv~~I~~~L~~~~~~~~--~~~v~V~TVd~fQG~E~D 784 (2576)
.|+|+.|..||..+.+++..|++.+. .+..|||||||.+|+..|-+.++..-.... ...|.|.|||+|||+|+|
T Consensus 698 asGtSf~Nr~Ea~~~ekii~~l~~~gv---~~~qIGVITpYegQr~~i~~ym~~~gsl~~~ly~~veVasVDaFQGrEKd 774 (935)
T KOG1802|consen 698 ASGTSFLNRTEAANCEKIITKLLKSGV---KPSQIGVITPYEGQRSYIVNYMQTNGSLHKDLYKEVEVASVDAFQGREKD 774 (935)
T ss_pred ccccceecHHHHHHHHHHHHHHHHcCC---CHHHeeeecccchhHHHHHHHHHhcCccccchhheeEEEeeccccCcccc
Confidence 78999999999999999999999875 778999999999999999998854211111 136799999999999999
Q ss_pred EEEEEcccCCCCCccccCCCCCceEEecccccccEEEEechhhhhcCchHHHHHHHHHHhcCceeccC
Q 000053 785 IIIISTVRSNNGGSIGFISNPRRVNVALTRARHCLWILGNERTLTRNRSVWKALVDDAKARQCFFNAD 852 (2576)
Q Consensus 785 iVIlS~Vrs~~~~~~gFl~d~~RlNVAlTRAR~~LiIVGn~~~L~~~~~~W~~li~~~~~r~~~~~~~ 852 (2576)
+||+||||+|....+||+.|++|+|||+||||++|+||||+..|.++ ++|..+|.++++++|++..+
T Consensus 775 fIIlSCVRsn~~qgIGFl~d~RRlNVaLTRaK~glvivGN~~~L~k~-~LW~~li~h~~eke~l~eg~ 841 (935)
T KOG1802|consen 775 FIILSCVRSNEHQGIGFLNDPRRLNVALTRAKYGLVIVGNPKVLRKH-PLWGHLITHYKEKEVLVEGP 841 (935)
T ss_pred eEEEEEeecccccccccccCchhhhhhhhhcccceEEecCHHHhhhc-hHHHHHHHHhhcccceeecc
Confidence 99999999999999999999999999999999999999999999995 99999999999999998753
|
|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1807 consensus Helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13909 putative recombination protein RecB; Provisional | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >TIGR02773 addB_Gpos ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1803 consensus DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PRK13909 putative recombination protein RecB; Provisional | Back alignment and domain information |
|---|
| >KOG1805 consensus DNA replication helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >PRK10876 recB exonuclease V subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >TIGR02774 rexB_recomb ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >PF13087 AAA_12: AAA domain; PDB: 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A 2XZL_A | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >KOG2108 consensus 3'-5' DNA helicase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1807 consensus Helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >COG3857 AddB ATP-dependent nuclease, subunit B [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1112 Superfamily I DNA and RNA helicases and helicase subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >KOG1804 consensus RNA helicase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PF13538 UvrD_C_2: UvrD-like helicase C-terminal domain; PDB: 1W36_G 3K70_G 3DMN_A 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >TIGR02773 addB_Gpos ATP-dependent nuclease subunit B | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR03623 probable DNA repair protein | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >COG5290 IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1801 consensus tRNA-splicing endonuclease positive effector (SEN1) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG5290 IkappaB kinase complex, IKAP component [Transcription] | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >KOG2247 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PF13361 UvrD_C: UvrD-like helicase C-terminal domain; PDB: 1UAA_B 3U4Q_A 3U44_A 1W36_B 3K70_B 2IS6_B 3LFU_A 2IS2_B 2IS1_B 2IS4_A | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >KOG2247 consensus WD40 repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >smart00299 CLH Clathrin heavy chain repeat homology | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >cd01125 repA Hexameric Replicative Helicase RepA | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04301 radA DNA repair and recombination protein RadA; Validated | Back alignment and domain information |
|---|
| >PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK09302 circadian clock protein KaiC; Reviewed | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >TIGR02236 recomb_radA DNA repair and recombination protein RadA | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 2576 | ||||
| 2xzl_A | 802 | Upf1-Rna Complex Length = 802 | 6e-38 | ||
| 2wjv_A | 800 | Crystal Structure Of The Complex Between Human Nons | 9e-35 | ||
| 2xzo_A | 623 | Upf1 Helicase - Rna Complex Length = 623 | 1e-34 | ||
| 2gjk_A | 624 | Structural And Functional Insights Into The Human U | 1e-34 | ||
| 4b3f_X | 646 | Crystal Structure Of 1ghmbp2 Helicase Length = 646 | 5e-22 | ||
| 4b3g_A | 646 | Crystal Structure Of Ighmbp2 Helicase In Complex Wi | 6e-22 | ||
| 1qhh_B | 273 | Structure Of Dna Helicase With Adpnp Length = 273 | 2e-04 | ||
| 2pjr_A | 548 | Helicase Product Complex Length = 548 | 5e-04 | ||
| 3pjr_A | 724 | Helicase Substrate Complex Length = 724 | 8e-04 |
| >pdb|2XZL|A Chain A, Upf1-Rna Complex Length = 802 | Back alignment and structure |
|
| >pdb|2WJV|A Chain A, Crystal Structure Of The Complex Between Human Nonsense Mediated Decay Factors Upf1 And Upf2 Length = 800 | Back alignment and structure |
| >pdb|2XZO|A Chain A, Upf1 Helicase - Rna Complex Length = 623 | Back alignment and structure |
| >pdb|2GJK|A Chain A, Structural And Functional Insights Into The Human Upf1 Helicase Core Length = 624 | Back alignment and structure |
| >pdb|4B3F|X Chain X, Crystal Structure Of 1ghmbp2 Helicase Length = 646 | Back alignment and structure |
| >pdb|4B3G|A Chain A, Crystal Structure Of Ighmbp2 Helicase In Complex With Rna Length = 646 | Back alignment and structure |
| >pdb|1QHH|B Chain B, Structure Of Dna Helicase With Adpnp Length = 273 | Back alignment and structure |
| >pdb|2PJR|A Chain A, Helicase Product Complex Length = 548 | Back alignment and structure |
| >pdb|3PJR|A Chain A, Helicase Substrate Complex Length = 724 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
Score = 346 bits (889), Expect = e-101
Identities = 115/368 (31%), Positives = 179/368 (48%), Gaps = 15/368 (4%)
Query: 495 LSHSVDEDLSESIVDI--KYLLHKRRSECHFVLRKLLSSFNELNLPSAVEKDLLEDLLKR 552
L+ ED+ S+ ++ L+ + L KL EL+ L +
Sbjct: 434 LTAKSREDVESSVSNLALHNLVGRGAKGELKNLLKLKDEVGELSASDTKRFVKLVRKTEA 493
Query: 553 FCLKRASLFFSTASSSYMLHSVAMKPLNFLVIDEAAQLKESESTIPLQLSGIKHAVLFGD 612
L +A + T + ++IDE+ Q E E IP+ + G K +L GD
Sbjct: 494 EILNKADVVCCTCVGAG--DKRLDTKFRTVLIDESTQASEPECLIPI-VKGAKQVILVGD 550
Query: 613 ECQLPAMVESKVSDEACFGRSLFERLSHLRHSKHLLSIQYRMHPSISFFPNSYFYENKIH 672
QL ++ + + +A +SLFERL L H L +QYRM+P +S FP++ FYE +
Sbjct: 551 HQQLGPVILERKAADAGLKQSLFERLISLGHVPIRLEVQYRMNPYLSEFPSNMFYEGSLQ 610
Query: 673 DSPTVEKRSYEKRFLPGPMYG-PYSFINVFGGREEFIE--HSCRNMVEVSVVMKILLNLY 729
+ T+E+R+ P P+ G P F + GREE S N +E +I+ L+
Sbjct: 611 NGVTIEQRTVPNSKFPWPIRGIPMMFWANY-GREEISANGTSFLNRIEAMNCERIITKLF 669
Query: 730 KGWINSKEKLSIGIVSPYIAQVAAIQEKLGSKYV--NSAGFAVKVMSVDGFQGGEEDIII 787
+ + + IG+++PY Q A I + + V+V SVD FQG E+D II
Sbjct: 670 RDGVKPE---QIGVITPYEGQRAYILQYMQMNGSLDKDLYIKVEVASVDAFQGREKDYII 726
Query: 788 ISTVRSNNGGSIGFISNPRRVNVALTRARHCLWILGNERTLTRNRSVWKALVDDAKARQC 847
+S VR+N +IGF+ +PRR+NV LTRA++ L ILGN R+L RN ++W L+ + + C
Sbjct: 727 LSCVRANEQQAIGFLRDPRRLNVGLTRAKYGLVILGNPRSLARN-TLWNHLLIHFREKGC 785
Query: 848 FFNADDDK 855
D
Sbjct: 786 LVEGTLDN 793
|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Length = 802 | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Length = 624 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Length = 800 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Length = 446 | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Length = 1180 | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Length = 1232 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2576 | |||
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 100.0 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 100.0 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 100.0 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 100.0 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 100.0 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 100.0 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 100.0 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 100.0 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 100.0 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 99.95 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 99.91 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 99.89 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 99.88 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 99.87 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 99.85 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 99.85 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 99.83 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 99.77 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 99.77 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 99.73 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 99.71 | |
| 3dmn_A | 174 | Putative DNA helicase; APC89291.2, lactobacillus p | 99.7 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 99.61 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 99.6 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 99.6 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 99.48 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 99.41 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 99.08 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 98.98 | |
| 3dmn_A | 174 | Putative DNA helicase; APC89291.2, lactobacillus p | 98.87 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 98.5 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.48 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 98.39 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 98.34 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 98.19 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 98.07 | |
| 1w36_C | 1122 | RECC, exodeoxyribonuclease V gamma chain; recombin | 98.03 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 98.03 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 97.95 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.95 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 97.92 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.89 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.87 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.84 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 97.79 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 97.72 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.71 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 97.71 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 97.7 | |
| 3mkq_B | 177 | Coatomer subunit alpha; beta-propeller, alpha-sole | 97.69 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 97.69 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 97.68 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 97.66 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 97.64 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.59 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.53 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 97.5 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 97.46 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.43 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 97.32 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.3 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 97.29 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 97.28 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 97.27 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 97.25 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.23 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 97.23 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.19 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 97.16 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 97.12 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 97.07 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 97.06 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 97.05 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 97.01 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 97.01 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 96.99 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 96.84 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 96.84 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 96.77 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 96.71 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 96.69 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 96.6 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 96.56 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 96.56 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.39 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 96.39 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 96.35 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 96.31 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 96.26 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 96.12 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 96.06 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 96.03 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 96.0 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 95.96 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 95.87 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.85 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 95.8 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 95.67 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 95.49 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 95.45 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 95.43 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 95.42 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 95.42 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 95.38 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 95.36 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 95.33 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 95.32 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 95.31 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 95.3 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 95.3 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 95.28 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 95.28 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 95.26 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 95.25 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 95.24 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 95.24 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 95.23 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 95.23 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 95.21 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 95.19 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 95.19 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 95.18 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 95.16 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 95.13 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 95.01 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 95.01 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 95.01 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 94.93 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 94.89 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 94.85 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 94.83 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 94.79 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 94.77 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 94.73 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 94.69 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 94.64 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 94.6 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 94.58 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 94.57 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 94.55 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 94.55 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 94.51 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 94.45 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 94.45 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 94.44 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 94.38 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 94.32 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 94.32 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 94.31 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 94.22 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 94.21 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 94.2 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 94.18 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 94.18 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 94.08 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 94.07 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 94.05 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 94.01 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 94.0 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 93.99 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 93.96 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 93.93 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 93.91 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 93.89 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 93.88 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 93.86 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 93.85 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 93.83 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 93.82 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 93.79 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 93.77 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 93.77 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 93.75 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 93.74 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 93.72 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 93.69 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 93.69 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 93.67 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 93.65 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 93.64 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 93.59 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 93.57 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 93.55 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 93.54 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 93.52 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 93.47 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 93.46 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 93.45 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 93.43 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 93.41 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 93.39 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 93.39 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 93.38 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 93.37 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 93.37 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 93.33 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 93.31 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 93.31 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 93.31 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 93.3 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 93.27 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 93.27 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 93.27 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 93.26 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 93.24 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 93.21 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 93.19 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 93.18 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 93.17 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 93.14 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 93.11 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 93.11 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 93.11 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 93.1 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 93.1 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 93.09 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 93.07 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 93.01 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 92.94 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 92.89 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 92.73 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 92.65 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 92.65 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 92.59 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 92.58 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 92.58 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 92.55 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 92.49 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 92.45 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 92.43 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 92.37 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 92.37 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 92.36 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 92.32 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 92.3 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 92.28 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 92.26 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 92.17 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 92.17 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 92.16 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 92.16 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 92.13 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 92.01 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 92.0 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 91.98 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 91.97 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 91.94 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 91.93 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 91.92 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 91.91 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 91.88 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 91.87 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 91.87 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 91.85 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 91.85 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 91.82 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 91.8 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 91.8 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 91.77 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 91.7 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 91.69 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 91.65 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 91.65 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 91.65 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 91.64 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 91.63 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 91.6 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 91.6 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 91.59 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 91.59 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 91.59 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 91.56 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 91.49 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 91.49 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 91.48 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 91.43 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 91.41 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 91.38 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 91.38 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 91.38 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 91.33 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 91.33 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 91.29 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 91.28 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 91.25 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 91.24 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 91.24 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 91.23 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 91.2 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 91.19 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 91.14 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 91.13 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 91.13 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 91.12 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 91.11 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 91.11 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 91.09 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 91.08 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 91.08 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 91.07 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 91.06 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 91.03 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 91.03 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 91.01 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 91.0 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 90.98 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 90.97 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 90.96 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 90.92 | |
| 3ug7_A | 349 | Arsenical pump-driving ATPase; tail-anchored, memb | 90.89 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 90.84 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 90.82 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 90.81 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 90.78 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 90.77 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 90.73 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 90.73 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 90.72 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 90.7 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 90.7 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 90.69 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 90.64 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 90.63 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 90.62 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 90.59 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 90.58 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 90.51 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 90.48 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 90.46 | |
| 3zq6_A | 324 | Putative arsenical pump-driving ATPase; tail-ancho | 90.41 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 90.33 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 90.27 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 90.25 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 90.24 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 90.19 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 90.14 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 90.14 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 90.12 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 90.12 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 89.97 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 89.92 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 89.92 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 89.91 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 89.91 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 89.9 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 89.85 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 89.82 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 89.8 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 89.77 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 89.54 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 89.53 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 89.48 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 89.47 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 89.42 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 89.41 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 89.39 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 89.36 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 89.35 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 89.34 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 89.32 | |
| 2wpv_A | 312 | GET4, UPF0363 protein YOR164C; golgi-ER traffickin | 89.17 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 89.16 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 89.1 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 89.1 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 89.09 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 89.08 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 89.05 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 89.02 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 88.99 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 88.97 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 88.89 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 88.88 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 88.86 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 88.86 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 88.81 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 88.79 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 88.7 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 88.61 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 88.46 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 88.43 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 88.39 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 88.36 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 88.35 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 88.3 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 88.3 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 88.26 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 88.21 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 88.15 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 88.03 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 88.01 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 87.87 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 87.86 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 87.83 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 87.8 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 87.57 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 87.53 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 87.53 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 87.52 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 87.51 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 87.37 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 87.37 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 87.34 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 87.31 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 87.29 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 87.09 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 87.03 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 87.01 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 86.99 | |
| 1ihu_A | 589 | Arsenical pump-driving ATPase; aluminum fluoride, | 86.97 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 86.9 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 86.89 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 86.74 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 86.73 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 86.7 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 86.68 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 86.58 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 86.56 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 86.55 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 86.42 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 86.41 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 86.39 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 86.34 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 86.31 | |
| 3bfv_A | 271 | CAPA1, CAPB2, membrane protein CAPA1, protein tyro | 86.31 | |
| 4g26_A | 501 | Pentatricopeptide repeat-containing protein AT2G3 | 86.24 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 86.24 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 86.23 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 86.22 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 86.21 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 86.16 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 86.13 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 86.12 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 86.05 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 86.05 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 86.04 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 85.94 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 85.75 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 85.72 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 85.66 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 85.63 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 85.63 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 85.6 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 85.58 | |
| 2qx5_A | 661 | Nucleoporin NIC96; mRNA transport, nuclear pore co | 85.45 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 85.42 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 85.4 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 85.38 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 85.37 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 85.36 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 85.3 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 85.26 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 85.23 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 85.18 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 85.15 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 85.1 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 85.1 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 85.01 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 85.0 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 84.94 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 84.89 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 84.86 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 84.85 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 84.84 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 84.82 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 84.76 | |
| 3cio_A | 299 | ETK, tyrosine-protein kinase ETK; WZC, escherichia | 84.68 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 84.67 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 84.66 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 84.63 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 84.59 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 84.58 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 84.55 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 84.52 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 84.51 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 84.44 | |
| 3iqw_A | 334 | Tail-anchored protein targeting factor GET3; ATPas | 84.43 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 84.37 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 84.31 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 84.3 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 84.14 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 84.08 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 84.0 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 83.95 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 83.95 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 83.92 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 83.89 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 83.72 | |
| 3kjh_A | 254 | CO dehydrogenase/acetyl-COA synthase complex, acce | 83.62 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 83.6 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 83.57 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 83.52 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 83.51 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 83.46 | |
| 2woo_A | 329 | ATPase GET3; tail-anchored, membrane protein, targ | 83.45 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 83.36 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 83.35 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 83.34 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 83.33 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 83.33 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 83.23 |
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.1e-65 Score=696.86 Aligned_cols=574 Identities=25% Similarity=0.325 Sum_probs=395.4
Q ss_pred CChhHHHhhchhhHHHHHHHHHHhhhhcccCCCceE-------EE--EEe--ccCCCCCceEEEEEcccccccCCCCCCc
Q 000053 54 RSVGQYFESFVFPLLEETRANLMSGMEKISNAPFAQ-------VV--AFE--DSKPYGSMLYDVKVDCWRNRFSNLGREP 122 (2576)
Q Consensus 54 ~s~~~Y~~sf~~~LlEEtra~l~Ssl~~is~ap~~~-------i~--~~~--~~~~~~~~~y~i~~~~~~~~~~~~~~~~ 122 (2576)
.|+++|++.|..+|-.|-.+++...-+.+...+..+ +. .+. ..+..|..++.+..+..... ..--.
T Consensus 2 ~~~~~~~~~~~~Ll~~E~~~e~~~~~~~~~~~~~~~~~~~G~~~~~l~~~~~~~~~~g~~~~~~~~~~~~~~---~~l~~ 78 (646)
T 4b3f_X 2 AAVESFVTKQLDLLELERDAEVEERRSWQENISLKELQSRGVCLLKLQVSSQRTGLYGRLLVTFEPRRYGSA---AALPS 78 (646)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSSCHHHHGGGTSEEEEEEEEEEEECSSSCEEEEEEESCC------CCCCC
T ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCHHHHHhCCceecceEEEEEEecCCCeEEEEEEecCCCCC---CCCcc
Confidence 368999999999999998888766555444444211 11 111 11234555666665433211 11113
Q ss_pred ccCCCCCEEEEccCCCCCCccccccCceeEEEEEeeeccCCcccCCCCceeEEEeeccccccc---cCcceEEEEeeccc
Q 000053 123 YKTLPGDILVLADAKPETASDLQRVGRMWTFVSVANVTEDENEIDTSPTYFKVNATKEIQIDV---SKKSLFVIFLINRT 199 (2576)
Q Consensus 123 y~p~~GDii~lt~~kP~~~~dl~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~v~~sk~i~~~~---~~~~~~~~~L~N~~ 199 (2576)
....+||+|++++..|.. ....-|.|.++..+ .+.|.+........ ....+...++.|.+
T Consensus 79 ~~~~~Gd~v~~~~~~~~~--------~~~~~g~v~~~~~~---------~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~ 141 (646)
T 4b3f_X 79 NSFTSGDIVGLYDAANEG--------SQLATGILTRVTQK---------SVTVAFDESHDFQLSLDRENSYRLLKLANDV 141 (646)
T ss_dssp CCCCTTCEEEEEETTTTS--------CCCEEEEEEEEETT---------EEEEECC-------CCCSSCCEEEEEECCHH
T ss_pred CCCCCCCEEEEEecCCCC--------CceEEEEEEEEeCC---------EEEEEECCccccccccCCCCcEEEEEeccch
Confidence 467899999999876643 33456889888653 56676654332221 13456678899999
Q ss_pred chhhHhhhccc------CCCHHHHHHHH------------------------------hcCCCCCeEEEEcCCCCChhHH
Q 000053 200 SNRRIWNSLHM------KGNLKIIKELL------------------------------CTDSGATVQLIWGPPGTGKTKT 243 (2576)
Q Consensus 200 t~~ri~~~l~~------~~~~~~i~~vl------------------------------~~~~~~~v~LIwGPPGTGKTkt 243 (2576)
||.|++.+|.. .+...+++-++ ..-+.+++.|||||||||||+|
T Consensus 142 ~~~r~~~al~~l~~~~~~~~~~l~~~l~~~~~p~~~~~~~~~~~~~~~LN~~Q~~AV~~al~~~~~~lI~GPPGTGKT~t 221 (646)
T 4b3f_X 142 TYRRLKKALIALKKYHSGPASSLIEVLFGRSAPSPASEIHPLTFFNTCLDTSQKEAVLFALSQKELAIIHGPPGTGKTTT 221 (646)
T ss_dssp HHHHHHHHHHHHHTCCSSTTHHHHHHHTTSSCCCCCCCCCCCCCSSTTCCHHHHHHHHHHHHCSSEEEEECCTTSCHHHH
T ss_pred HHHHHHHHHHHhhhcccCchHHHHHHHcCCCCCCCccccCcccccCCCCCHHHHHHHHHHhcCCCceEEECCCCCCHHHH
Confidence 99999999842 12233333332 2111267999999999999999
Q ss_pred HHHHHHHHHhCCCeEEEEecChHHHHHHHHHHHHHHHhhhhhccccccccccccEEEccCcccccccccchhhhHHHHHH
Q 000053 244 VSMLLVILLQMKFRTLVCTPTIVAIKELASRVVKLVKESVERDCRDALFFPLGEILLLGNNERLKVDSGVEEIYLDYRVK 323 (2576)
Q Consensus 244 Is~Ll~~Ll~~~~rVLv~ApTN~AVd~V~~RL~~lv~es~~~~~~~~~~~~lgdillfGn~~rm~id~~l~~v~Ld~Rv~ 323 (2576)
+++++..|++.|.+||+|||||.|||++++||... ..+++++|++.++. +.+....++....
T Consensus 222 i~~~I~~l~~~~~~ILv~a~TN~AvD~i~erL~~~----------------~~~ilRlG~~~r~~--~~~~~~~l~~~~~ 283 (646)
T 4b3f_X 222 VVEIILQAVKQGLKVLCCAPSNIAVDNLVERLALC----------------KQRILRLGHPARLL--ESIQQHSLDAVLA 283 (646)
T ss_dssp HHHHHHHHHHTTCCEEEEESSHHHHHHHHHHHHHT----------------TCCEEECSCCSSCC--HHHHTTBHHHHHT
T ss_pred HHHHHHHHHhCCCeEEEEcCchHHHHHHHHHHHhc----------------CCceEEecchhhhh--hhhhhhhHHHHHh
Confidence 99999999999999999999999999999998632 13589999988762 1222222221111
Q ss_pred HHhhhccCCCCcchhhhhhHHHHHhhHHHHHHHHHhhhhccccccccchhhhhhccccCCccccccchhhHHHhhhhhhc
Q 000053 324 RLADCFAPLTGWSHCFASMVEFLDNCVSQYHTYMENESMKQSEDINGDIIKEKECGKEADASDVEIKPFLEFVRERFKCI 403 (2576)
Q Consensus 324 ~L~~~f~~~~gw~~~L~sli~lLen~~~~y~~~l~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~ 403 (2576)
+... .. ....+++.+
T Consensus 284 ~~~~--------~~------------------------------------------------------~~~~~~~~~--- 298 (646)
T 4b3f_X 284 RSDS--------AQ------------------------------------------------------IVADIRKDI--- 298 (646)
T ss_dssp TTTC--------SS------------------------------------------------------THHHHHHHH---
T ss_pred hchH--------HH------------------------------------------------------HHHHHHHHH---
Confidence 0000 00 000000000
Q ss_pred ccccchhhhcccccccccccccchhHHHHHhhhhcccchhhhhhhhhccCCCccccccchhhHHHHHHHHHHHHHHHhhh
Q 000053 404 INGDIIKEKECGKEADASDVEIKPFLEFVRERFKCIAAPLRSCIFNFCTHIPKCYIGEDNFHVMATLISLLDSFETLLFE 483 (2576)
Q Consensus 404 ~~~~~~~~~~~~~~~~~~~~~~~sf~~f~~~~~~~~~~~l~~~~~~l~~~lp~~~~s~~~~~~~~~l~~~L~~~~~ll~~ 483 (2576)
........ .......
T Consensus 299 ---------------------------------~~~~~~~~-----------~~~~~~~--------------------- 313 (646)
T 4b3f_X 299 ---------------------------------DQVFVKNK-----------KTQDKRE--------------------- 313 (646)
T ss_dssp ---------------------------------TTSSTTTT-----------C---------------------------
T ss_pred ---------------------------------HHHHHhhh-----------hhhhHHH---------------------
Confidence 00000000 0000000
Q ss_pred cccchHHHHHHhcccccccchhhHHHHHHHHHhhhhhhHHHHHHHHhhhhccCCChhhhhHHHHHHHHHHHhcCCcEEEE
Q 000053 484 DNLVSEELEELLSHSVDEDLSESIVDIKYLLHKRRSECHFVLRKLLSSFNELNLPSAVEKDLLEDLLKRFCLKRASLFFS 563 (2576)
Q Consensus 484 ~~~~~eel~~~~~~~~~~~~~~~~~~~~~~l~~~r~~~~~~lk~L~~~~~~l~lp~~~~k~~~~~~i~~~~l~~a~VI~~ 563 (2576)
+......++.+...++. .++......+..+++|++
T Consensus 314 ----------------------------------~~~~~~~~~~l~~~l~~-----------~~~~~~~~~l~~~~vv~~ 348 (646)
T 4b3f_X 314 ----------------------------------KSNFRNEIKLLRKELKE-----------REEAAMLESLTSANVVLA 348 (646)
T ss_dssp ----------------------------------CCSSHHHHHHHHHHHHH-----------HHHHHHHHHHHHCSEEEE
T ss_pred ----------------------------------HHHHHHHHHHHHHHHHH-----------HHHHHHHHHHhhcceeee
Confidence 00000000000000000 011122334678999999
Q ss_pred ccccchhh---hhccCCCCCEEEEEcCCCCChhHHhhhccccCcceEEEecCCCCCCccccccchhhhhccccHHHHHhh
Q 000053 564 TASSSYML---HSVAMKPLNFLVIDEAAQLKESESTIPLQLSGIKHAVLFGDECQLPAMVESKVSDEACFGRSLFERLSH 640 (2576)
Q Consensus 564 T~sss~~l---~~~~~~~fD~VIIDEAsQ~~e~e~lipL~l~~~k~vILVGD~~QLpPvv~s~~~~~~~~~~SLfeRL~~ 640 (2576)
|++++... ..+....||+||||||+|++|+++++|+. +++++||||||+||||++.+..+...+++.|+|+|+..
T Consensus 349 t~~~a~~~~~~~~~~~~~Fd~vIIDEAsQ~~e~~~lipL~--~~~~~ILVGD~~QLpP~v~~~~a~~~gl~~SlferL~~ 426 (646)
T 4b3f_X 349 TNTGASADGPLKLLPESYFDVVVIDECAQALEASCWIPLL--KARKCILAGDHKQLPPTTVSHKAALAGLSLSLMERLAE 426 (646)
T ss_dssp ETTTTCSSSGGGGSCTTCCSEEEETTGGGSCHHHHTTTGG--GSSEEEEEECTTSCCCCCSCHHHHHTTTTCCHHHHHHH
T ss_pred ehhhhhhhhHHHhhhhccCCEEEEcCccccchHHHHhhcc--ccceEEEcCCccccCceecchhhhhccccchHHHHHHH
Confidence 98875432 33455679999999999999999999985 46899999999999999999888899999999999986
Q ss_pred c--cCCccccccccccCcccccccccccccCcccCCcccccccccccc---CCCCCCCCcEEEEccCC----cccccccc
Q 000053 641 L--RHSKHLLSIQYRMHPSISFFPNSYFYENKIHDSPTVEKRSYEKRF---LPGPMYGPYSFINVFGG----REEFIEHS 711 (2576)
Q Consensus 641 ~--g~~~~~L~~qYRmhp~I~~f~n~~fY~g~L~~~~~~~~~~~~~~~---~~~~~~~~~~fidv~~g----~e~~~~~S 711 (2576)
. +.+.++|++||||||+|+.|+|..||+|+|.+++++..+...... .......|+.|+|+.+. .++..+.|
T Consensus 427 ~~~~~~v~~L~~qYRmhp~I~~f~n~~fY~g~L~~~~~~~~~~~~~lp~~~~~~~~~~p~~f~d~~g~~~~~~~~~~~~s 506 (646)
T 4b3f_X 427 EYGARVVRTLTVQYRMHQAIMRWASDTMYLGQLTAHSSVARHLLRDLPGVAATEETGVPLLLVDTAGCGLFELEEEDEQS 506 (646)
T ss_dssp HHGGGTEEECCEESSSCHHHHHHHHHHHSTTCCEECTTTTTCCGGGSTTCCCCTTTTCSEEEEECTTSSCCCCC-----C
T ss_pred hcCCceeeecccccCCcHHHHhhhHHhhcCCccccCcchhhhhhccccccccccccCCceEEEecCCCccccccccCCcc
Confidence 5 334568999999999999999999999999988876654322111 11122358899999553 22336789
Q ss_pred ccCHHHHHHHHHHHHHHHhcccCCCCCCeEEEEcccHHHHHHHHHHhccccccCCCCceEEccCCCCCCccCCEEEEEcc
Q 000053 712 CRNMVEVSVVMKILLNLYKGWINSKEKLSIGIVSPYIAQVAAIQEKLGSKYVNSAGFAVKVMSVDGFQGGEEDIIIISTV 791 (2576)
Q Consensus 712 ~~N~~Ea~~v~~lv~~L~~~~~~~~~~~sIgIITPY~aQv~~I~~~L~~~~~~~~~~~v~V~TVd~fQG~E~DiVIlS~V 791 (2576)
+.|..||..|..++..|++.+. +..+|||||||++|+.+|++.|.+.+ ..++|+|||+|||+|+||||+|+|
T Consensus 507 ~~N~~EA~~V~~~v~~L~~~gv---~~~dIgVItpYraQ~~~l~~~l~~~~-----~~i~v~TVd~fQG~E~dvII~S~v 578 (646)
T 4b3f_X 507 KGNPGEVRLVSLHIQALVDAGV---PARDIAVVSPYNLQVDLLRQSLVHRH-----PELEIKSVDGFQGREKEAVILSFV 578 (646)
T ss_dssp CCCHHHHHHHHHHHHHHHHHTC---CGGGEEEEESCHHHHHHHHHHHTTTC-----TTCEEEEGGGGTTCCEEEEEEECC
T ss_pred ccCHHHHHHHHHHHHHHHhcCC---CcCcEEEECCCHHHHHHHHHHHHHhC-----CCCEECChhhcccccCCEEEEEec
Confidence 9999999999999999998764 66799999999999999999997643 368999999999999999999999
Q ss_pred cCCCCCccccCCCCCceEEecccccccEEEEechhhhhcCchHHHHHHHHHHhcCceecc
Q 000053 792 RSNNGGSIGFISNPRRVNVALTRARHCLWILGNERTLTRNRSVWKALVDDAKARQCFFNA 851 (2576)
Q Consensus 792 rs~~~~~~gFl~d~~RlNVAlTRAR~~LiIVGn~~~L~~~~~~W~~li~~~~~r~~~~~~ 851 (2576)
|++..+.+||+.|+||+|||+||||++||||||..+|.++ +.|+.|+++++++|+++.+
T Consensus 579 rsn~~~~iGFl~~~rRlNVAlTRAk~~liivGn~~~l~~~-~~~~~li~~~~~~g~~~~~ 637 (646)
T 4b3f_X 579 RSNRKGEVGFLAEDRRINVAVTRARRHVAVICDSRTVNNH-AFLKTLVEYFTQHGEVRTA 637 (646)
T ss_dssp CCCTTCCCCSTTCHHHHHHHHHTEEEEEEEEECHHHHTTS-HHHHHHHHHHHHSSEEEEG
T ss_pred cCCCCCCccccCCcCcEEeEhhhhhCeEEEEEchHHhcCC-HHHHHHHHHHHHCCCEeeH
Confidence 9999999999999999999999999999999999999875 8999999999999998865
|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, STR genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1w36_C RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.25 PDB: 3k70_C* | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >3ug7_A Arsenical pump-driving ATPase; tail-anchored, membrane protein, targeting factor, ATP-bindi TRC40, ARSA, nucleotide-binding; HET: ADP; 2.90A {Methanocaldococcus jannaschii} PDB: 3ug6_A* | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3zq6_A Putative arsenical pump-driving ATPase; tail-anchored, membrane protein; HET: ADP; 2.11A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1ihu_A Arsenical pump-driving ATPase; aluminum fluoride, ADP, ARSA ATPase, ATP binding site, hydro; HET: ADP; 2.15A {Escherichia coli} SCOP: c.37.1.10 c.37.1.10 PDB: 1f48_A* 1ii0_A* 1ii9_A* | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3bfv_A CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine kinase; chimerical protein, P-loop protein, capsule biogenesis/degradation; HET: ADP; 1.80A {Staphylococcus aureus} PDB: 2ved_A* | Back alignment and structure |
|---|
| >4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3cio_A ETK, tyrosine-protein kinase ETK; WZC, escherichia coli tyrosine kinase domain, signaling protein, transferase, inner membrane, membrane; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >3iqw_A Tail-anchored protein targeting factor GET3; ATPase, Zn binding, protein transport; HET: ANP; 3.00A {Chaetomium thermophilum} PDB: 3iqx_A* 3ibg_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3kjh_A CO dehydrogenase/acetyl-COA synthase complex, accessory protein COOC; Zn-bound dimer, nickel binding protein, ATPase; 1.90A {Carboxydothermus hydrogenoformans} PDB: 3kjg_A* 3kje_A 3kji_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2woo_A ATPase GET3; tail-anchored, membrane protein, targeting factor, endoplasmic reticulum, TRC40, ATP-binding, golgi apparatus; 3.01A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 2576 | ||||
| d1w36b1 | 485 | c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta ch | 1e-10 | |
| d1uaaa1 | 306 | c.37.1.19 (A:2-307) DEXX box DNA helicase {Escheri | 4e-06 | |
| d1pjra1 | 318 | c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillu | 2e-04 | |
| d1a1va1 | 136 | c.37.1.14 (A:190-325) HCV helicase domain {Human h | 0.003 | |
| d1w36b2 | 395 | c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta | 0.004 |
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 485 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Exodeoxyribonuclease V beta chain (RecB), N-terminal domain species: Escherichia coli [TaxId: 562]
Score = 64.0 bits (154), Expect = 1e-10
Identities = 43/270 (15%), Positives = 84/270 (31%), Gaps = 30/270 (11%)
Query: 1221 LCNSYFERFHNIWKNYGQLQNSKSVFIETIIRKKEVNYERFSSSYWPHFNAQLARKLDPS 1280
R + + + IE+ + + + +A + +
Sbjct: 221 RHAQIVARIDTVKQQWRDAVGELDALIESSGIDRRKFNRSNQAKWIDKISAWAEEETNSY 280
Query: 1281 RVFTEIISHIKGGLQSIEVVNGKLNREDYV----NLSETRNSSLSRQKRERIYDIFESYE 1336
++ + + L+ G+ R L S + +I E+
Sbjct: 281 QLPESLEKFSQRFLEDRTKAGGETPRHPLFEAIDQLLAEPLSIRDLVITRALAEIRETVA 340
Query: 1337 QMKMRNGEFDLADLVNDLHHRLKEESYK------GDEFHFVYIDEVQDLTMSQVALFKYV 1390
+ K R GE D+++ L L+ ES + F IDE QD Q +F+ +
Sbjct: 341 REKRRRGELGFDDMLSRLDSALRSESGEVLAAAIRTRFPVAMIDEFQDTDPQQYRIFRRI 400
Query: 1391 CKNIEEGFVFS-GDTAQTIARGIDFRFQDIRSLFYKKFVLESRNNGNDGRQEKRQLSDIF 1449
+ E + GD Q I FR DI + + + ++ +
Sbjct: 401 WHHQPETALLLIGDPKQAIYA---FRGADIFTYM----------------KARSEVHAHY 441
Query: 1450 NLRQNFRTHVGVLNLAQSIIELLYRFFPHS 1479
L N+R+ G++N + F
Sbjct: 442 TLDTNWRSAPGMVNSVNKLFSQTDDAFMFR 471
|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Length = 306 | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Length = 318 | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 | Back information, alignment and structure |
|---|
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 395 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2576 | |||
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 100.0 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.94 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 99.93 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 99.92 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 99.55 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.54 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 99.38 | |
| d1uaaa2 | 333 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 99.35 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.22 | |
| d1pjra2 | 333 | DEXX box DNA helicase {Bacillus stearothermophilus | 99.2 | |
| d1w36b2 | 395 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 99.08 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 99.0 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 98.6 | |
| d1w36c2 | 470 | Exodeoxyribonuclease V gamma chain (RecC), N-termi | 98.24 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 98.01 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 97.93 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 97.88 | |
| d1w36d2 | 246 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 97.75 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 97.58 | |
| d1w36d2 | 246 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 97.34 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 97.31 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 96.89 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.83 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 96.8 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 96.67 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.56 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 96.28 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 96.2 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.12 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 96.03 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 95.97 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 95.93 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 95.83 | |
| d1w36b2 | 395 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 95.81 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 95.77 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 95.7 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 95.68 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 95.55 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 95.54 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 95.53 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 95.52 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 95.49 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.4 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.27 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.02 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 94.96 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 94.9 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 94.9 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 94.88 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 94.78 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 94.74 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 94.63 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 94.5 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 94.48 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 94.44 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 94.39 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.35 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 94.31 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 94.3 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 94.28 | |
| d1uaaa2 | 333 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 94.26 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 94.19 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 94.18 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 94.14 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 94.11 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 94.09 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 94.08 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 94.07 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 94.03 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 93.96 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 93.87 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 93.81 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 93.74 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 93.73 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 93.64 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 93.6 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 93.51 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 93.5 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 93.42 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 93.41 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 93.32 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 93.03 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 93.02 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 92.95 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 92.78 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 92.65 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 92.61 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 92.57 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 92.5 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 92.49 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 92.48 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 92.47 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.44 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 92.4 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 92.34 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 92.28 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 92.23 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 92.19 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 92.17 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 91.91 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 91.91 | |
| d1pjra2 | 333 | DEXX box DNA helicase {Bacillus stearothermophilus | 91.85 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 91.79 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 91.78 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 91.76 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 91.73 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 91.52 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 91.38 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 91.25 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 91.16 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 91.13 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 91.06 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 90.98 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 90.97 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 90.84 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 90.84 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 90.75 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 90.56 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 90.55 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 90.47 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 90.37 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 90.36 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 90.27 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 90.24 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 90.22 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 90.2 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 90.0 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 89.99 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 89.97 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 89.78 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 89.74 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 89.48 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 89.41 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 89.41 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 89.32 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 89.27 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 89.19 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 89.18 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 89.14 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 89.0 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 88.98 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 88.85 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 88.72 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 88.69 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 88.62 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 88.47 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 88.35 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 88.25 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 88.24 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 88.21 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 88.04 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 88.03 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 88.01 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 87.99 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 87.9 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 87.81 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 87.76 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 87.74 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 87.67 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 87.6 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 87.45 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 87.23 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 87.04 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 86.97 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 86.91 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 86.77 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 86.72 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 86.72 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 86.65 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 86.57 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 86.55 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 86.43 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 86.35 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 86.17 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 85.88 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 85.74 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 85.66 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 85.44 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 85.25 | |
| d1wmia1 | 88 | Hypothetical protein PHS013 {Pyrococcus horikoshii | 84.96 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 84.88 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 84.74 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 84.71 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 84.58 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 84.43 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 83.85 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 83.78 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 83.67 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 83.65 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 83.57 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 83.53 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 83.52 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 83.31 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 83.26 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 83.2 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 83.18 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 83.06 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 83.0 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 82.99 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 82.98 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 82.71 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 82.7 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 82.45 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 82.45 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 82.45 | |
| d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 81.92 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 81.91 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 81.91 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 81.83 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 81.82 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 81.71 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 81.66 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 81.56 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 81.43 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 81.41 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 81.37 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 81.2 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 81.1 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 81.07 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 80.65 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 80.64 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 80.62 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 80.41 | |
| d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 80.38 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 80.24 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 80.12 |
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36d2 c.37.1.19 (D:361-606) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1wmia1 d.298.1.2 (A:1-88) Hypothetical protein PHS013 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|