Citrus Sinensis ID: 000236
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1810 | ||||||
| 359481849 | 1879 | PREDICTED: protein RRP5 homolog [Vitis v | 0.961 | 0.926 | 0.726 | 0.0 | |
| 297739784 | 1862 | unnamed protein product [Vitis vinifera] | 0.957 | 0.930 | 0.727 | 0.0 | |
| 356533079 | 1885 | PREDICTED: protein RRP5 homolog [Glycine | 0.966 | 0.928 | 0.662 | 0.0 | |
| 449453908 | 1898 | PREDICTED: protein RRP5 homolog [Cucumis | 0.969 | 0.924 | 0.635 | 0.0 | |
| 240255326 | 1896 | RNA binding protein [Arabidopsis thalian | 0.969 | 0.925 | 0.628 | 0.0 | |
| 10998136 | 1765 | pre-rRNA processing protein RRP5 [Arabid | 0.964 | 0.989 | 0.628 | 0.0 | |
| 297833988 | 1843 | S1 RNA-binding domain-containing protein | 0.912 | 0.895 | 0.631 | 0.0 | |
| 222636634 | 1898 | hypothetical protein OsJ_23484 [Oryza sa | 0.969 | 0.924 | 0.561 | 0.0 | |
| 242043296 | 1862 | hypothetical protein SORBIDRAFT_02g00600 | 0.941 | 0.915 | 0.557 | 0.0 | |
| 218199275 | 1848 | hypothetical protein OsI_25303 [Oryza sa | 0.941 | 0.922 | 0.545 | 0.0 |
| >gi|359481849|ref|XP_002276633.2| PREDICTED: protein RRP5 homolog [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 2622 bits (6795), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 1323/1821 (72%), Positives = 1528/1821 (83%), Gaps = 81/1821 (4%)
Query: 4 QNISAGMKLWGVVAEVNEKDLVICLPGGLRGLARAADALDPILDNEIEANEDNLLPTIFH 63
+NIS GMKLWGVVAEVNEKDL I LPGGLRGL RA++A DP+ NEI+ E LP IFH
Sbjct: 126 KNISPGMKLWGVVAEVNEKDLGISLPGGLRGLVRASEAFDPLFSNEIKDAEGIFLPRIFH 185
Query: 64 VGQLVSCIVLQLDDDKKEIGKRKIWLSLRLSLLYKGLSLETVQEGMVLTAYVKSIEDHGY 123
+GQLVSC+VLQLDDDKKE GKR+IWLSLRLSLL+KG +L+ +QEGMVLTAYVKSIEDHGY
Sbjct: 186 IGQLVSCVVLQLDDDKKEKGKRRIWLSLRLSLLHKGFTLDALQEGMVLTAYVKSIEDHGY 245
Query: 124 ILHFGLPSFTGFLPRNNLAENSGIDVKPGLLLQGVVRSIDRTRKVVYLSSDPDTVSKCVT 183
ILHFGLPSFTGFLP+++ A+ + I++ G +LQGV+RSID+ KVVYLSSDPDT+SKCVT
Sbjct: 246 ILHFGLPSFTGFLPKSSQADQN-IEINTGQILQGVIRSIDKAHKVVYLSSDPDTISKCVT 304
Query: 184 KDLKGISIDLLVPGMMVSTRVQSILENGVMLSFLTYFTGTVDIFHLQNTFPTTNWKNDYN 243
KDLKGISIDLL+PGMMV+ RVQS ENGVMLSFLTYFTGTVDIFHLQ TFP++NWK+DYN
Sbjct: 305 KDLKGISIDLLIPGMMVNARVQSTFENGVMLSFLTYFTGTVDIFHLQTTFPSSNWKDDYN 364
Query: 244 QHKKVNARILFVDPTSRAVGLTLNPYLLHNRAPPSHVKVGDIYDQSKVVRVDRGLGLLLD 303
Q+KKVNARILF+DP++RAVGLTLNP+L++N+APP VK GDIYD SKV+RVDRGLGLLL+
Sbjct: 365 QNKKVNARILFIDPSTRAVGLTLNPHLVNNKAPPCPVKTGDIYDHSKVIRVDRGLGLLLE 424
Query: 304 IPSTPVSTPAYVTISDVAEEEVRKLEKKYKEGSCVRVRILGFRHLEGLATGILKASAFEG 363
+PSTP STP YVT YKEGS VRVRILGFR+LEGLA G LKASAFEG
Sbjct: 425 VPSTPASTPTYVT---------------YKEGSHVRVRILGFRNLEGLAMGTLKASAFEG 469
Query: 364 LVFTHSDVKPGMVVKGKVIAVDSFGAIVQFPGGVKALCPLPHMSEFEIVKPGKKFKVGAE 423
VFTHSDVKPGMVVK KVIAVDSFGAIVQFP GVKALCPL HMSEF+IVKP KKFKVGAE
Sbjct: 470 SVFTHSDVKPGMVVKAKVIAVDSFGAIVQFPSGVKALCPLRHMSEFDIVKPRKKFKVGAE 529
Query: 424 LVFRVLGVKSKRITVTHKKTLVKSKLAILSSYAEATDRLITHGWITKIEKHGCFVRFYNG 483
L+FRVLG KSKRITVTHKKTL+KSKL I+SSY +AT+ LITHGWITKIEKHGCF+RFYNG
Sbjct: 530 LIFRVLGCKSKRITVTHKKTLLKSKLGIISSYTDATEGLITHGWITKIEKHGCFIRFYNG 589
Query: 484 VQGFAPRSELGLDPGCEPSSMYHVGQVVKCRIMSSIPASRRINLSFMMKPTRVSEDDLVK 543
VQGFAP SELGL+PGC S MYHVGQVVKCR+ S+PASRRINL +D+VK
Sbjct: 590 VQGFAPSSELGLEPGCNTSLMYHVGQVVKCRVKGSVPASRRINL-----------NDMVK 638
Query: 544 LGSLVSGVVDVVTPNAVVVYVIAKGYSKGTIPTEHLADHLEHATVMKSVIKPGYEFDQLL 603
LGS+V GVVD VTP+A++V V AKGY KGTI TEHLADH HA +MKS +KPGYEFDQLL
Sbjct: 639 LGSVVGGVVDRVTPHAIIVNVSAKGYLKGTISTEHLADHQGHAALMKSTLKPGYEFDQLL 698
Query: 604 VLDNESSNLLLSAKYSLINSAQQLPSDASHIHPNSVVHGYVCNIIETGCFVRFLGRLTGF 663
VLD E +N +LSAKYSLINSAQQLP D + IHPNSVVHGY+CNIIETGCFVRFLGRLTGF
Sbjct: 699 VLDVEGNNFILSAKYSLINSAQQLPLDLTQIHPNSVVHGYICNIIETGCFVRFLGRLTGF 758
Query: 664 APRSKAVDGQRADLSKTYYVGQSVRSNILDVNSETGRITLSLKQSCCSSTDASFMQEHFL 723
+PR+K +D QRA S+ +++GQSVRSNILDVNSETGRITLSLKQSCCSSTDASF+QE+FL
Sbjct: 759 SPRNKVMDDQRAVPSEAFFIGQSVRSNILDVNSETGRITLSLKQSCCSSTDASFIQEYFL 818
Query: 724 LEEKIAMLQSSKHNGSELKWVEGFIIGSVIEGKVHESNDFGVVVSFEEHSDVYGFITHHQ 783
LEEKIA LQ S SELKW EGF IG+VIEGK+H++ DFGVV+SFE+++DV+GFITH+Q
Sbjct: 819 LEEKIAKLQLSDSEHSELKWAEGFNIGTVIEGKIHDAKDFGVVISFEKYNDVFGFITHYQ 878
Query: 784 LAGATVESGSVIQAAILDVAKAERLVDLSLKTVFIDRFREANSNRQAQKKKRKREASKDL 843
L T E GS +QA +LDVAK ERLVDLSLK F+DR +E +SN QA KKKR+REA K+L
Sbjct: 879 L---TAERGSTVQAVVLDVAKTERLVDLSLKPEFLDRHKEDSSNSQAGKKKRRREAYKEL 935
Query: 844 GVHQTVNAIVEIVKENYLVLSLPEYNHSIGYASVSDYNTQKFPQKQFLNGQSVIATVMAL 903
HQTVNAIVEIVKENYLVLSLPEYN++IGYASVSDYNTQKF QKQFL+GQSVIA+VMAL
Sbjct: 936 QPHQTVNAIVEIVKENYLVLSLPEYNYAIGYASVSDYNTQKFAQKQFLHGQSVIASVMAL 995
Query: 904 PSSSTAGRLLLLLKAISE-TETSSSKRAKKKSSYDVGSLVQAEITEIKPLELRLKFGIGF 962
PS ST GRLLL+LK++SE TETSSSKRAKKKSSY+VGSLVQAEITEIKPLELRLKFGIGF
Sbjct: 996 PSPSTVGRLLLVLKSVSEATETSSSKRAKKKSSYNVGSLVQAEITEIKPLELRLKFGIGF 1055
Query: 963 HGRIHITEVNDDKSNVVENLFSNFKIGQTVTARIIAKSNKPDMK-KSFLWELSIKPSMLT 1021
HGR+HITEV D+ NV+EN FSNF+IGQTV+ARI+AK+NK + K+ WELSIKP MLT
Sbjct: 1056 HGRVHITEVCDE--NVIENPFSNFRIGQTVSARIVAKANKSENNGKNHQWELSIKPEMLT 1113
Query: 1022 VS-EIGSKLLFEECDVSIGQRVTGYVYKVDNEWALLTISRHLKAQLFILDSAYEPSELQE 1080
S E+ +KL+ E +S GQRVTGYVYKV+NEW LTISRH+KAQLF+LD++ EP+ELQE
Sbjct: 1114 GSIEVENKLVDAEFRISTGQRVTGYVYKVENEWIWLTISRHIKAQLFLLDTSCEPNELQE 1173
Query: 1081 FQRRFHIGKAVTGHVLSINKEKKLLRLVLRPFQ--DGISD-KTVDISN-------DNMQT 1130
FQ+RF +GKAV+G+VLS NKEKKLLR+VL F +G D K ++I N +N+
Sbjct: 1174 FQKRFEVGKAVSGYVLSANKEKKLLRMVLHQFSVSNGTLDGKVLNIDNQHCNPPIENLIP 1233
Query: 1131 FIHEGDIVGGRISKILSGVGGLVVQIGPHLYGRVHFTELKNICVSDPLSGYDEGQFDPLS 1190
IH+GD +GGRISKIL GVGGL+VQIGPHLYG+VHFTELK+ VSDPLSGY E
Sbjct: 1234 HIHKGDTLGGRISKILPGVGGLLVQIGPHLYGKVHFTELKDSWVSDPLSGYHE------- 1286
Query: 1191 GYDEGQFVKCKVLEISRTVRGTFHVELSLRSSLDGMSSTNSSDLSTDVDTPGKHLEKIED 1250
GQFVKCKVLEI + +GT HV+LSL SSL+GM S NS +EKI++
Sbjct: 1287 ----GQFVKCKVLEIGHSEKGTVHVDLSLWSSLNGMHSPNS------------RVEKIDN 1330
Query: 1251 LSPNMIVQGYVKNVTSKGCFIMLSRKLDAKVLLSNLSDGYVESPEKEFPIGKLVAGRVLS 1310
L +M+VQGYVKNVTSKGCFI+LSRKLDA++LL+NLSDGYVE PE+EFPIGKLV+GRVLS
Sbjct: 1331 LHSDMLVQGYVKNVTSKGCFILLSRKLDARILLANLSDGYVEKPEREFPIGKLVSGRVLS 1390
Query: 1311 VEPLSKRVEVTLKTSDSRTASQSEINNLSNLHVGDIVIGQIKRVESYGLFITIENTNLVG 1370
VEPLS+RVEVTLKTS + + +SE+N+ S++ VGDI+ G IKRVESYGLFITI++TN+VG
Sbjct: 1391 VEPLSRRVEVTLKTSSATSVQKSEVNDFSSILVGDIIFGTIKRVESYGLFITIDDTNMVG 1450
Query: 1371 LCHVSELSEDHVDNIETIYRAGEKVKVKILKVDKEKRRISLGMKSSYFKNDADNLQMSSE 1430
LCH+SELS+DH+ NIET Y+AGE+V KILKVD+E+ RISLGMK+SY K N
Sbjct: 1451 LCHISELSDDHISNIETKYKAGERVAAKILKVDEERHRISLGMKNSYIKETTQNNGF--- 1507
Query: 1431 EESDEAIEEVGSYNRSSLLENSSVAVQDMDMESEDGGSLVLAQIESRASVPPLEVNLDD- 1489
V S+ LEN+S +Q++D+E ED VL+Q+ESRAS+ PLEV+LDD
Sbjct: 1508 ---------VDDTQLSTFLENNSREIQNLDVEYEDEEYPVLSQVESRASILPLEVDLDDV 1558
Query: 1490 EQPDMDNGISQNQGHTDEAKTIDEKNNRHAKKKEKEEREQEIRAAEERLLEKDAPRTPDE 1549
++D+ + QN +T+E TIDEK+ R AKKK KEE+EQEIRAAEERL+ D PRT DE
Sbjct: 1559 NHSNLDDAVGQNHIYTNETNTIDEKSKRRAKKKAKEEKEQEIRAAEERLMLNDVPRTADE 1618
Query: 1550 FERLVRSSPNSSFVWIKYMAFMLSMADVEKARSIAERALQTINIREENEKLNIWVAYFNL 1609
FE+LVR SPNSSF+WIKYMA MLS+AD+EKARSIAERAL+TINIREE+EKLNIW+AYFNL
Sbjct: 1619 FEKLVRGSPNSSFLWIKYMALMLSLADIEKARSIAERALRTINIREESEKLNIWMAYFNL 1678
Query: 1610 ENEYGNPPEEAVVKVFQRALQYCDPKKVHLALLGLYERTEQNKLADELLYKMIKKFKHSC 1669
ENEYGNPPEEAVVKVFQRALQYCDPKKVHLALLG+YERTEQ+KLADELL KM KKFKHSC
Sbjct: 1679 ENEYGNPPEEAVVKVFQRALQYCDPKKVHLALLGMYERTEQHKLADELLEKMTKKFKHSC 1738
Query: 1670 KVWLRRVQRLLKQQQEGVQAVVQRALLSLPRHKHIKFISQTAILEFKNGVADRGRSMFEG 1729
KVWLRRVQ +LKQ Q+GVQ V+ RALL LPRHKHIKFISQTAILEFK+GV DRGRSMFEG
Sbjct: 1739 KVWLRRVQNVLKQHQDGVQPVINRALLCLPRHKHIKFISQTAILEFKSGVPDRGRSMFEG 1798
Query: 1730 ILSEYPKRTDLWSIYLDQEIRLGDVDLIRGLFERAISLSLPPKKMKFLFKKYLEYEKSVG 1789
+L EYPKRTDLWS+YLDQEIRLGD+D+IR LFERAI+LSL P+KMKFLFKKYLEYEKS G
Sbjct: 1799 MLREYPKRTDLWSVYLDQEIRLGDIDIIRALFERAINLSLEPRKMKFLFKKYLEYEKSQG 1858
Query: 1790 EEERIEYVKQKAMEYVESTLA 1810
+EERIE VK+KAMEY STLA
Sbjct: 1859 DEERIESVKRKAMEYANSTLA 1879
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297739784|emb|CBI29966.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356533079|ref|XP_003535096.1| PREDICTED: protein RRP5 homolog [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449453908|ref|XP_004144698.1| PREDICTED: protein RRP5 homolog [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|240255326|ref|NP_187803.4| RNA binding protein [Arabidopsis thaliana] gi|332641610|gb|AEE75131.1| RNA binding protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|10998136|dbj|BAB03107.1| pre-rRNA processing protein RRP5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297833988|ref|XP_002884876.1| S1 RNA-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297330716|gb|EFH61135.1| S1 RNA-binding domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|222636634|gb|EEE66766.1| hypothetical protein OsJ_23484 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|242043296|ref|XP_002459519.1| hypothetical protein SORBIDRAFT_02g006000 [Sorghum bicolor] gi|241922896|gb|EER96040.1| hypothetical protein SORBIDRAFT_02g006000 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
| >gi|218199275|gb|EEC81702.1| hypothetical protein OsI_25303 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1810 | ||||||
| TAIR|locus:2088644 | 1896 | RRP5 "Ribosomal RNA Processing | 0.799 | 0.763 | 0.579 | 0.0 | |
| RGD|1304933 | 1876 | Pdcd11 "programmed cell death | 0.480 | 0.463 | 0.276 | 1.3e-149 | |
| MGI|MGI:1341788 | 1862 | Pdcd11 "programmed cell death | 0.480 | 0.466 | 0.277 | 3e-149 | |
| UNIPROTKB|G5E5C4 | 1874 | PDCD11 "Protein RRP5 homolog" | 0.690 | 0.667 | 0.267 | 3.9e-148 | |
| UNIPROTKB|A7MB10 | 1874 | PDCD11 "Protein RRP5 homolog" | 0.690 | 0.667 | 0.266 | 5.3e-147 | |
| UNIPROTKB|F1PLK8 | 1870 | PDCD11 "Uncharacterized protei | 0.690 | 0.668 | 0.260 | 4.9e-146 | |
| UNIPROTKB|Q14690 | 1871 | PDCD11 "Protein RRP5 homolog" | 0.698 | 0.675 | 0.254 | 4.2e-144 | |
| UNIPROTKB|F1S842 | 1859 | LOC100157027 "Uncharacterized | 0.691 | 0.673 | 0.257 | 1.1e-142 | |
| UNIPROTKB|F1S843 | 1876 | LOC100157027 "Uncharacterized | 0.691 | 0.667 | 0.256 | 1.2e-142 | |
| UNIPROTKB|F1P3T9 | 1841 | PDCD11 "Uncharacterized protei | 0.388 | 0.381 | 0.279 | 2.7e-135 |
| TAIR|locus:2088644 RRP5 "Ribosomal RNA Processing 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 4222 (1491.3 bits), Expect = 0., P = 0.
Identities = 867/1496 (57%), Positives = 1076/1496 (71%)
Query: 332 YKEGSCVRVRILGFRHLEGLATGILKASAFEGLVFTHSDVKPGMVVKGKVIAVDSFGAIV 391
+KEG+ +RVR+LG + +EGLA G LK SAFEG VFTHSDVKPGMV K KVI+VD+FGAIV
Sbjct: 433 FKEGNHIRVRVLGLKQMEGLAVGTLKESAFEGPVFTHSDVKPGMVTKAKVISVDTFGAIV 492
Query: 392 QFPGGVKALCPLPHMSEFEIVKPGKKFKVGAELVFRVLGVKSKRITVTHKKTLVKSKLAI 451
QF GG+KA+CPL HMSEFE+ KP KKFKVGAELVFRVLG KSKRITVT+KKTLVKSKL I
Sbjct: 493 QFSGGLKAMCPLRHMSEFEVTKPRKKFKVGAELVFRVLGCKSKRITVTYKKTLVKSKLPI 552
Query: 452 LSSYAEATDRLITHGWITKIEKHGCFVRFYNGVQGFAPRSELGLDPGCEPSSMYHVGQVV 511
LSSY +AT+ L+THGWITKIEKHGCFVRFYNGVQGF PR ELGL+PG +P S++HVG+VV
Sbjct: 553 LSSYTDATEGLVTHGWITKIEKHGCFVRFYNGVQGFVPRFELGLEPGSDPDSVFHVGEVV 612
Query: 512 KCRIMSSIPASRRINLSFMMKPTRVSEDXXXXXXXXXXXXXXXXXXXXXXXXXIAKGYSK 571
KCR+ S++ ++RI L+ +K + +K K
Sbjct: 613 KCRVTSAVHGTQRITLNDSIKLGSIVSGIIDTITSQAVIVRVK-----------SKSVVK 661
Query: 572 GTIPTEHLADHLEHATVMKSVIKPGYEFDQLLVLDNESSNLLLSAKYSLINSAQQLPSDA 631
GTI EHLADH E A ++ S+++PGYE D+LLVLD E +N+ LS+KYSLI A++LPSD
Sbjct: 662 GTISAEHLADHHEQAKLIMSLLRPGYELDKLLVLDIEGNNMALSSKYSLIKLAEELPSDF 721
Query: 632 SHIHPNSVVHGYVCNIIETGCFVRFLGRLTGFAPRSKAVDGQRADLSKTYYVGQSVRSNI 691
+ + PNSVVHGYVCN+IE GCFVRFLGRLTGFAPRSKA+D +AD+S++++VGQSVR+NI
Sbjct: 722 NQLQPNSVVHGYVCNLIENGCFVRFLGRLTGFAPRSKAIDDPKADVSESFFVGQSVRANI 781
Query: 692 LDVNSETGRITLSLKQSCCSSTDASFMQEHFLLEEKIAMLQSSKHNGSELKWVEGFIIGS 751
+DVN E RITLSLKQS C+S DASF+QE+FL++EKI+ LQSS S+ WVE F IGS
Sbjct: 782 VDVNQEKSRITLSLKQSSCASVDASFVQEYFLMDEKISDLQSSDITKSDCSWVEKFSIGS 841
Query: 752 VIEGKVHESNDFGVVVSFEEHSDVYGFITHHQLAGATVESGSVIQAAILDVAKAERLVDL 811
+I+G + E ND GVVV+F+ ++V GFI H + GAT+ GSV+ A +LD+++AERLVDL
Sbjct: 842 LIKGTIQEQNDLGVVVNFDNINNVLGFIPQHHMGGATLVPGSVVNAVVLDISRAERLVDL 901
Query: 812 SLKTVFIDRFREAXXXXXXXXXXXXXXXXXDLGVHQTVNAIVEIVKENYLVLSLPEYNHS 871
SL+ ++ + +L VHQ V+A+VEIVKE +LVLS+PE+ ++
Sbjct: 902 SLRPELLNNLTKEVSNSSKKKRKRGISK--ELEVHQRVSAVVEIVKEQHLVLSIPEHGYT 959
Query: 872 IGYASVSDYNTQKFPQKQFLNGQSVIATVMALPSSSTAGRLLLLLKAIXXXXXXXXXXXX 931
IGYASVSDYNTQK P KQF GQSV+A+V A+ + T+GRLLLLL ++
Sbjct: 960 IGYASVSDYNTQKLPVKQFSTGQSVVASVKAVQNPLTSGRLLLLLDSVSGTSETSRSKRA 1019
Query: 932 XX-XXYDVGSLVQAEITEIKPLELRLKFGIGFHGRIHITEVNDDKSNVVENLFSNFKIGQ 990
+VGS+V AEITEIKP ELR+ FG F GRIHITEV + ++ + F+ F++GQ
Sbjct: 1020 KKKSSCEVGSVVHAEITEIKPFELRVNFGNSFRGRIHITEVLVNDASTSDEPFAKFRVGQ 1079
Query: 991 TVTARIIAKSNKPDMKKSFLWELSIKPSMLT-VSEIGSKLLFEECDVSIGQRVTGYVYKV 1049
+++AR++AK D+KK+ LWELS+KP+ML SE E+ + + GQ V GYVYKV
Sbjct: 1080 SISARVVAKPCHTDIKKTQLWELSVKPAMLKDSSEFNDTQESEQLEFAAGQCVIGYVYKV 1139
Query: 1050 DNEWALLTISRHLKAQLFILDSAYEPSELQEFQRRFHIGKAVTGHVLSINKEKKLLRLVL 1109
D EW L +SR++ A++FILD++ + EL+EF+RRF IGKAV+G+VL+ NKEKK LRLV
Sbjct: 1140 DKEWVWLAVSRNVTARIFILDTSCKAHELEEFERRFPIGKAVSGYVLTYNKEKKTLRLVQ 1199
Query: 1110 RPF-------QDGISDKT----VDISNDNMQTFIHEGDIVGGRISKILSGVGGLVVQIGP 1158
RP +G KT I D+ FIHEGDI+GGRISKIL GVGGL VQ+GP
Sbjct: 1200 RPLLFIHKSIANGGGSKTDKPDSSIPGDDDTLFIHEGDILGGRISKILPGVGGLRVQLGP 1259
Query: 1159 HLYGRVHFTELKNICVSDPLSGYDEGQFDPLSGYDEGQFVKCKVLEISRTVRGTFHVELS 1218
+++GRVHFTE+ + V P DPL G+ EGQFVKCKVLEIS + +GT+ +ELS
Sbjct: 1260 YVFGRVHFTEINDSWV--P---------DPLDGFREGQFVKCKVLEISSSSKGTWQIELS 1308
Query: 1219 LRSSLDGMSSTN--SSDLSTDVDTPGKHLEKIEDLSPNMIVQGYVKNVTSKGCFIMLSRK 1276
LR+SLDGMSS + S DL + D K E+IEDLSP+M VQGYVKN SKGCFI+LSR
Sbjct: 1309 LRTSLDGMSSADHLSEDLKNN-DNVCKRFERIEDLSPDMGVQGYVKNTMSKGCFIILSRT 1367
Query: 1277 LDAKVLLSNLSDGYVESPEKEFPIGKLVAGRVLSVEPLSKRVEVTLKTSDSRTASQSEIN 1336
++AKV LSNL D +V+ PEKEFP+GKLV GRVL+VEPLSKR+EVTLKT ++ +SE
Sbjct: 1368 VEAKVRLSNLCDTFVKEPEKEFPVGKLVTGRVLNVEPLSKRIEVTLKTVNAGGRPKSESY 1427
Query: 1337 NLSNLHVGDIVIGQIKRVESYGLFITIENTNLVGLCHVSELSEDHVDNIETIYRAGEKVK 1396
+L LHVGD++ G+I+RVE +GLFI I+ T +VGLCH+S+LS+D ++N++ Y+AGE V+
Sbjct: 1428 DLKKLHVGDMISGRIRRVEPFGLFIDIDQTGMVGLCHISQLSDDRMENVQARYKAGESVR 1487
Query: 1397 VKILKVDKEKRRISLGMKSSYFKNDADNLQMXXXXXXXXXXXXXXXYNRSSLLENSSVAV 1456
KILK+D+EK+RISLGMKSSY N D+ +S +L AV
Sbjct: 1488 AKILKLDEEKKRISLGMKSSYLMNGDDDKAQPLSEDNTSMECDPINDPKSEVL----AAV 1543
Query: 1457 QDMDMESEDGG-SLVLAQIESRASVPPLEVNLDD-EQPDMDNGISQNQGHTDEAKTIDXX 1514
D + GG SLVLAQ+ESRAS+PPLEV+LDD E+ D D+ SQNQ A D
Sbjct: 1544 DDFGFQETSGGTSLVLAQVESRASIPPLEVDLDDIEETDFDS--SQNQEKLLGANK-DEK 1600
Query: 1515 XXXXXXXXXXXXXXXXXXXXXXXXXXXDAPRTPDEFERLVRSSPNSSFVWIKYMAFMLSM 1574
AP DEFE+LVRSSPNSSFVWIKYMAFMLS+
Sbjct: 1601 SKRREKQKDKEEREKKIQAAEGRLLEHHAPENADEFEKLVRSSPNSSFVWIKYMAFMLSL 1660
Query: 1575 ADVEKARSIAERALQTINIREENEKLNIWVAYFNLENEYGNPPEEAVVKVFQRALQYCDP 1634
AD+EKARSIAERAL+TINIREE EKLNIWVAYFNLENE+GNPPEE+V KVF+RA QYCDP
Sbjct: 1661 ADIEKARSIAERALRTINIREEEEKLNIWVAYFNLENEHGNPPEESVKKVFERARQYCDP 1720
Query: 1635 KKVHLALLGLYERTEQNKLADELLYKMIKKFKHSCKVWXXXXXXXXXXXXEGVQAVVQRA 1694
KKV+LALLG+YERTEQ KLAD+LL +MIKKFK SCK+W E +Q+VV RA
Sbjct: 1721 KKVYLALLGVYERTEQYKLADKLLDEMIKKFKQSCKIWLRKIQSSLKQNEEAIQSVVNRA 1780
Query: 1695 LLSLPRHKHIKFISQTAILEFKNGVADRGRSMFEGILSEYPKRTDLWSIYLDQEIRLGDV 1754
LL LPRHKHIKFISQTAILEFK GVADRGRS+FEG+L EYPKRTDLWS+YLDQEIRLG+
Sbjct: 1781 LLCLPRHKHIKFISQTAILEFKCGVADRGRSLFEGVLREYPKRTDLWSVYLDQEIRLGED 1840
Query: 1755 DLIRGLFERAIXXXXXXXXXXXXXXXYLEYEKSVGEEERIEYVKQKAMEYVESTLA 1810
D+IR LFERAI +LEYEKSVG+EER+EYVKQ+AMEY STLA
Sbjct: 1841 DVIRSLFERAISLSLPPKKMKFLFKKFLEYEKSVGDEERVEYVKQRAMEYANSTLA 1896
|
|
| RGD|1304933 Pdcd11 "programmed cell death 11" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1341788 Pdcd11 "programmed cell death 11" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E5C4 PDCD11 "Protein RRP5 homolog" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A7MB10 PDCD11 "Protein RRP5 homolog" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PLK8 PDCD11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14690 PDCD11 "Protein RRP5 homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S842 LOC100157027 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S843 LOC100157027 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P3T9 PDCD11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00025446001 | SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (1799 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00019376001 | • | • | • | 0.657 | |||||||
| GSVIVG00038815001 | • | • | 0.641 | ||||||||
| GSVIVG00034559001 | • | • | • | 0.611 | |||||||
| GSVIVG00020673001 | • | • | • | 0.599 | |||||||
| GSVIVG00033408001 | • | • | • | 0.585 | |||||||
| GSVIVG00021307001 | • | • | • | 0.580 | |||||||
| GSVIVG00021349001 | • | • | 0.577 | ||||||||
| GSVIVG00028481001 | • | • | • | 0.568 | |||||||
| GSVIVG00036355001 | • | 0.557 | |||||||||
| GSVIVG00018070001 | • | • | • | 0.541 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1810 | |||
| cd05708 | 77 | cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: | 8e-30 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 6e-28 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 5e-27 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 1e-25 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 3e-25 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 2e-24 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 2e-24 | |
| cd05694 | 74 | cd05694, S1_Rrp5_repeat_hs2_sc2, S1_Rrp5_repeat_hs | 2e-23 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 4e-23 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 2e-22 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 4e-22 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 6e-22 | |
| cd05703 | 73 | cd05703, S1_Rrp5_repeat_hs12_sc9, S1_Rrp5_repeat_h | 1e-21 | |
| cd05695 | 66 | cd05695, S1_Rrp5_repeat_hs3, S1_Rrp5_repeat_hs3: R | 4e-21 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 1e-20 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 2e-18 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 3e-18 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 3e-18 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 5e-18 | |
| cd05702 | 70 | cd05702, S1_Rrp5_repeat_hs11_sc8, S1_Rrp5_repeat_h | 6e-18 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 6e-17 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 9e-17 | |
| cd05693 | 100 | cd05693, S1_Rrp5_repeat_hs1_sc1, S1_Rrp5_repeat_hs | 1e-16 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 2e-16 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 9e-16 | |
| cd05707 | 68 | cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: | 7e-15 | |
| cd05688 | 68 | cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: R | 9e-15 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 2e-14 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 2e-14 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 3e-14 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 1e-13 | |
| cd05692 | 69 | cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: R | 1e-13 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 1e-13 | |
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 2e-13 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 3e-13 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 6e-13 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 2e-12 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 2e-12 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 3e-12 | |
| COG1098 | 129 | COG1098, VacB, Predicted RNA binding protein (cont | 3e-12 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 4e-12 | |
| PRK08059 | 123 | PRK08059, PRK08059, general stress protein 13; Val | 4e-12 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 1e-11 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 1e-11 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 1e-11 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 1e-11 | |
| cd05684 | 79 | cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N | 2e-11 | |
| PRK07400 | 318 | PRK07400, PRK07400, 30S ribosomal protein S1; Revi | 3e-11 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 7e-11 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 7e-11 | |
| cd04471 | 83 | cd04471, S1_RNase_R, S1_RNase_R: RNase R C-termina | 9e-11 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 1e-10 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 2e-10 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 2e-10 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 3e-10 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 3e-10 | |
| PRK03987 | 262 | PRK03987, PRK03987, translation initiation factor | 3e-10 | |
| COG1093 | 269 | COG1093, SUI2, Translation initiation factor 2, al | 3e-10 | |
| cd04452 | 76 | cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha sub | 4e-10 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 5e-10 | |
| cd05690 | 69 | cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: R | 5e-10 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 6e-10 | |
| cd05697 | 69 | cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: R | 6e-10 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 7e-10 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 1e-09 | |
| COG2183 | 780 | COG2183, Tex, Transcriptional accessory protein [T | 1e-09 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 2e-09 | |
| cd05697 | 69 | cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: R | 2e-09 | |
| cd05685 | 68 | cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain | 2e-09 | |
| cd05708 | 77 | cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: | 3e-09 | |
| TIGR02063 | 709 | TIGR02063, RNase_R, ribonuclease R | 5e-09 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 6e-09 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 6e-09 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 7e-09 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 7e-09 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 8e-09 | |
| PRK05807 | 136 | PRK05807, PRK05807, hypothetical protein; Provisio | 1e-08 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 2e-08 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 2e-08 | |
| cd05691 | 73 | cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: R | 2e-08 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 3e-08 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 3e-08 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 4e-08 | |
| COG2183 | 780 | COG2183, Tex, Transcriptional accessory protein [T | 5e-08 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 6e-08 | |
| cd04472 | 68 | cd04472, S1_PNPase, S1_PNPase: Polynucleotide phos | 7e-08 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 1e-07 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 1e-07 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 1e-07 | |
| PRK07252 | 120 | PRK07252, PRK07252, hypothetical protein; Provisio | 1e-07 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 2e-07 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 2e-07 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 2e-07 | |
| cd05696 | 71 | cd05696, S1_Rrp5_repeat_hs4, S1_Rrp5_repeat_hs4: R | 3e-07 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 5e-07 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 5e-07 | |
| cd05705 | 74 | cd05705, S1_Rrp5_repeat_hs14, S1_Rrp5_repeat_hs14: | 5e-07 | |
| COG0557 | 706 | COG0557, VacB, Exoribonuclease R [Transcription] | 5e-07 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 1e-06 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 2e-06 | |
| cd05693 | 100 | cd05693, S1_Rrp5_repeat_hs1_sc1, S1_Rrp5_repeat_hs | 2e-06 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 2e-06 | |
| cd05686 | 73 | cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-b | 4e-06 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 5e-06 | |
| COG5107 | 660 | COG5107, RNA14, Pre-mRNA 3'-end processing (cleava | 6e-06 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 7e-06 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 9e-06 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 9e-06 | |
| cd05689 | 72 | cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: R | 9e-06 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 1e-05 | |
| PLN00207 | 891 | PLN00207, PLN00207, polyribonucleotide nucleotidyl | 1e-05 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 3e-05 | |
| cd05691 | 73 | cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: R | 3e-05 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 4e-05 | |
| cd05703 | 73 | cd05703, S1_Rrp5_repeat_hs12_sc9, S1_Rrp5_repeat_h | 5e-05 | |
| cd05685 | 68 | cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain | 5e-05 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 6e-05 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 6e-05 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 7e-05 | |
| cd05706 | 73 | cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: | 7e-05 | |
| PRK11642 | 813 | PRK11642, PRK11642, exoribonuclease R; Provisional | 8e-05 | |
| cd05789 | 86 | cd05789, S1_Rrp4, S1_Rrp4: Rrp4 S1-like RNA-bindin | 8e-05 | |
| COG1098 | 129 | COG1098, VacB, Predicted RNA binding protein (cont | 9e-05 | |
| cd05704 | 72 | cd05704, S1_Rrp5_repeat_hs13, S1_Rrp5_repeat_hs13: | 9e-05 | |
| cd05697 | 69 | cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: R | 1e-04 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 2e-04 | |
| cd05707 | 68 | cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: | 2e-04 | |
| PRK08582 | 139 | PRK08582, PRK08582, hypothetical protein; Provisio | 2e-04 | |
| cd05707 | 68 | cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: | 5e-04 | |
| cd05707 | 68 | cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: | 5e-04 | |
| cd05692 | 69 | cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: R | 5e-04 | |
| TIGR00358 | 654 | TIGR00358, 3_prime_RNase, VacB and RNase II family | 5e-04 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 6e-04 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 6e-04 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 6e-04 | |
| cd05702 | 70 | cd05702, S1_Rrp5_repeat_hs11_sc8, S1_Rrp5_repeat_h | 8e-04 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 8e-04 | |
| pfam05843 | 271 | pfam05843, Suf, Suppressor of forked protein (Suf) | 9e-04 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 0.001 | |
| COG1098 | 129 | COG1098, VacB, Predicted RNA binding protein (cont | 0.001 | |
| cd05697 | 69 | cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: R | 0.001 | |
| PRK04163 | 235 | PRK04163, PRK04163, exosome complex RNA-binding pr | 0.001 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 0.002 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 0.002 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 0.002 | |
| cd05706 | 73 | cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: | 0.002 | |
| cd05707 | 68 | cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: | 0.003 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 0.003 | |
| cd05706 | 73 | cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: | 0.003 | |
| cd05706 | 73 | cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: | 0.003 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 0.004 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 0.004 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 0.004 |
| >gnl|CDD|240213 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
Score = 113 bits (284), Expect = 8e-30
Identities = 40/77 (51%), Positives = 59/77 (76%)
Query: 1342 HVGDIVIGQIKRVESYGLFITIENTNLVGLCHVSELSEDHVDNIETIYRAGEKVKVKILK 1401
VG + G ++RVE YG+FI I+ TN+ GLCH SE+S++ V + ++R G+KV+ K+LK
Sbjct: 1 KVGQKIDGTVRRVEDYGVFIDIDGTNVSGLCHKSEISDNRVADASKLFRVGDKVRAKVLK 60
Query: 1402 VDKEKRRISLGMKSSYF 1418
+D EK+RISLG+K+SYF
Sbjct: 61 IDAEKKRISLGLKASYF 77
|
Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 12 (sc12). Rrp5 is found in eukaryotes but not in prokaryotes or archaea. Length = 77 |
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|240199 cd05694, S1_Rrp5_repeat_hs2_sc2, S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240208 cd05703, S1_Rrp5_repeat_hs12_sc9, S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240200 cd05695, S1_Rrp5_repeat_hs3, S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240207 cd05702, S1_Rrp5_repeat_hs11_sc8, S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|240198 cd05693, S1_Rrp5_repeat_hs1_sc1, S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240212 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240193 cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|240197 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|181215 PRK08059, PRK08059, general stress protein 13; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240189 cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >gnl|CDD|180960 PRK07400, PRK07400, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239917 cd04471, S1_RNase_R, S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|235188 PRK03987, PRK03987, translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224018 COG1093, SUI2, Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|239899 cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240195 cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240202 cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|225094 COG2183, Tex, Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240202 cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240190 cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >gnl|CDD|240213 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|233703 TIGR02063, RNase_R, ribonuclease R | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235614 PRK05807, PRK05807, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240196 cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|225094 COG2183, Tex, Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|239918 cd04472, S1_PNPase, S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180908 PRK07252, PRK07252, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240201 cd05696, S1_Rrp5_repeat_hs4, S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240210 cd05705, S1_Rrp5_repeat_hs14, S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|223631 COG0557, VacB, Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240198 cd05693, S1_Rrp5_repeat_hs1_sc1, S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240191 cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227438 COG5107, RNA14, Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240194 cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215104 PLN00207, PLN00207, polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240196 cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240208 cd05703, S1_Rrp5_repeat_hs12_sc9, S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240190 cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240211 cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|236944 PRK11642, PRK11642, exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240215 cd05789, S1_Rrp4, S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240209 cd05704, S1_Rrp5_repeat_hs13, S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240202 cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240212 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|236305 PRK08582, PRK08582, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240212 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240212 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240197 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|232937 TIGR00358, 3_prime_RNase, VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240207 cd05702, S1_Rrp5_repeat_hs11_sc8, S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|218774 pfam05843, Suf, Suppressor of forked protein (Suf) | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|240202 cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|235233 PRK04163, PRK04163, exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240211 cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240212 cd05707, S1_Rrp5_repeat_sc11, S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240211 cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240211 cd05706, S1_Rrp5_repeat_sc10, S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1810 | |||
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 100.0 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 100.0 | |
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 100.0 | |
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 100.0 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 100.0 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 100.0 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 100.0 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 100.0 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 100.0 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 100.0 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 100.0 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 100.0 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 100.0 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 99.98 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 99.91 | |
| KOG1915 | 677 | consensus Cell cycle control protein (crooked neck | 99.9 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 99.86 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 99.82 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 99.77 | |
| KOG2047 | 835 | consensus mRNA splicing factor [RNA processing and | 99.73 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.7 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 99.69 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.67 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.66 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.66 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 99.66 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 99.66 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.65 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.61 | |
| PTZ00248 | 319 | eukaryotic translation initiation factor 2 subunit | 99.58 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.58 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.57 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 99.57 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 99.57 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 99.57 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.56 | |
| COG1098 | 129 | VacB Predicted RNA binding protein (contains ribos | 99.55 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 99.54 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 99.54 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 99.53 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 99.5 | |
| COG1098 | 129 | VacB Predicted RNA binding protein (contains ribos | 99.49 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.49 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.47 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 99.47 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.45 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.44 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 99.43 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.43 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 99.43 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 99.41 | |
| PTZ00248 | 319 | eukaryotic translation initiation factor 2 subunit | 99.41 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 99.4 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.4 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 99.4 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 99.4 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 99.4 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.39 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.38 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 99.37 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 99.37 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 99.37 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 99.36 | |
| cd05693 | 100 | S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp | 99.35 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 99.35 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 99.33 | |
| KOG1258 | 577 | consensus mRNA processing protein [RNA processing | 99.33 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 99.32 | |
| PF05843 | 280 | Suf: Suppressor of forked protein (Suf); InterPro: | 99.32 | |
| cd05703 | 73 | S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R | 99.32 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 99.31 | |
| cd05703 | 73 | S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R | 99.3 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 99.3 | |
| KOG1914 | 656 | consensus mRNA cleavage and polyadenylation factor | 99.29 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.27 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 99.27 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 99.26 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 99.24 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 99.23 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 99.22 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 99.22 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 99.21 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 99.21 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 99.21 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 99.19 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 99.19 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 99.19 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 99.19 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 99.19 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 99.18 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 99.18 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 99.18 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.18 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 99.17 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.17 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 99.17 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 99.16 | |
| cd05708 | 77 | S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a | 99.16 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 99.16 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 99.14 | |
| COG5107 | 660 | RNA14 Pre-mRNA 3'-end processing (cleavage and pol | 99.14 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 99.13 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 99.12 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 99.12 | |
| cd05693 | 100 | S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp | 99.11 | |
| KOG1258 | 577 | consensus mRNA processing protein [RNA processing | 99.1 | |
| cd04452 | 76 | S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr | 99.1 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 99.09 | |
| cd05708 | 77 | S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a | 99.08 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 99.08 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 99.08 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 99.08 | |
| cd04452 | 76 | S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr | 99.08 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 99.07 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 99.06 | |
| cd05695 | 66 | S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t | 99.05 | |
| COG5107 | 660 | RNA14 Pre-mRNA 3'-end processing (cleavage and pol | 99.05 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 99.05 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 99.04 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 99.03 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 99.03 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 99.02 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 99.02 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.01 | |
| cd05695 | 66 | S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t | 99.0 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 99.0 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 99.0 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 99.0 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 98.99 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 98.98 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.98 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 98.97 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 98.97 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 98.97 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 98.97 | |
| PRK08059 | 123 | general stress protein 13; Validated | 98.95 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.95 | |
| PRK08059 | 123 | general stress protein 13; Validated | 98.95 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 98.95 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 98.94 | |
| cd04465 | 67 | S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib | 98.94 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.92 | |
| PHA02945 | 88 | interferon resistance protein; Provisional | 98.92 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 98.92 | |
| PLN02789 | 320 | farnesyltranstransferase | 98.92 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 98.91 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.91 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 98.91 | |
| KOG0128 | 881 | consensus RNA-binding protein SART3 (RRM superfami | 98.9 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.9 | |
| cd05685 | 68 | S1_Tex S1_Tex: The C-terminal S1 domain of a trans | 98.9 | |
| cd05685 | 68 | S1_Tex S1_Tex: The C-terminal S1 domain of a trans | 98.88 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 98.88 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 98.88 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 98.87 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.86 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.85 | |
| cd04465 | 67 | S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib | 98.85 | |
| PHA02945 | 88 | interferon resistance protein; Provisional | 98.85 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.85 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 98.84 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 98.83 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.82 | |
| cd05699 | 72 | S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t | 98.8 | |
| cd05789 | 86 | S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. | 98.8 | |
| cd05688 | 68 | S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p | 98.8 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.79 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.79 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.79 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.78 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 98.78 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 98.78 | |
| KOG0128 | 881 | consensus RNA-binding protein SART3 (RRM superfami | 98.78 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.77 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 98.76 | |
| cd05688 | 68 | S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p | 98.76 | |
| COG1093 | 269 | SUI2 Translation initiation factor 2, alpha subuni | 98.76 | |
| cd04471 | 83 | S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai | 98.76 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.76 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 98.75 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 98.75 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 98.75 | |
| cd05789 | 86 | S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. | 98.74 | |
| COG2183 | 780 | Tex Transcriptional accessory protein [Transcripti | 98.73 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 98.73 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 98.73 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 98.72 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 98.72 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 98.72 | |
| PRK03987 | 262 | translation initiation factor IF-2 subunit alpha; | 98.7 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.69 | |
| COG2183 | 780 | Tex Transcriptional accessory protein [Transcripti | 98.69 | |
| COG1093 | 269 | SUI2 Translation initiation factor 2, alpha subuni | 98.68 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 98.68 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 98.67 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 98.67 | |
| cd04471 | 83 | S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai | 98.66 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.66 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 98.66 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 98.66 | |
| PRK09521 | 189 | exosome complex RNA-binding protein Csl4; Provisio | 98.65 | |
| PRK03987 | 262 | translation initiation factor IF-2 subunit alpha; | 98.64 | |
| cd05702 | 70 | S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R | 98.63 | |
| cd05702 | 70 | S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R | 98.62 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 98.62 | |
| cd04454 | 82 | S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- | 98.62 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 98.6 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 98.59 | |
| cd04454 | 82 | S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- | 98.56 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 98.56 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 98.55 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.55 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.54 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 98.54 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 98.51 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 98.49 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 98.49 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 98.47 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 98.46 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.45 | |
| COG3071 | 400 | HemY Uncharacterized enzyme of heme biosynthesis [ | 98.42 | |
| PRK09521 | 189 | exosome complex RNA-binding protein Csl4; Provisio | 98.42 | |
| cd05699 | 72 | S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t | 98.41 | |
| cd04460 | 99 | S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. | 98.4 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 98.37 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.37 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 98.37 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 98.35 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 98.3 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 98.3 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 98.3 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 98.29 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 98.29 | |
| KOG2396 | 568 | consensus HAT (Half-A-TPR) repeat-containing prote | 98.27 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 98.26 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 98.25 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.23 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 98.22 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 98.21 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.21 | |
| cd04460 | 99 | S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. | 98.2 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 98.2 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 98.18 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 98.17 | |
| cd04455 | 67 | S1_NusA S1_NusA: N-utilizing substance A protein ( | 98.17 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.17 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 98.17 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 98.15 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.15 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 98.14 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.14 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 98.13 | |
| cd04455 | 67 | S1_NusA S1_NusA: N-utilizing substance A protein ( | 98.11 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 98.11 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 98.09 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 98.08 | |
| COG1095 | 183 | RPB7 DNA-directed RNA polymerase, subunit E' [Tran | 98.06 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 98.05 | |
| TIGR00448 | 179 | rpoE DNA-directed RNA polymerase (rpoE), archaeal | 98.05 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 98.05 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.04 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 98.04 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 98.01 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 98.01 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 97.96 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 97.93 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 97.92 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 97.91 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 97.91 | |
| PRK04841 | 903 | transcriptional regulator MalT; Provisional | 97.91 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 97.9 | |
| TIGR00448 | 179 | rpoE DNA-directed RNA polymerase (rpoE), archaeal | 97.9 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 97.86 | |
| cd05791 | 92 | S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. | 97.86 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 97.86 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 97.85 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 97.85 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 97.84 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.82 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.82 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 97.81 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 97.79 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.79 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 97.79 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 97.79 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.78 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.77 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 97.77 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 97.76 | |
| cd05791 | 92 | S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. | 97.76 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 97.75 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 97.74 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 97.73 | |
| PRK08563 | 187 | DNA-directed RNA polymerase subunit E'; Provisiona | 97.73 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 97.73 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 97.72 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 97.71 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.71 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 97.7 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.69 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.69 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.68 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.68 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.68 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 97.68 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 97.68 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 97.62 | |
| KOG3617 | 1416 | consensus WD40 and TPR repeat-containing protein [ | 97.62 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 97.62 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 97.6 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 97.6 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 97.59 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 97.58 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 97.57 | |
| COG5191 | 435 | Uncharacterized conserved protein, contains HAT (H | 97.57 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 97.56 | |
| KOG3785 | 557 | consensus Uncharacterized conserved protein [Funct | 97.56 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 97.53 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 97.52 | |
| COG1095 | 183 | RPB7 DNA-directed RNA polymerase, subunit E' [Tran | 97.51 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 97.5 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 97.48 | |
| PHA02858 | 86 | EIF2a-like PKR inhibitor; Provisional | 97.48 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 97.47 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 97.45 | |
| PRK08563 | 187 | DNA-directed RNA polymerase subunit E'; Provisiona | 97.43 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 97.39 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 97.37 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 97.34 | |
| COG4700 | 251 | Uncharacterized protein conserved in bacteria cont | 97.33 | |
| cd04462 | 88 | S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly | 97.3 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 97.29 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 97.29 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 97.27 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 97.19 | |
| PF08311 | 126 | Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro | 97.17 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 97.16 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 97.13 | |
| cd05700 | 65 | S1_Rrp5_repeat_hs9 S1_Rrp5_repeat_hs9: Rrp5 is a t | 97.1 | |
| cd05701 | 69 | S1_Rrp5_repeat_hs10 S1_Rrp5_repeat_hs10: Rrp5 is a | 97.06 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 97.04 | |
| PHA02858 | 86 | EIF2a-like PKR inhibitor; Provisional | 97.01 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 96.99 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 96.95 | |
| PF08311 | 126 | Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro | 96.95 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 96.94 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 96.93 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 96.92 | |
| cd04462 | 88 | S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly | 96.9 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 96.89 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 96.87 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 96.87 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 96.83 | |
| PTZ00162 | 176 | DNA-directed RNA polymerase II subunit 7; Provisio | 96.69 | |
| KOG1464 | 440 | consensus COP9 signalosome, subunit CSN2 [Posttran | 96.65 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 96.58 | |
| COG1729 | 262 | Uncharacterized protein conserved in bacteria [Fun | 96.57 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 96.56 | |
| PF10447 | 82 | EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I | 96.56 | |
| COG3898 | 531 | Uncharacterized membrane-bound protein [Function u | 96.54 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 96.54 | |
| COG4105 | 254 | ComL DNA uptake lipoprotein [General function pred | 96.53 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 96.51 | |
| KOG3081 | 299 | consensus Vesicle coat complex COPI, epsilon subun | 96.48 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 96.46 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 96.42 | |
| KOG1856 | 1299 | consensus Transcription elongation factor SPT6 [RN | 96.41 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 96.39 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 96.38 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 96.34 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 96.34 | |
| KOG2916 | 304 | consensus Translation initiation factor 2, alpha s | 96.31 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 96.31 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 96.27 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 96.24 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 96.23 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 96.22 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 96.19 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 96.15 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 96.12 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 96.12 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 96.06 | |
| COG0557 | 706 | VacB Exoribonuclease R [Transcription] | 96.05 | |
| PTZ00162 | 176 | DNA-directed RNA polymerase II subunit 7; Provisio | 96.01 | |
| TIGR00757 | 414 | RNaseEG ribonuclease, Rne/Rng family. The C-termin | 95.99 | |
| cd05790 | 86 | S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai | 95.97 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 95.94 | |
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 95.9 | |
| cd05790 | 86 | S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai | 95.87 | |
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 95.84 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 95.83 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 95.78 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 95.75 | |
| KOG2916 | 304 | consensus Translation initiation factor 2, alpha s | 95.7 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 95.7 | |
| TIGR00757 | 414 | RNaseEG ribonuclease, Rne/Rng family. The C-termin | 95.65 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 95.65 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 95.64 | |
| KOG1856 | 1299 | consensus Transcription elongation factor SPT6 [RN | 95.61 | |
| smart00777 | 125 | Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region | 95.59 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 95.51 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 95.51 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 95.49 | |
| PF10447 | 82 | EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I | 95.45 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 95.35 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 95.3 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 95.27 | |
| KOG4340 | 459 | consensus Uncharacterized conserved protein [Funct | 95.2 | |
| KOG2041 | 1189 | consensus WD40 repeat protein [General function pr | 95.19 | |
| smart00777 | 125 | Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region | 95.18 | |
| KOG1586 | 288 | consensus Protein required for fusion of vesicles | 95.13 | |
| KOG1464 | 440 | consensus COP9 signalosome, subunit CSN2 [Posttran | 95.07 | |
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 94.98 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 94.9 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 94.88 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 94.83 | |
| COG0557 | 706 | VacB Exoribonuclease R [Transcription] | 94.78 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 94.75 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 94.58 | |
| PF02184 | 32 | HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 | 94.56 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 94.52 | |
| KOG1585 | 308 | consensus Protein required for fusion of vesicles | 94.45 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 94.42 | |
| KOG2796 | 366 | consensus Uncharacterized conserved protein [Funct | 94.42 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 94.32 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 94.28 | |
| PF02184 | 32 | HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 | 94.26 | |
| PF02259 | 352 | FAT: FAT domain; InterPro: IPR003151 The FAT domai | 94.25 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 94.19 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 94.09 | |
| KOG3616 | 1636 | consensus Selective LIM binding factor [Transcript | 94.05 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 94.0 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 93.8 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 93.79 | |
| KOG0890 | 2382 | consensus Protein kinase of the PI-3 kinase family | 93.71 | |
| PF10300 | 468 | DUF3808: Protein of unknown function (DUF3808); In | 93.68 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 93.34 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 93.1 | |
| smart00386 | 33 | HAT HAT (Half-A-TPR) repeats. Present in several R | 93.06 | |
| PF13281 | 374 | DUF4071: Domain of unknown function (DUF4071) | 93.06 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 92.97 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 92.64 | |
| PF03704 | 146 | BTAD: Bacterial transcriptional activator domain; | 92.34 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 92.19 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 91.64 | |
| PRK10811 | 1068 | rne ribonuclease E; Reviewed | 91.42 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 91.37 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 91.2 | |
| PRK10811 | 1068 | rne ribonuclease E; Reviewed | 91.16 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 91.0 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 90.97 | |
| KOG3824 | 472 | consensus Huntingtin interacting protein HYPE [Gen | 90.92 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 90.91 | |
| COG2909 | 894 | MalT ATP-dependent transcriptional regulator [Tran | 90.8 | |
| KOG2610 | 491 | consensus Uncharacterized conserved protein [Funct | 90.68 | |
| KOG0545 | 329 | consensus Aryl-hydrocarbon receptor-interacting pr | 90.42 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 90.22 | |
| COG1747 | 711 | Uncharacterized N-terminal domain of the transcrip | 90.07 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 89.92 | |
| KOG0985 | 1666 | consensus Vesicle coat protein clathrin, heavy cha | 89.82 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 89.28 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 89.17 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 89.1 | |
| KOG1538 | 1081 | consensus Uncharacterized conserved protein WDR10, | 89.01 | |
| KOG3298 | 170 | consensus DNA-directed RNA polymerase subunit E' [ | 88.93 | |
| KOG2471 | 696 | consensus TPR repeat-containing protein [General f | 88.91 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 88.76 | |
| PRK11712 | 489 | ribonuclease G; Provisional | 88.74 | |
| PRK11712 | 489 | ribonuclease G; Provisional | 87.99 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 87.78 | |
| KOG2422 | 665 | consensus Uncharacterized conserved protein [Funct | 87.77 | |
| PF04910 | 360 | Tcf25: Transcriptional repressor TCF25; InterPro: | 87.67 | |
| PF08292 | 122 | RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; I | 87.47 | |
| KOG3409 | 193 | consensus Exosomal 3'-5' exoribonuclease complex, | 87.46 | |
| PF10345 | 608 | Cohesin_load: Cohesin loading factor; InterPro: IP | 87.45 | |
| PF11207 | 203 | DUF2989: Protein of unknown function (DUF2989); In | 87.44 | |
| COG4649 | 221 | Uncharacterized protein conserved in bacteria [Fun | 87.3 | |
| KOG1130 | 639 | consensus Predicted G-alpha GTPase interaction pro | 87.17 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 86.79 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 86.77 | |
| KOG3298 | 170 | consensus DNA-directed RNA polymerase subunit E' [ | 86.67 | |
| PF10246 | 104 | MRP-S35: Mitochondrial ribosomal protein MRP-S35; | 86.43 | |
| PF10602 | 177 | RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 | 86.4 | |
| PF10246 | 104 | MRP-S35: Mitochondrial ribosomal protein MRP-S35; | 86.31 | |
| PF08292 | 122 | RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; I | 86.18 | |
| KOG2422 | 665 | consensus Uncharacterized conserved protein [Funct | 85.67 | |
| KOG3409 | 193 | consensus Exosomal 3'-5' exoribonuclease complex, | 85.57 | |
| PF04053 | 443 | Coatomer_WDAD: Coatomer WD associated region ; Int | 84.89 | |
| COG2976 | 207 | Uncharacterized protein conserved in bacteria [Fun | 84.76 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 84.53 | |
| KOG0890 | 2382 | consensus Protein kinase of the PI-3 kinase family | 84.36 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 84.3 | |
| KOG0687 | 393 | consensus 26S proteasome regulatory complex, subun | 83.83 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 83.66 |
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-176 Score=1628.92 Aligned_cols=1540 Identities=38% Similarity=0.576 Sum_probs=1262.1
Q ss_pred CCCCCcCcCcEEEEEEEEEecccEEEEcCCCcEEEEeccccCChhccccccccccCCCCCcccCCCEEEEEEEEeecccc
Q 000236 1 MYPQNISAGMKLWGVVAEVNEKDLVICLPGGLRGLARAADALDPILDNEIEANEDNLLPTIFHVGQLVSCIVLQLDDDKK 80 (1810)
Q Consensus 1 ~~~~~l~~G~~~lg~V~~i~~~~~~v~lp~~l~g~v~~~~is~~~~~~~~~~~~~~~l~~~f~~Gq~v~~~V~~~~~~~~ 80 (1810)
++|++++|||++||+|++|+..|+.+|+|++|+|+|+.+++|+.
T Consensus 109 ~~~k~isPG~~llgvIs~i~~~Dl~isv~~~l~g~v~~t~lS~~------------------------------------ 152 (1710)
T KOG1070|consen 109 FQLKNISPGMLLLGVISKINGNDLKISVKGGLNGYVLNTHLSDE------------------------------------ 152 (1710)
T ss_pred ccccccCCcceeeeeeeeccccceeEEccCcccccccccccCHh------------------------------------
Confidence 47899999999999999999999999999999999999999988
Q ss_pred ccCeeEEEEEechhhhccCCCcccccCCcEEEEEEEEEecceEEEEeCCCcceecccCCCCCCCCCCccCCCcEEEEEEE
Q 000236 81 EIGKRKIWLSLRLSLLYKGLSLETVQEGMVLTAYVKSIEDHGYILHFGLPSFTGFLPRNNLAENSGIDVKPGLLLQGVVR 160 (1810)
Q Consensus 81 ~~~~~~~~LS~~p~~vn~~l~~~~l~~g~~l~~~V~sved~G~i~d~G~~~~~gfl~~~~~~~~~~~~~~~G~~~~~~v~ 160 (1810)
.+.+||.|.+.|.|+||||+++|+|+...+||+.+.++. +.+..|++||+++|+|+
T Consensus 153 -----------------------~~~~~~~l~~~v~S~ed~g~~l~~g~~~~~~~~e~~q~p-n~~~~lKvGq~l~~~V~ 208 (1710)
T KOG1070|consen 153 -----------------------MLAAGEVLDTAVVSIEDHGAILDVGLDEITGFIEKSQFP-NLGAKLKVGQWLRVSVT 208 (1710)
T ss_pred -----------------------HhhhhhhhccccccccccccchhcCCccccchhhhccCc-hhhhhcccCceEEEEEE
Confidence 233688999999999999999999999999999999874 33347999999999999
Q ss_pred EEcCCCcEEEEccCccccccccccccccccccccCCCceEEEEEEEEecCeEEEEeCCCeEEEEeccccCCCCCCCCccc
Q 000236 161 SIDRTRKVVYLSSDPDTVSKCVTKDLKGISIDLLVPGMMVSTRVQSILENGVMLSFLTYFTGTVDIFHLQNTFPTTNWKN 240 (1810)
Q Consensus 161 ~~~~~~~~v~ls~~~~~~~~~~~~~~~~~~~~~l~pG~~v~~~V~~v~~~gl~v~~~~~~~G~v~~~~l~~~~~~~~~~~ 240 (1810)
++++ + .+.+|..+..+....+++.+.++++.|.|||+|.+.|.+|++||+.++|+++|+|+++..||.+++
T Consensus 209 k~~s-~-~v~ks~~~~~~~t~~~t~~~~~~~~~LvpGt~vqa~V~sv~~~Gi~~dil~~ftG~l~~~hl~~~~------- 279 (1710)
T KOG1070|consen 209 KSTS-E-RVVKSTKFVEVLTLNPTSCNGLALNDLVPGTMVQAEVQSVEDHGITLDILNGFTGFLDKKHLPPFL------- 279 (1710)
T ss_pred eccC-c-eEEecccceeeecccchhccccchhhcCCcceEEEEecceecCcEEEEecccccceeehhhCCchh-------
Confidence 9876 3 888999998888888888889999999999999999999999999999999999999999998774
Q ss_pred cCCCCCEEEEEEEEEeCCCCeEEEeeCchhccCCCCCCCCCCCCeEEeeEEEEEeCCceeEEEeCCCCCcccEEEeeccc
Q 000236 241 DYNQHKKVNARILFVDPTSRAVGLTLNPYLLHNRAPPSHVKVGDIYDQSKVVRVDRGLGLLLDIPSTPVSTPAYVTISDV 320 (1810)
Q Consensus 241 ~~~~G~~v~arVl~~~~~~~~v~LSl~p~~~~~~~~~~~~~~G~iv~~~~V~~v~~~~G~~v~i~~~~~~v~gfv~~s~~ 320 (1810)
.|..||...|.|+. +..+ ...++.++.+..+.+... |+..- +|-+.+
T Consensus 280 ~~~~~~~~l~~vi~--~s~R-------------------v~~~~f~~ka~ki~~l~~-~v~ai-----------~p~~~~ 326 (1710)
T KOG1070|consen 280 RYFENQEKLGKVIH--KSDR-------------------VFVVDFFDKASKILVLKA-GVDAI-----------APSRIE 326 (1710)
T ss_pred hccccHHHhhcccc--hhhh-------------------eeeechhhccceEEEecC-ccceE-----------ccCCcc
Confidence 48888888888643 1111 122333333333333343 44333 333222
Q ss_pred chHHHHhhcccccCCCEEEEEEEEEeecCCeEEEEeecccccccccccccCCCCCEEEEEEEEEecCceEEEeCCCeEEe
Q 000236 321 AEEEVRKLEKKYKEGSCVRVRILGFRHLEGLATGILKASAFEGLVFTHSDVKPGMVVKGKVIAVDSFGAIVQFPGGVKAL 400 (1810)
Q Consensus 321 ~~~~~~~~~~~~~vG~~~~~rV~~~~~~~~~~~~s~k~~~~~~~~~~~~~l~~G~~v~g~V~~v~~~G~~V~~~~~v~g~ 400 (1810)
. +-.. ..+++|..++|||+.+..++.++..+++.+.++.++..+.++.||.++.+.| ++..+ ..|+
T Consensus 327 ~---~~~~-e~~k~G~~~K~~vi~~~~~~~~~~~tl~~s~ie~k~~~~s~V~~r~l~~~~~-svdt~---------~~~l 392 (1710)
T KOG1070|consen 327 K---VLSF-EIFKIGNKVKCRVIDVLQMDSLALFTLKESAIEGKFSLVSDVSPRGLLKKPV-SVDTE---------EVGL 392 (1710)
T ss_pred c---ccch-hhcccCceEEEEEEEEeeccceEEeecchhhccCceEEEeccCCceEEEecc-cCChh---------hhhc
Confidence 1 1111 2489999999999999999999999999999999999999999999999998 77664 6789
Q ss_pred ccCCCCCcccccCCCCCcccCCEEEEEEEEEeCCeEEEEEcchhhcchhhHHhhhhhcCCCcEEEEEEEEEeeceEEEEE
Q 000236 401 CPLPHMSEFEIVKPGKKFKVGAELVFRVLGVKSKRITVTHKKTLVKSKLAILSSYAEATDRLITHGWITKIEKHGCFVRF 480 (1810)
Q Consensus 401 vp~~~ls~~~~~~~~~~~~vG~~v~~rVl~v~~~~i~ls~k~~l~~~~~~~~~~~~~~~~g~~~~g~V~~i~~~G~~V~~ 480 (1810)
+|..|+..+...+|+.+|..|..|.+|||.+..+++.+|+| .+..+++|.+..|.++.+ ..+|++.++.
T Consensus 393 ~~L~hv~~f~~a~p~~~~~~~~di~~~vl~~~ak~~~vt~~-v~~~sK~pvis~y~~~~~--~t~~~l~~v~-------- 461 (1710)
T KOG1070|consen 393 SPLPHVLGFEYADPSKKISDGKDIGFRVLTCKAKCGSVTLK-VLCVSKLPVISMYADAVK--LTHGMLSKVP-------- 461 (1710)
T ss_pred cccchhhceeecCCCcccccccceeeEEeeccceeeeeeee-eeEeecCcceEEEeeccc--cCcchhhccc--------
Confidence 99999999999999999999999999999999999999999 999999999999988766 6677776665
Q ss_pred cCCeEEEeeccccCCCCCCCCCcCccCCCEEEEEEEEEeCCCCeEEEEEeeCCC--CccccccccCCCeEEEEEEEEecC
Q 000236 481 YNGVQGFAPRSELGLDPGCEPSSMYHVGQVVKCRIMSSIPASRRINLSFMMKPT--RVSEDDLVKLGSLVSGVVDVVTPN 558 (1810)
Q Consensus 481 ~~~v~g~vp~s~~~~~~~~~~~~~~~~G~~v~~rVl~~d~~~~~l~lS~k~~~~--~~~~~~~~~~G~iv~g~V~~v~~~ 558 (1810)
.|++|+ |++|.++.|||.+|-+.++.+.+|+.++.. ......++++|++|+|+|.++++.
T Consensus 462 ----q~~v~~--------------~e~~te~~~rv~~v~~v~~v~~v~~~~svl~lk~~~~nDI~iG~~V~~~I~~vt~~ 523 (1710)
T KOG1070|consen 462 ----QGMVPI--------------YEVGTEVKSRVWQVFYVGKVVIVSVRESVLGLKFLRVNDIEIGQLVPGVIRKVTPQ 523 (1710)
T ss_pred ----cCCCCc--------------eecCCcccCccceecccCcEEEEEEehHhhcccccccccccccceeeeEEEEecCC
Confidence 555554 556666666666666666666666654422 344556799999999999999999
Q ss_pred cEEEEEEecCceeEEEecccccCcccccccccccccCCCeEeeEEEeecCCCeEEEeccchhcchhccCCCccccCCCCC
Q 000236 559 AVVVYVIAKGYSKGTIPTEHLADHLEHATVMKSVIKPGYEFDQLLVLDNESSNLLLSAKYSLINSAQQLPSDASHIHPNS 638 (1810)
Q Consensus 559 g~~V~l~~~~~~~g~i~~~~lsd~~~~~~~~~~~~k~G~~i~~vl~id~~~~~v~ls~K~~l~~~~~~~~~~~~~~~~G~ 638 (1810)
|+.|.+. .+++.|++|..||+|++.+.+.+..++..|.++ |+|.++.+.+++.|++|++|++...++|.+|+++.+|+
T Consensus 524 Gv~v~v~-~~ni~g~lp~~hlsd~~~~~p~~~f~v~~~~k~-RVl~~~~~~~~v~l~~K~slv~~~~plp~d~~~~~pg~ 601 (1710)
T KOG1070|consen 524 GVEVLVT-FGNIKGVLPKEHLSDHPLQPPLRDFKVGSGVKL-RVLSVNRDRNRVALTLKKSLVNTQLPLPSDFEQAIPGK 601 (1710)
T ss_pred cEEEEEe-cCceeeecChHhhhhcccccccceeeeccccEE-EEEEEEccCCeeEEEechhhhcccCCCccchhhcCCCc
Confidence 9999995 466999999999999999999988888888888 89999999999999999999999889999999999999
Q ss_pred EEEEEEEEEecCeEEEEECCCeEEEeeCCccCcccccCcccCcCCCCEEEEEEEEeeCCCCeEEEeecccccCCCChhhH
Q 000236 639 VVHGYVCNIIETGCFVRFLGRLTGFAPRSKAVDGQRADLSKTYYVGQSVRSNILDVNSETGRITLSLKQSCCSSTDASFM 718 (1810)
Q Consensus 639 ~~~G~V~~i~~~G~fV~f~~gv~Glv~~s~ls~~~~~~~~~~~~~Gq~V~~~V~~vd~~~~rl~lSlk~~~~~~~~~~~~ 718 (1810)
++.|++.++.++||||+|+||++||+|.+++++.|+.+++++|.+||||.|+|+++|++++||.|+++.+.|+.++..+.
T Consensus 602 ~~~G~l~~~~~~g~~V~F~g~lsGf~p~s~~sd~~v~~~~ehf~vGqTv~~~i~nvd~ek~rm~l~~r~s~~~~a~~~~~ 681 (1710)
T KOG1070|consen 602 ITKGTLCAIKENGAFVTFTGGLSGFAPVSEMSDDFVLSDSEHFPVGQTVRAKIVNVDDEKRRMPLGLRASSCARACVKRS 681 (1710)
T ss_pred eEEEEEeeeccCCeEEEecCccccccchhhhhhhhhcChhhhcccccEEEEEEEecCchhceeehhhhhhhhHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999998744332222
Q ss_pred HHHHHHHHHHHHhhcccCCCcccccccccccccEEEEEEEEeecceeEEEecccCceeEEEeeeeccCc-----------
Q 000236 719 QEHFLLEEKIAMLQSSKHNGSELKWVEGFIIGSVIEGKVHESNDFGVVVSFEEHSDVYGFITHHQLAGA----------- 787 (1810)
Q Consensus 719 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~v~~~V~~~~~~g~~v~l~~~~~v~g~i~~~~ls~~----------- 787 (1810)
. +.+..|.+..+.+.+++.+.++|++.+. ++.|++...||.|+
T Consensus 682 ~-------------------------e~~~~g~v~s~~~~~~tkd~viVei~~~-~~~~v~~~~~L~dg~v~~~~~~~~k 735 (1710)
T KOG1070|consen 682 V-------------------------ENFVKGGVKSLKSIDKTKDSVIVEIVDQ-GITGVGVFGELVDGSVVVNKVLENK 735 (1710)
T ss_pred H-------------------------HHhhccccccceeehhccccEEEEccCc-ceEEEEEEEEEccCceEEccchhhh
Confidence 2 3355566777777777777788888774 78888888888763
Q ss_pred --------cccCCCeEEEEEEEeecccceEEEeehhhhhhhhhhcchhhHHhHhhhhhccccccCCcceEEEEEEEEeee
Q 000236 788 --------TVESGSVIQAAILDVAKAERLVDLSLKTVFIDRFREANSNRQAQKKKRKREASKDLGVHQTVNAIVEIVKEN 859 (1810)
Q Consensus 788 --------~~~~G~~v~~~vl~~~~~~~~v~ls~k~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~g~~v~g~V~~i~~~ 859 (1810)
.+.+|+...++|++++..++.+.+++++.|...+ .++..|....++|++|...
T Consensus 736 l~~~t~~~~lv~gq~~~~~i~~isl~k~lv~~s~~~~L~~~~-------------------~~l~k~~~~~~~v~~is~~ 796 (1710)
T KOG1070|consen 736 LRKNTSLLHLVVGQVTVGVILSISLKKSLVLISLCTDLPNNA-------------------TKLLKGSYALALVRSISKE 796 (1710)
T ss_pred hhhcchhheeeecceeEEEEEEeehhhhhhhccccccccchH-------------------HHHhcCchhHHHHHhhhhh
Confidence 3678999999999999888888888888776543 3477788889999999999
Q ss_pred eEEEeecCCcceEEEeeeecCC-CCCCCcccccCCCeEEEEEeecCCCCcccceeheehh------------cc-ccccc
Q 000236 860 YLVLSLPEYNHSIGYASVSDYN-TQKFPQKQFLNGQSVIATVMALPSSSTAGRLLLLLKA------------IS-ETETS 925 (1810)
Q Consensus 860 ~v~v~~~~~~~~~g~~~~~~~~-~~~~~~~~f~~Gq~v~a~V~~~~~~~~~~~~~l~~~~------------~~-~~~~~ 925 (1810)
+.|++| .++++++++.+|.+ ....+......||+|.+....++. ......+.... .. ..+-.
T Consensus 797 ~~~~a~--~~~~i~~v~~s~~v~s~~~d~~~~~y~Q~v~~~~~st~~--~~~~~~~a~e~p~~K~~~~~~~~~~~~~d~~ 872 (1710)
T KOG1070|consen 797 GKFVAF--VSNLIALVKVSHLVDSELDDLTKAEYGQSVTVKLLSTEP--KVVKDLKAVEKPKKKKEKKFIKVSSNDSDNE 872 (1710)
T ss_pred eeheee--cccccceeeccccccccccccceeeeecccceEEEecCh--hHHHHHHhhcchhhccceeEEEeccccCCCc
Confidence 999999 56699999999976 444455667778999999988763 11111111100 00 10111
Q ss_pred cccccccCCCCCCcceEEEEEEEEeCCeEEEEeCCCeeEEEEeeeecCCcCccccCcCcCCCCCCEEEEEEEEeee-c--
Q 000236 926 SSKRAKKKSSYDVGSLVQAEITEIKPLELRLKFGIGFHGRIHITEVNDDKSNVVENLFSNFKIGQTVTARIIAKSN-K-- 1002 (1810)
Q Consensus 926 ~~~~~~~~~~~~~G~~v~~~V~~i~~~~~~v~l~~~~~G~v~~~e~~d~~~~~~~~p~~~~~~G~~v~~~Vl~~~~-~-- 1002 (1810)
-..+.++.+++.+|.++.|+|++|++++++|.++.+.+||||++|++|+..++ ..|+++|++|+.|.++|++.+. +
T Consensus 873 Vd~a~k~~~~~~igsiv~a~v~svKp~~L~v~l~~~~~gri~isev~d~~~ei-tDp~~k~~vG~~I~vrviG~~D~k~l 951 (1710)
T KOG1070|consen 873 VDLAIKSTEDLSIGSIVRAYVKSVKPDQLNVLLAANHHGRIHISEVLDNLHEI-TDPLDKFKVGDGIFVRVIGGHDVKDL 951 (1710)
T ss_pred cccccccccceeeeeEEEEEEeeecccceEEeccccccCceehHHhhcccccc-CChhhhcccCCeEEEEEEcCCccccC
Confidence 11345677899999999999999999999999999999999999999988765 4499999999999999999851 0
Q ss_pred ---CCCCCcceEEEEeccCCccccccCCcccccccccCCCCEEEEEEEEEeCCEEEEEeCCCeEEEEEccccCCCCchhh
Q 000236 1003 ---PDMKKSFLWELSIKPSMLTVSEIGSKLLFEECDVSIGQRVTGYVYKVDNEWALLTISRHLKAQLFILDSAYEPSELQ 1079 (1810)
Q Consensus 1003 ---~~~~~~~~~~lS~r~~~~~~~~~~~~~~~~~~~~~~G~~v~g~V~~v~~~~~~v~l~~~~~g~l~~~~~~~~~~~~~ 1079 (1810)
....+..++|||+||+.++......+ +.. +++.||.|+|+|.++..+++|+.++|.++||||+.+++.+...++
T Consensus 952 pith~i~k~~v~ElSvkps~les~~~~t~-s~~--q~~~gq~vtGfV~nv~ke~~w~~isp~v~~RIplld~s~~~~~le 1028 (1710)
T KOG1070|consen 952 PITHLISKEQVLELSVKPSELESDEFNTT-STK--QFKAGQEVTGFVNNVSKEWLWVRISPFVDGRIPLLDTSLDLHVLE 1028 (1710)
T ss_pred ccccccchhhhhhhccChhhhcccccccc-chh--hhhcCCeEEEEEEccccceeEEEccccccceeeeeeccchhhhhh
Confidence 01233578999999999883321111 222 479999999999999999999999999999999999998888889
Q ss_pred hhcccCCCCcEEEEEEEEEeCCCcEEEEEecccccCCCCcccccccccccccccCCCEEEEEEEEEeeCcCeEEEEeCCc
Q 000236 1080 EFQRRFHIGKAVTGHVLSINKEKKLLRLVLRPFQDGISDKTVDISNDNMQTFIHEGDIVGGRISKILSGVGGLVVQIGPH 1159 (1810)
Q Consensus 1080 ~~~~~~~vG~~v~~~V~~~~~~~~~~~Ls~~~~~~~~~~~~~~~~~~~~~~~l~~G~~v~g~V~~i~~~~~g~~V~l~~~ 1159 (1810)
+|.+.|++|+.++++|+..+.. ..+++..... .... ..+|++..|+|.++.++ ++.++++.+
T Consensus 1029 ~~e~~F~~g~al~~~V~~~~~~---~tv~~iG~~~--------~~k~-----~s~G~~l~Grv~kv~~~--~~~l~~~~~ 1090 (1710)
T KOG1070|consen 1029 LPESLFPLGKALDEYVVRNDKS---KTVRAIGFSK--------SDKN-----PSPGDILFGRVSKVLPG--YLILQLPFK 1090 (1710)
T ss_pred CchhhcccccceeeEEecccce---eEEEeccccc--------CCCC-----CCcchhhcceeeeeccc--eeEEecCCc
Confidence 9999999999999999997732 2233222210 0111 12899999999999998 899999999
Q ss_pred eEEEEecc-cccccccCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEeecCCCCcceEEEeecccccCCCCCCCCCCCCCC
Q 000236 1160 LYGRVHFT-ELKNICVSDPLSGYDEGQFDPLSGYDEGQFVKCKVLEISRTVRGTFHVELSLRSSLDGMSSTNSSDLSTDV 1238 (1810)
Q Consensus 1160 ~~G~i~~s-el~d~~~~~~~~~~~~~~~~p~~~~~~G~~v~~~Vl~~~~~~~g~~~l~lS~r~~~~~~~~~~~~~~~~~~ 1238 (1810)
..|+++.. +++++|..+ |...|..++.+.+.+|.++.. ++.++||+|.+++.+. ..
T Consensus 1091 ~~G~~~~i~~~~d~~~~~-----------P~~~f~~~~~v~~~~L~vs~~---n~~leLslr~sr~~~t---------~~ 1147 (1710)
T KOG1070|consen 1091 VFGRVSFIEDMSDSYSMT-----------PVEHFTKIQIVYVCVLSVSAL---NKGLELSLRESRTKIT---------PV 1147 (1710)
T ss_pred cccceEEeeehhccccCC-----------hHHhcccccEEEEEEEEEecc---cccceeecccccccCc---------cc
Confidence 99988855 999999887 889999999999999999876 3449999998873322 22
Q ss_pred CCCcccccccccCCCCCEEEEEEEEEeeceEEEEeCCCcEEEEEcccCCCcccCCccccCCCCcEEEEEEEEEeCCCCEE
Q 000236 1239 DTPGKHLEKIEDLSPNMIVQGYVKNVTSKGCFIMLSRKLDAKVLLSNLSDGYVESPEKEFPIGKLVAGRVLSVEPLSKRV 1318 (1810)
Q Consensus 1239 ~~~~~~~~~~~~l~~G~~v~G~V~~v~~~G~fV~l~~~v~g~v~~s~ls~~~~~~~~~~f~~G~~V~~~Vl~vd~~~~ri 1318 (1810)
...++.+..++++++|++++|+|.++.+.|+|+.+++++.|+++++++++.+...|+..|++|+.|.++|+++++..+|+
T Consensus 1148 ~~kd~~iks~eDlk~g~iv~G~V~nv~~~glfi~ls~~v~a~v~is~~~ds~~k~w~k~~~~gklv~~rv~~ve~~s~ri 1227 (1710)
T KOG1070|consen 1148 DSKDGSIKSIEDLKIGDIVRGFVKNVETKGLFIALSRKVEAFVPISGLSDSFEKEWEKHLPVGKLVTGRVLSVEEDSKRI 1227 (1710)
T ss_pred cccCCcccchhhcccCceeEEEEEEecCCcEEEEEccceEEEEEccccccchhhhhhccCCccceeeeEEEEeeccCceE
Confidence 34677888899999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEecCcccccccccccccCCCCCCcEEEEEEEEEeeceEEEEEeCC-ceeEEEeccccCcccccCcccccCCCCEEEE
Q 000236 1319 EVTLKTSDSRTASQSEINNLSNLHVGDIVIGQIKRVESYGLFITIENT-NLVGLCHVSELSEDHVDNIETIYRAGEKVKV 1397 (1810)
Q Consensus 1319 ~lSlk~~~~~~~~~~~~~~~~~~~~G~~v~G~V~~i~~~G~fV~l~~~-~v~gl~~~sel~~~~~~~~~~~~~~G~~V~~ 1397 (1810)
.|+||++....... ......++++|+...|+|.++.+||+||+++++ ++.|+||++++++.+.++....|..|+.|++
T Consensus 1228 el~Lk~s~~~d~~~-~~~~~~~l~~gd~~~g~v~~~~~~G~fi~l~~tv~~~g~~~~~e~~d~~~e~it~~~~~~~~V~a 1306 (1710)
T KOG1070|consen 1228 ELSLKNSDIKDTVK-LLKDSKDLKKGDREDGTVEVVDPFGLFIKLDVTVNMVGLCHISEEADDRGENITALYYAGDRVKA 1306 (1710)
T ss_pred EEEEeccccCCchh-hhhhhhhhhccccccceEEEecCCceEEEecCcceecccccceeecchhhhhcccceeccceeee
Confidence 99999987643222 333467999999999999999999999999975 3699999999999999999999999999999
Q ss_pred EEEEEecCCCeeEEeecccccCCCccccccCcccchhhhHhhhcccCcccccccCcccccccccc---ccCCCcccc---
Q 000236 1398 KILKVDKEKRRISLGMKSSYFKNDADNLQMSSEEESDEAIEEVGSYNRSSLLENSSVAVQDMDME---SEDGGSLVL--- 1471 (1810)
Q Consensus 1398 ~I~~id~~~~ri~lslk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~--- 1471 (1810)
.+++++.+++||++++|.+|+..+++.......++.-+ ..+... .+. +.++ -++...+..
T Consensus 1307 ~~lk~~~ek~rIsl~~k~s~~~~~dd~~~~~~~~e~v~-----------~~~~~~--~d~-~s~~~~~~~d~g~q~~~~g 1372 (1710)
T KOG1070|consen 1307 CVLKEDSEKKRISLGLKSSYLSSEDDARITSYGEEGVE-----------MEEESH--SDP-KSMEEVAAEDPGFQSSSGG 1372 (1710)
T ss_pred EeeeccchhhhhhhhhhhhccCChhhhhcccccccCcc-----------hhcccc--cCc-cchhhhcccCCCccccccc
Confidence 99999999999999999999966443321110000000 000000 000 0000 000000000
Q ss_pred -----cccccccCCCCc-cc-CCCCCCCCcCCCCCCCCCCcchhchhhhhhhhhhhhHHHHHHHHHHHHHHHHHhccCCC
Q 000236 1472 -----AQIESRASVPPL-EV-NLDDEQPDMDNGISQNQGHTDEAKTIDEKNNRHAKKKEKEEREQEIRAAEERLLEKDAP 1544 (1810)
Q Consensus 1472 -----~~~~~~~~~~~~-~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~e~~~~~~~~~ 1544 (1810)
..++.....+++ +- .|++++.|++-+ +++.++++.+ ++++..+++.|.....+++.++. +.|
T Consensus 1373 ~~~e~~~d~~~~~~p~~le~s~~td~e~d~~~~--~~e~~qde~d--------ee~e~~kee~e~~~~~~e~~dl~-~~p 1441 (1710)
T KOG1070|consen 1373 FNLEDAVDEMSETLPDALEDSCETDSEVDEEVE--DEELDQDEKD--------EEKEKDKEEREENRSDEEERDLS-RAP 1441 (1710)
T ss_pred eehhhhhhhccccCCchhhhcccchhhhhhccc--cccccccccc--------hhhhhhhhhccccccchhhcccc-cCC
Confidence 001111111211 11 133322221111 1111111000 01111112222333333443433 699
Q ss_pred CcHHHHHHHHHcCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhcCccchhhHHHHHHHHHHHHHHcCCCCHHHHHHH
Q 000236 1545 RTPDEFERLVRSSPNSSFVWIKYMAFMLSMADVEKARSIAERALQTINIREENEKLNIWVAYFNLENEYGNPPEEAVVKV 1624 (1810)
Q Consensus 1545 ~a~~~fer~l~~~P~~~~~W~~y~~~~~~~~~~d~Ar~v~eral~~~~~~~e~e~~~lW~~yl~le~~~g~~~~e~a~~v 1624 (1810)
++.++|+|+++.+||++.+|++||+|+++.+++++||++++|||.+|++||+.|++|+|++|+|+++.|| +.+...++
T Consensus 1442 esaeDferlvrssPNSSi~WI~YMaf~LelsEiekAR~iaerAL~tIN~REeeEKLNiWiA~lNlEn~yG--~eesl~kV 1519 (1710)
T KOG1070|consen 1442 ESAEDFERLVRSSPNSSILWIRYMAFHLELSEIEKARKIAERALKTINFREEEEKLNIWIAYLNLENAYG--TEESLKKV 1519 (1710)
T ss_pred cCHHHHHHHHhcCCCcchHHHHHHHHHhhhhhhHHHHHHHHHHhhhCCcchhHHHHHHHHHHHhHHHhhC--cHHHHHHH
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999 78999999
Q ss_pred HHHHHhcCCCHHHHHHHHHHHHHhCChHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHh-cHHHHHHHHHHHHHhCCCCCh
Q 000236 1625 FQRALQYCDPKKVHLALLGLYERTEQNKLADELLYKMIKKFKHSCKVWLRRVQRLLKQ-QQEGVQAVVQRALLSLPRHKH 1703 (1810)
Q Consensus 1625 ferAl~~~~~~~i~~~l~~~~~~~g~~~~A~~~~e~~lk~~~~~~~~w~~~a~~~~~~-~~~~A~~ll~ralk~~p~~~~ 1703 (1810)
|+||+++|++..+|..|+.+|...+++++|.++|+.|+++|++..++|..|++|++++ +.++|+.+++|||+.+|+++|
T Consensus 1520 FeRAcqycd~~~V~~~L~~iy~k~ek~~~A~ell~~m~KKF~q~~~vW~~y~~fLl~~ne~~aa~~lL~rAL~~lPk~eH 1599 (1710)
T KOG1070|consen 1520 FERACQYCDAYTVHLKLLGIYEKSEKNDEADELLRLMLKKFGQTRKVWIMYADFLLRQNEAEAARELLKRALKSLPKQEH 1599 (1710)
T ss_pred HHHHHHhcchHHHHHHHHHHHHHhhcchhHHHHHHHHHHHhcchhhHHHHHHHHHhcccHHHHHHHHHHHHHhhcchhhh
Confidence 9999999999999999999999999999999999999999999999999999999999 999999999999999999999
Q ss_pred HHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHhcCCCchhHHHHHHHHHH
Q 000236 1704 IKFISQTAILEFKNGVADRGRSMFEGILSEYPKRTDLWSIYLDQEIRLGDVDLIRGLFERAISLSLPPKKMKFLFKKYLE 1783 (1810)
Q Consensus 1704 ~~~~~~~a~l~~~~g~~e~Ar~lfe~al~~~P~~~~lw~~ya~~e~k~gd~e~ar~lferal~~~~~p~~~~~lw~~yl~ 1783 (1810)
++++..||+++|++||.+|||++|+..+..+|++.|+|+.|+++++++|+.+.+|.+|||++.+++++++|+++|++|++
T Consensus 1600 v~~IskfAqLEFk~GDaeRGRtlfEgll~ayPKRtDlW~VYid~eik~~~~~~vR~lfeRvi~l~l~~kkmKfffKkwLe 1679 (1710)
T KOG1070|consen 1600 VEFISKFAQLEFKYGDAERGRTLFEGLLSAYPKRTDLWSVYIDMEIKHGDIKYVRDLFERVIELKLSIKKMKFFFKKWLE 1679 (1710)
T ss_pred HHHHHHHHHHHhhcCCchhhHHHHHHHHhhCccchhHHHHHHHHHHccCCHHHHHHHHHHHHhcCCChhHhHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHcCCHHHHHHHHHHHHHHHHhhh
Q 000236 1784 YEKSVGEEERIEYVKQKAMEYVESTL 1809 (1810)
Q Consensus 1784 ~E~~~G~~~~a~~v~~rAl~~v~~~~ 1809 (1810)
||+++||.+.++.++.||.+||++..
T Consensus 1680 yEk~~Gde~~vE~VKarA~EYv~s~~ 1705 (1710)
T KOG1070|consen 1680 YEKSHGDEKNVEYVKARAKEYVESIK 1705 (1710)
T ss_pred HHHhcCchhhHHHHHHHHHHHHHHhh
Confidence 99999999999999999999999853
|
|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2047 consensus mRNA splicing factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >KOG1258 consensus mRNA processing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins | Back alignment and domain information |
|---|
| >cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >KOG1258 consensus mRNA processing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08059 general stress protein 13; Validated | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK08059 general stress protein 13; Validated | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >PHA02945 interferon resistance protein; Provisional | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PHA02945 interferon resistance protein; Provisional | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >COG2183 Tex Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03987 translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2183 Tex Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK09521 exosome complex RNA-binding protein Csl4; Provisional | Back alignment and domain information |
|---|
| >PRK03987 translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK09521 exosome complex RNA-binding protein Csl4; Provisional | Back alignment and domain information |
|---|
| >cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK04841 transcriptional regulator MalT; Provisional | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PRK08563 DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3785 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PHA02858 EIF2a-like PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PRK08563 DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] | Back alignment and domain information |
|---|
| >cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >cd05700 S1_Rrp5_repeat_hs9 S1_Rrp5_repeat_hs9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05701 S1_Rrp5_repeat_hs10 S1_Rrp5_repeat_hs10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PHA02858 EIF2a-like PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional | Back alignment and domain information |
|---|
| >KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG1729 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions [] | Back alignment and domain information |
|---|
| >COG3898 Uncharacterized membrane-bound protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >COG4105 ComL DNA uptake lipoprotein [General function prediction only] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG1856 consensus Transcription elongation factor SPT6 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2916 consensus Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >COG0557 VacB Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional | Back alignment and domain information |
|---|
| >TIGR00757 RNaseEG ribonuclease, Rne/Rng family | Back alignment and domain information |
|---|
| >cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2916 consensus Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >TIGR00757 RNaseEG ribonuclease, Rne/Rng family | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >KOG1856 consensus Transcription elongation factor SPT6 [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions [] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >KOG4340 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2041 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 | Back alignment and domain information |
|---|
| >KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >COG0557 VacB Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >KOG2796 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing | Back alignment and domain information |
|---|
| >PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >KOG3616 consensus Selective LIM binding factor [Transcription] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >smart00386 HAT HAT (Half-A-TPR) repeats | Back alignment and domain information |
|---|
| >PF13281 DUF4071: Domain of unknown function (DUF4071) | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PRK10811 rne ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >PRK10811 rne ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >COG2909 MalT ATP-dependent transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >KOG2610 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3298 consensus DNA-directed RNA polymerase subunit E' [Transcription] | Back alignment and domain information |
|---|
| >KOG2471 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11712 ribonuclease G; Provisional | Back alignment and domain information |
|---|
| >PRK11712 ribonuclease G; Provisional | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >KOG2422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] | Back alignment and domain information |
|---|
| >PF08292 RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; InterPro: IPR013238 Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit | Back alignment and domain information |
|---|
| >KOG3409 consensus Exosomal 3'-5' exoribonuclease complex, subunit ski4 (Csl4) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi | Back alignment and domain information |
|---|
| >PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed | Back alignment and domain information |
|---|
| >COG4649 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >KOG3298 consensus DNA-directed RNA polymerase subunit E' [Transcription] | Back alignment and domain information |
|---|
| >PF10246 MRP-S35: Mitochondrial ribosomal protein MRP-S35; InterPro: IPR019375 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome | Back alignment and domain information |
|---|
| >PF10246 MRP-S35: Mitochondrial ribosomal protein MRP-S35; InterPro: IPR019375 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF08292 RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; InterPro: IPR013238 Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit | Back alignment and domain information |
|---|
| >KOG2422 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3409 consensus Exosomal 3'-5' exoribonuclease complex, subunit ski4 (Csl4) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >COG2976 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1810 | ||||
| 2k4k_A | 130 | Solution Structure Of Gsp13 From Bacillus Subtilis | 1e-06 | ||
| 3bzc_A | 785 | Crystal Structure Of The Tex Protein From Pseudomon | 1e-06 | ||
| 2oce_A | 780 | Crystal Structure Of Tex Family Protein Pa5201 From | 1e-06 | ||
| 2oce_A | 780 | Crystal Structure Of Tex Family Protein Pa5201 From | 1e-06 | ||
| 1q8k_A | 308 | Solution Structure Of Alpha Subunit Of Human Eif2 L | 8e-05 | ||
| 3cdi_A | 723 | Crystal Structure Of E. Coli Pnpase Length = 723 | 8e-05 | ||
| 3aev_A | 275 | Crystal Structure Of AEIF2ALPHA-Adim2p-Rrna Complex | 9e-05 | ||
| 1yz6_A | 274 | Crystal Structure Of Intact Alpha Subunit Of Aif2 F | 9e-05 | ||
| 1wi5_A | 119 | Solution Structure Of The S1 Rna Binding Domain Fro | 2e-04 | ||
| 1sro_A | 76 | S1 Rna Binding Domain, Nmr, 20 Structures Length = | 2e-04 |
| >pdb|2K4K|A Chain A, Solution Structure Of Gsp13 From Bacillus Subtilis Length = 130 | Back alignment and structure |
|
| >pdb|3BZC|A Chain A, Crystal Structure Of The Tex Protein From Pseudomonas Aeruginosa, Crystal Form I Length = 785 | Back alignment and structure |
| >pdb|2OCE|A Chain A, Crystal Structure Of Tex Family Protein Pa5201 From Pseudomonas Aeruginosa Length = 780 | Back alignment and structure |
| >pdb|2OCE|A Chain A, Crystal Structure Of Tex Family Protein Pa5201 From Pseudomonas Aeruginosa Length = 780 | Back alignment and structure |
| >pdb|1Q8K|A Chain A, Solution Structure Of Alpha Subunit Of Human Eif2 Length = 308 | Back alignment and structure |
| >pdb|3CDI|A Chain A, Crystal Structure Of E. Coli Pnpase Length = 723 | Back alignment and structure |
| >pdb|3AEV|A Chain A, Crystal Structure Of AEIF2ALPHA-Adim2p-Rrna Complex From Pyrococcus Horikoshii Ot3 Length = 275 | Back alignment and structure |
| >pdb|1YZ6|A Chain A, Crystal Structure Of Intact Alpha Subunit Of Aif2 From Pyrococcus Abyssi Length = 274 | Back alignment and structure |
| >pdb|1WI5|A Chain A, Solution Structure Of The S1 Rna Binding Domain From Human Hypothetical Protein Baa11502 Length = 119 | Back alignment and structure |
| >pdb|1SRO|A Chain A, S1 Rna Binding Domain, Nmr, 20 Structures Length = 76 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1810 | |||
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 1e-49 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 2e-15 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 3e-14 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 4e-12 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 3e-11 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 6e-04 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 1e-38 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 2e-18 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 2e-07 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 6e-04 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 4e-37 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 1e-11 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 5e-34 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 1e-18 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 4e-05 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 8e-23 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 1e-07 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 2e-07 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 2e-06 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 7e-06 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 3e-05 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 8e-21 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 2e-08 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 5e-07 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 1e-06 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 5e-06 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 2e-05 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 8e-04 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 3e-19 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 4e-11 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 9e-10 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 4e-07 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 5e-04 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 2e-18 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 7e-09 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 2e-08 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 1e-05 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 4e-05 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 5e-04 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 1e-17 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 2e-13 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 1e-07 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 2e-05 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 3e-04 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 4e-17 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 4e-06 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 2e-04 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 9e-04 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 6e-17 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 1e-16 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 2e-07 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 6e-05 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 2e-04 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 1e-15 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 3e-05 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 2e-15 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 4e-07 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 1e-06 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 5e-04 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 8e-04 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 5e-15 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 1e-05 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 3e-04 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 1e-13 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 2e-11 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 3e-05 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 4e-05 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 5e-04 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 6e-04 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 7e-04 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 2e-13 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 2e-11 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 2e-05 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 6e-05 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 6e-04 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 3e-13 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 8e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-08 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 8e-11 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 2e-10 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 1e-10 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 1e-10 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 4e-09 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 6e-08 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 6e-06 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 4e-05 | |
| 4ayb_E | 180 | DNA-directed RNA polymerase; transferase, multi-su | 6e-07 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 9e-07 | |
| 2r7d_A | 469 | Ribonuclease II family protein; structural genomic | 6e-05 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 7e-05 | |
| 2wp8_J | 977 | Exosome complex exonuclease DIS3; nucleus, hydrola | 6e-04 | |
| 3h0g_G | 172 | DNA-directed RNA polymerase II subunit RPB7; trans | 6e-04 | |
| 2vnu_D | 760 | Exosome complex exonuclease RRP44; hydrolase-RNA c | 7e-04 |
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 | Back alignment and structure |
|---|
Score = 178 bits (452), Expect = 1e-49
Identities = 43/269 (15%), Positives = 102/269 (37%), Gaps = 31/269 (11%)
Query: 1563 VWIKYMAFMLS--------MADVEKARSIAERALQ-----------TINIREENEKLNIW 1603
+W KY+ + S ++ E+ L E++ KL
Sbjct: 10 MWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAE 69
Query: 1604 VAYFNLENEYGNPPEEAVVKVFQRALQYCDPK--KVHLALLGLYERTEQNKLADELLYKM 1661
N + + +++RA+ K ++ A E + + + ++
Sbjct: 70 KGDMNNAKLFSDEAAN----IYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYNRL 125
Query: 1662 IKKFK-HSCKVWLRRVQRLLKQQQ-EGVQAVVQRALLSLPRHKHIKFISQTAILEFK-NG 1718
+ V+++ ++ + + + + + ++A H+ + A++E+ +
Sbjct: 126 LAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDARTRHHVYVTA--ALMEYYCSK 183
Query: 1719 VADRGRSMFEGILSEYPKRTDLWSIYLDQEIRLGDVDLIRGLFERAI-SLSLPPKKMKFL 1777
+FE L +Y + Y+D L + + R LFER + S SLPP+K +
Sbjct: 184 DKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEI 243
Query: 1778 FKKYLEYEKSVGEEERIEYVKQKAMEYVE 1806
+ ++L +E ++G+ I V+++
Sbjct: 244 WARFLAFESNIGDLASILKVEKRRFTAFR 272
|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 Length = 119 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Length = 275 | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Length = 275 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Length = 785 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Length = 785 | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Length = 285 | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Length = 285 | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} Length = 285 | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E Length = 180 | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A Length = 644 | Back alignment and structure |
|---|
| >2r7d_A Ribonuclease II family protein; structural genomics, PSI-2, structure initiative, northeast structural genomics consort NESG; 1.80A {Deinococcus radiodurans R1} SCOP: b.40.4.5 b.40.4.16 PDB: 2r7f_A Length = 469 | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A Length = 179 | Back alignment and structure |
|---|
| >2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Length = 977 | Back alignment and structure |
|---|
| >3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 172 | Back alignment and structure |
|---|
| >2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 Length = 760 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
No hit with probability above 80.00
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1810 | ||||
| d2onda1 | 308 | a.118.8.7 (A:242-549) Cleavage stimulation factor | 8e-32 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 1e-17 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 1e-13 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 3e-11 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 4e-11 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 2e-08 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 2e-04 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 5e-04 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 0.001 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 9e-17 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 5e-14 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 7e-10 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 6e-09 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 2e-07 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 0.001 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 0.002 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 2e-14 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 2e-08 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 1e-06 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 4e-06 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 8e-06 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 2e-05 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 4e-14 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 3e-07 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 1e-06 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 1e-06 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 1e-05 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 2e-04 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 4e-13 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 1e-09 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 2e-06 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 1e-04 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 4e-04 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 5e-04 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 4e-13 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 1e-07 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 1e-05 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 2e-04 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 4e-04 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 1e-12 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 3e-07 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 1e-06 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 2e-04 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 1e-11 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 5e-07 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 3e-05 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 1e-04 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 2e-04 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 3e-11 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 8e-08 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 2e-05 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 4e-05 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 6e-04 | |
| d1go3e1 | 106 | b.40.4.5 (E:79-184) C-terminal domain of RNA polym | 7e-11 | |
| d1y14b1 | 91 | b.40.4.5 (B:81-171) C-terminal domain of RNA polym | 5e-10 | |
| d1y14b1 | 91 | b.40.4.5 (B:81-171) C-terminal domain of RNA polym | 0.002 | |
| d2ix0a3 | 87 | b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Esche | 6e-10 | |
| d2ix0a3 | 87 | b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Esche | 0.002 | |
| d2nn6h1 | 95 | b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-pro | 3e-09 | |
| d2nn6g1 | 88 | b.40.4.5 (G:107-194) S1-domain of exosome componen | 4e-07 | |
| d2c35b1 | 94 | b.40.4.5 (B:78-171) C-terminal domain of RNA polym | 4e-07 | |
| d1w3ba_ | 388 | a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, | 3e-06 | |
| d2ja9a1 | 90 | b.40.4.5 (A:62-151) S1-domain of exosome component | 2e-05 | |
| d1hh2p1 | 72 | b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga | 9e-05 | |
| d1dcea1 | 334 | a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr | 0.004 | |
| d2nn6i1 | 125 | b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {H | 0.004 |
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: HAT/Suf repeat domain: Cleavage stimulation factor 77 kDa subunit CSTF3 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 125 bits (314), Expect = 8e-32
Identities = 42/284 (14%), Positives = 105/284 (36%), Gaps = 39/284 (13%)
Query: 1546 TPDEFERLVRSSPNSSFVWIKYMAFMLS--------MADVEKARSIAERALQTINIREEN 1597
TP E +++ +W KY+ + S ++ E+ L + +
Sbjct: 1 TPQEAQQVD--------MWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPD- 51
Query: 1598 EKLNIWVAYFNLENEYGNPPE------------EAVVKVFQRALQYCDPK--KVHLALLG 1643
IW + + +++RA+ K ++ A
Sbjct: 52 ----IWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYAD 107
Query: 1644 LYERTEQNKLADELLYKMIKKF-KHSCKVWLRRVQRLLKQQQ-EGVQAVVQRALLSLPRH 1701
E + + + +++ V+++ ++ + + + + + ++A
Sbjct: 108 YEESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDARTR 167
Query: 1702 KHIKFISQTAILEFKNGVADRGRSMFEGILSEYPKRTDLWSIYLDQEIRLGDVDLIRGLF 1761
H+ +++ + + + +FE L +Y + Y+D L + + R LF
Sbjct: 168 HHV-YVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLF 226
Query: 1762 ERAI-SLSLPPKKMKFLFKKYLEYEKSVGEEERIEYVKQKAMEY 1804
ER + S SLPP+K ++ ++L +E ++G+ I V+++
Sbjct: 227 ERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTA 270
|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 106 | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 91 | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Length = 87 | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} Length = 87 | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} Length = 90 | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} Length = 72 | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1810 | |||
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 99.96 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 99.92 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.88 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.85 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.84 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.83 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.69 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.64 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.57 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 99.54 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.46 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 99.43 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 99.42 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.41 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 99.41 | |
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 99.41 | |
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 99.4 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.38 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.36 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.33 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 99.33 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.32 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.3 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 99.28 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.19 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 99.17 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 99.16 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 99.13 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 99.12 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 99.1 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 99.09 | |
| d2z0sa1 | 88 | S1-domain of exosome complex RNA-binding protein 1 | 99.07 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.05 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 99.03 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 99.02 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 99.02 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 98.99 | |
| d2z0sa1 | 88 | S1-domain of exosome complex RNA-binding protein 1 | 98.98 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.97 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.87 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.86 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.84 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.76 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.75 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 98.74 | |
| d2nn6h1 | 95 | S1-domain of Ribosomal RNA-processing protein 4, R | 98.71 | |
| d2ix0a3 | 87 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 98.68 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.67 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 98.67 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 98.67 | |
| d1e3pa2 | 62 | S1 RNA-binding domain of polyribonucleotide phosph | 98.62 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 98.61 | |
| d2nn6h1 | 95 | S1-domain of Ribosomal RNA-processing protein 4, R | 98.59 | |
| d1y14b1 | 91 | C-terminal domain of RNA polymerase II subunit RBP | 98.58 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.56 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 98.56 | |
| d1e3pa2 | 62 | S1 RNA-binding domain of polyribonucleotide phosph | 98.56 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.55 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 98.53 | |
| d2ix0a3 | 87 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 98.49 | |
| d2c35b1 | 94 | C-terminal domain of RNA polymerase II subunit RBP | 98.48 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 98.46 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 98.43 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.4 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 98.39 | |
| d1y14b1 | 91 | C-terminal domain of RNA polymerase II subunit RBP | 98.36 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.27 | |
| d2c35b1 | 94 | C-terminal domain of RNA polymerase II subunit RBP | 98.25 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 98.2 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.16 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.13 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 98.08 | |
| d2nn6g1 | 88 | S1-domain of exosome component 3 (RRP40) {Human (H | 98.03 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 97.99 | |
| d2nn6g1 | 88 | S1-domain of exosome component 3 (RRP40) {Human (H | 97.97 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 97.93 | |
| d1ouva_ | 265 | Cysteine rich protein C (HcpC) {Helicobacter pylor | 97.83 | |
| d2ja9a1 | 90 | S1-domain of exosome component 3 (RRP40) {Saccharo | 97.82 | |
| d2ja9a1 | 90 | S1-domain of exosome component 3 (RRP40) {Saccharo | 97.82 | |
| d2nn6i1 | 125 | Exosome component 1, EXOSC1 {Human (Homo sapiens) | 97.72 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 97.69 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 97.65 | |
| d1hh2p1 | 72 | S1 domain of NusA {Thermotoga maritima [TaxId: 233 | 97.64 | |
| d2nn6i1 | 125 | Exosome component 1, EXOSC1 {Human (Homo sapiens) | 97.63 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 97.54 | |
| d1hh2p1 | 72 | S1 domain of NusA {Thermotoga maritima [TaxId: 233 | 97.53 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 97.43 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 97.22 | |
| d2asba1 | 76 | S1 domain of NusA {Mycobacterium tuberculosis [Tax | 97.06 | |
| d2asba1 | 76 | S1 domain of NusA {Mycobacterium tuberculosis [Tax | 96.8 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 96.31 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 95.95 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 95.41 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 95.22 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 89.98 | |
| d1klxa_ | 133 | Cysteine rich protein B (HcpB) {Helicobacter pylor | 88.52 | |
| d1b89a_ | 336 | Clathrin heavy chain proximal leg segment {Cow (Bo | 88.34 |
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: TPR-like family: HAT/Suf repeat domain: Cleavage stimulation factor 77 kDa subunit CSTF3 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.96 E-value=2.2e-25 Score=199.92 Aligned_cols=241 Identities=15% Similarity=0.236 Sum_probs=208.0
Q ss_pred CHHHHHHHHHHHHHCC--------CHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHCCCC------------CHH
Q ss_conf 9999999999999648--------99999999999997517600011799999999999990999------------989
Q 000236 1560 SSFVWIKYMAFMLSMA--------DVEKARSIAERALQTINIREENEKLNIWVAYFNLENEYGNP------------PEE 1619 (1810)
Q Consensus 1560 ~~~~W~~y~~~~~~~~--------e~d~Ar~v~eral~~~~~~~e~e~~~iW~~~l~le~~~g~~------------~~e 1619 (1810)
...+|..|+.+..... ..++++.+|+||+..+|... .+|+.|+.++...++. ..+
T Consensus 7 ~~~~W~~yi~~E~~~~~~~~~~~~~~~Rv~~vyerAl~~~~~~~-----~lW~~y~~~~~~~~~~~~~~~~~~~~~~~~~ 81 (308)
T d2onda1 7 QVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHP-----DIWYEAAQYLEQSSKLLAEKGDMNNAKLFSD 81 (308)
T ss_dssp HHHHHHHHHHHHHTCTTCCCCHHHHHHHHHHHHHHHHHHHTTCH-----HHHHHHHHHHHHHHHHHHHTSCCHHHHHHHH
T ss_pred HHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHCCCCH-----HHHHHHHHHHHHCCCHHHHHHHHHHCCCCHH
T ss_conf 99999999999876865433220369999999999998777999-----9999999999870736887778763102459
Q ss_pred HHHHHHHHHHHCCCC--HHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCC-HHHHHHHHHHHHHH-CHHHHHHHHHHHH
Q ss_conf 999999999850998--9999999999999178499999999999963798-99999999999971-6999999999999
Q 000236 1620 AVVKVFQRALQYCDP--KKVHLALLGLYERTEQNKLADELLYKMIKKFKHS-CKVWLRRVQRLLKQ-QQEGVQAVVQRAL 1695 (1810)
Q Consensus 1620 ~a~~vf~rAl~~~~~--~~i~~~l~~i~~~~g~~~~A~~~~e~~lk~~~~~-~~~w~~~~~~~~~~-~~~~A~~ll~ral 1695 (1810)
+++.+|+||++..++ ..+|..++.++...++.+.|+.+|+++++..|.+ ..+|..|+.++.+. ..+.|+++|++|+
T Consensus 82 ~a~~i~~ral~~~~p~~~~l~~~ya~~~~~~~~~~~a~~i~~~~l~~~~~~~~~~w~~~~~~~~~~~~~~~ar~i~~~al 161 (308)
T d2onda1 82 EAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAR 161 (308)
T ss_dssp HHHHHHHHHHTTTTTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHTSSSSCTHHHHHHHHHHHHHHHCHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHCCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHH
T ss_conf 99999999998749987999999999998613389999999999987157869999999999998278688999999999
Q ss_pred HHCCCCCHHHHHHHHHHHHHH-CCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCC-CCCHH
Q ss_conf 729997759999999999998-5998999999999887599999999999999999299689999999999369-99043
Q 000236 1696 LSLPRHKHIKFISQTAILEFK-NGVADRGRSMFEGILSEYPKRTDLWSIYLDQEIRLGDVDLIRGLFERAISLS-LPPKK 1773 (1810)
Q Consensus 1696 ~~~p~~~~~~~~~~~a~~e~~-~g~~e~Ar~lfe~al~~~P~~~~iw~~ya~le~k~gd~e~Ar~lferal~~~-~~~k~ 1773 (1810)
+..|... .+|..+|.++.. .++.+.|+.+|++++..+|.+..+|..|++++...|+.++||.+|++++... .+|..
T Consensus 162 ~~~~~~~--~~~~~~a~~e~~~~~~~~~a~~i~e~~l~~~p~~~~~w~~y~~~~~~~g~~~~aR~~fe~ai~~~~~~~~~ 239 (308)
T d2onda1 162 EDARTRH--HVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEK 239 (308)
T ss_dssp TSTTCCT--HHHHHHHHHHHHTSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHTTCCHHHHHHHHHHHHHSSSSCGGG
T ss_pred HHCCCCH--HHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCHHH
T ss_conf 8088867--99999999998765577899999999998610038899999999998698689999999999827898689
Q ss_pred HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHH
Q ss_conf 9999999999999919999999999999999884
Q 000236 1774 MKFLFKKYLEYEKSVGEEERIEYVKQKAMEYVES 1807 (1810)
Q Consensus 1774 ~k~lw~~yl~~E~~~G~~~~a~~v~~rAle~v~~ 1807 (1810)
...+|..|+.||..+|+.+.+..+++||.+....
T Consensus 240 ~~~iw~~~~~fE~~~G~~~~~~~~~~r~~~~~~~ 273 (308)
T d2onda1 240 SGEIWARFLAFESNIGDLASILKVEKRRFTAFRE 273 (308)
T ss_dssp CHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHTTT
T ss_pred HHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCC
T ss_conf 9999999999999849999999999999987711
|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|