Citrus Sinensis ID: 000744

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------
MAGNYRFAMDQKDIVRLMITSVGSFIQDRLINQEERTQHKEQCAERLAAEDGSNDKDSEFRYSDQAVLANLDWGIEALEEAINTSNMETKLARLDYAEKMLQVCAMLDSDQQTAGVPNFYLSAWAHLNLSYLWKLRNNVQNSVLHALEMFSIDPFFSRIDFAPELWKELFLPQMSSIVGWYSEARHRLVMEAIPDSSDLSFTADLDQFFNESLIFSMRPEQVEKLQQLEQLYGDSLDENTRMFAKYYKDCMNSDSSTRTKVIPMLPIAEPPATPLHEFSRSIPDYVKFGPVLPKSAGFSAVLKSKSNMRGPSSPCNESDEGSQSCNSLPCSEKMTSRSRPPKDFVCPITGQIFNDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLCSNSLPKTNYVLKRLITSWKEQYPDLAQEFSYSETPKHSFGSSPLKDMTLASSPSRTFNFHIHNNTDDHINERRKRFTQAANATSPTSVISQASVETIINGLKPYVTCLCTSENLQECETAVLAIARLWKESKGDPGVHAYLLKPTIINGFAEILSASLSREVLRTSVYILSELMVADESVGDILTSVDSDFDCLAALLKNGLGEAAVLIYQLRPAFAQLSAHEFIPSLVQLVLNKTEEFDELQFVMEPKDAAIEMLEQILMGGDKKSRSITALSLISANGIPALIKCLDRVEVRRSIVSILLCCMHADKSCKTLIAKRIELSHVLDLFHDGNDSVRGICINFLSELVLLNRRTFSNQILQVIRDEGSFSTMHTFLVYLQMAPMEQQPATASLLLQLDLLVEPRKMSMYREEAVEALIEALRRKDFPNSQMMALDALLSLTGRFTFSGKSYTEALLLKIAGFDQPYNALMKPERLSKPESEMVESMEEEEQAACSWEKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIAAWLTHMLSTLPDTGVRGTARRSLLDEFINVLQSSRNLEEKILTALALKTFISDPVALEELGKYAKCIYGTLRKLKKYSAVVTDIQKALMNLSSVNATELWHCNEVTELDSSTNGEVLSLIHLKGRVLSSHSDGTIKMWDSGKRVLRLIQEVREHTRAVTCLYVPSSGDKLYSGSLDKTIRVWSIKPEEIHCLQVHNVKEAVHELTANAEIACFVSPATGVKVYNWSGAIKHINFNKHVKSLVMTGDKLYCGCSGYSIQEVDLGNLTSTTFYAGTKKLLGKQTIHSLHMHNGLLFAGGSSVDGTAGKVFSISSKTAVGSFTTGIDIQHLAVNSDFIFTATKCGTIEVWLKERVTRVASVKANNSGGGHAKITCLGTGVDGHPYK
ccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccccccHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccEEEcHHHHHHHccccccHHHccccccHHHHHHHHHHHHHHHHHHcccccccEEccccccccHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccHHHHHHHHHHccccHHHHHHcccHHHHHHHHHccccccccHHcccccHHHHHHHHHHHHcccccccccHHHHHHHccccHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHcccccccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHccccEEEccccccEEEEEEEEccccHHHcccccccEEEEEcccEEEEcccccEEEEEEEEcccEEEEEEccccEEEEEccccccEEEEEcccccccEEEEEEcccccEEEEccccccEEEEEcccccEEEEEEEcccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEcccEEEEEEEccEEEEEEcccEEEEEEccccEEEEEEccccccccccEEEEEEEEcccEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEEcccEEEEEcccccEEEEEcccccEEEEEEcccccccccEEEEEEEcccccccc
ccccccEcccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccEEEEcHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccHcHHHHccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccccHHHHHHHHcccHccccccHHHHccHHHHHHHHccccccccccccccccccccccccccccccccccccHccccccHHHccccEEEEccccccHHHHHHHHHcccccccccccEccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccEEEEcccHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcEEEEccccccHHHHHHHHHcccHHHHHHHHHccccHHHHHHcccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHcHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccHcccHHHcccccccHHHcHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccEEEEEccEEEEEccccccEEEEEEEEccEEEEEcccccEEEEEccccEEEEEEEHHHcccEEEEEEEccccccccccccccEEEEEEEccccEEEEEEEEccHHHHHHHHHccEEEEEEcccEEEEEEcccccEEEccccEEEEEEEEccEEEEEcccccEEEEEcccccEEEEEccccHHcccccEEEEEEEccEEEEccccEcccEEEEEcccccccEcEcccccEEEEEEEEccEEEEcccccEEEEEEccccEEEEEEEEccccccccEEEEEEEcccccccc
magnyrfamdqKDIVRLMITSVGSFIQDRLINQEERTQHKEQCAERLaaedgsndkdsefrysdQAVLANLDWGIEALEEAINTSNMETKLARLDYAEKMLQVCAMLdsdqqtagvpnFYLSAWAHLNLSYLWKLRNNVQNSVLHALEmfsidpffsridfAPELWKELFLPQMSSIVGWYSEARHRLVMeaipdssdlsftaDLDQFFNESLIFSMRPEQVEKLQQLEQLYGDSLDENTRMFAKYYKDcmnsdsstrtkvipmlpiaeppatplhefsrsipdyvkfgpvlpksagFSAVLKsksnmrgpsspcnesdegsqscnslpcsekmtsrsrppkdfvcpitgqifndpvtletgqTYERKAIQEWLKrgnttcpitrqplcsnslpktNYVLKRLITSWKEQypdlaqefsysetpkhsfgssplkdmtlasspsrtfnfhihnntdDHINERRKRFTqaanatsptsvISQASVETIINGLKPyvtclctsenlqECETAVLAIARLWKeskgdpgvhayllkpTIINGFAEILSASLSREVLRTSVYILSELMVADESVGDILTSVDSDFDCLAALLKNGLGEAAVLIYQLRPAFAQLSAHEFIPSLVQLVLNKteefdelqfvmePKDAAIEMLEQILmggdkksrSITALSLISANGIPALIKCLDRVEVRRSIVSILLCCMHADKSCKTLIAKRIELSHVLdlfhdgndsvRGICINFLSELVLLNRRTFSNQILQVIRDEGSFSTMHTFLVYLqmapmeqqpATASLLLQLDLlveprkmsMYREEAVEALIEALrrkdfpnsqMMALDALLSLtgrftfsgKSYTEALLLKIAgfdqpynalmkperlskpesemVESMEEEEQAACSWEKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIAAWLTHMLstlpdtgvrgtARRSLLDEFINVLQSSRNLEEKILTALALKTFISDPVALEELGKYAKCIYGTLRKLKKYSAVVTDIQKALMNLSsvnatelwhcnevteldsstngeVLSLIHLKGrvlsshsdgtikMWDSGKRVLRLIQEVREHTRAVtclyvpssgdklysgsldktirvwsikpeeihcLQVHNVKEAVHELTANAeiacfvspatgvkvynwsgaikhinfNKHVKSLVMtgdklycgcsgysiqevdlgnltsttfyagtkkllgKQTIHSLHMhngllfaggssvdgtagkVFSISsktavgsfttgidiqhlavNSDFIFTATKCGTIEVWLKERVTRVASVkannsggghakitclgtgvdghpyk
magnyrfamdqkdiVRLMITSVGSFIQDRLINQEERTQHKEQCAERlaaedgsndkdsefRYSDQAVLANLDWGIEALEEAINTSNMETKLARLDYAEKMLQVCAMLDSDQQTAGVPNFYLSAWAHLNLSYLWKLRNNVQNSVLHALEMFSIDPFFSRIDFAPELWKELFLPQMSSIVGWYSEARHRLVMEAIPDSSDLSFTADLDQFFNESLIFSMRPEQVEKLQQLEQLYGDSLDENTRMFAKYYKDCMNSDSSTRTKVIPMLPIAEPPATPLHEFSRSIPDYVKFGPVLPKSAGFSAVLKSKSNMRGPsspcnesdegsqscNSLPCSEKMTSRSRPPKDFVCPITGQIFNDPVTLETGQTYERKAIQEWLkrgnttcpitrqplcsnslpkTNYVLKRLITSWKEQYPDLAQEFSYSETPKHSFGSSPLKDMTLASSPSRTFNFHIHNNTDDHINERRKRFTQaanatsptsvisqASVETIINGLKPYVTCLCTSENLQECETAVLAIARLWKESKGDPGVHAYLLKPTIINGFAEILSASLSREVLRTSVYILSELMVADESVGDILTSVDSDFDCLAALLKNGLGEAAVLIYQLRPAFAQLSAHEFIPSLVQLVLNKTEEFDELQFVMEPKDAAIEMLEQILMGGDKKSRSITALSLISANGIPALIKCLDRVEVRRSIVSILLCCMHADKSCKTLIAKRIELSHVLDLFHDGNDSVRGICINFLSELVLLNRRTFSNQILQVIRDEGSFSTMHTFLVYLQMAPMEQQPATASLLLQLDLLVEPRKMSMYREEAVEALIEALRRKDFPNSQMMALDALLSLTGRFTFSGKSYTEALLLKIAGFDQPYNALMKPERLSKPESEMVESMEEEEQAACSWEKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIAAWLTHMLSTLPDTGVRGTARRSLLDEFINVLQSSRNLEEKILTALALKTFISDPVALEELGKYAKCIYGTLRKLKKYSAVVTDIQKALMNLSSVNATELWHCNEVTELDSSTNGEVLSLIHLKgrvlsshsdgtikmwdsGKRVLRLIQEVRehtravtclyvpssgdklysgsLDKTIRVWSIKPEEIHCLQVHNVKEAVHELTANAEIACFVSPATGVKVYNWSGAIKHINFNKHVKSLVMTGDKLYCGCSGYSIQEVDLGNLTSTTFYAGTKKLLGKQTIHSLHMHNGLLFAGGSSVDGTAGKVFSISSKTAVGSFTTGIDIQHLAVNSDFIFTATKCGTIEVWLKERVTRVASvkannsggghakitclgtgvdghpyk
MAGNYRFAMDQKDIVRLMITSVGSFIQDRLINQEERTQHKEQCAERLAAEDGSNDKDSEFRYSDQAVLANLDWGIEALEEAINTSNMETKLARLDYAEKMLQVCAMLDSDQQTAGVPNFYLSAWAHLNLSYLWKLRNNVQNSVLHALEMFSIDPFFSRIDFAPELWKELFLPQMSSIVGWYSEARHRLVMEAIPDSSDLSFTADLDQFFNESLIFSMRPeqveklqqleqlYGDSLDENTRMFAKYYKDCMNSDSSTRTKVIPMLPIAEPPATPLHEFSRSIPDYVKFGPVLPKSAGFSAVLKSKSNMRGPSSPCNESDEGSQSCNSLPCSEKMTSRSRPPKDFVCPITGQIFNDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLCSNSLPKTNYVLKRLITSWKEQYPDLAQEFSYSETPKHSFGSSPLKDMTLASSPSRTFNFHIHNNTDDHINERRKRFTQAANATSPTSVISQASVETIINGLKPYVTCLCTSENLQECETAVLAIARLWKESKGDPGVHAYLLKPTIINGFAEILSASLSREVLRTSVYILSELMVADESVGDILTSVDSDFDCLAALLKNGLGEAAVLIYQLRPAFAQLSAHEFIPSLVQLVLNKTEEFDELQFVMEPKDAAIEMLEQILMGGDKKSRSITALSLISANGIPALIKCLDRVEVRRSIVSILLCCMHADKSCKTLIAKRIELSHVLDLFHDGNDSVRGICINFLSELVLLNRRTFSNQILQVIRDEGSFSTMHTFLVYLQMAPMEQQPATASlllqldllVEPRKMSMYREEAVEALIEALRRKDFPNSQMMALDALLSLTGRFTFSGKSYTEALLLKIAGFDQPYNALMKPERLSKPesemvesmeeeeQAACSWEKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIAAWLTHMLSTLPDTGVRGTARRSLLDEFINVLQSSRNLEEKILTALALKTFISDPVALEELGKYAKCIYGTLRKLKKYSAVVTDIQKALMNLSSVNATELWHCNEVTELDSSTNGEVLSLIHLKGRVLSSHSDGTIKMWDSGKRVLRLIQEVREHTRAVTCLYVPSSGDKLYSGSLDKTIRVWSIKPEEIHCLQVHNVKEAVHELTANAEIACFVSPATGVKVYNWSGAIKHINFNKHVKSLVMTGDKLYCGCSGYSIQEVDLGNLTSTTFYAGTKKLLGKQTIHSLHMHNGLLFAGGSSVDGTAGKVFSISSKTAVGSFTTGIDIQHLAVNSDFIFTATKCGTIEVWLKERVTRVASVKANNSGGGHAKITCLGTGVDGHPYK
*****RFAMDQKDIVRLMITSVGSFIQDRLI******************************YSDQAVLANLDWGIEALEEAINTSNMETKLARLDYAEKMLQVCAMLDSDQQTAGVPNFYLSAWAHLNLSYLWKLRNNVQNSVLHALEMFSIDPFFSRIDFAPELWKELFLPQMSSIVGWYSEARHRLVMEAIPDSSDLSFTADLDQFFNESLIFSMRPEQVEKLQQLEQLYGDSLDENTRMFAKYYKDCM*********VIPML************FSRSIPDYVKFGPVLP**************************************************FVCPITGQIFNDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLCSNSLPKTNYVLKRLITSWKEQYPDLA*************************************************************VISQASVETIINGLKPYVTCLCTSENLQECETAVLAIARLWKESKGDPGVHAYLLKPTIINGFAEILSASLSREVLRTSVYILSELMVADESVGDILTSVDSDFDCLAALLKNGLGEAAVLIYQLRPAFAQLSAHEFIPSLVQLVLNKTEEFDELQFVMEPKDAAIEMLEQILMGGDKKSRSITALSLISANGIPALIKCLDRVEVRRSIVSILLCCMHADKSCKTLIAKRIELSHVLDLFHDGNDSVRGICINFLSELVLLNRRTFSNQILQVIRDEGSFSTMHTFLVYLQMAPMEQQPATASLLLQLDLLVEPRKMSMYREEAVEALIEALRRKDFPNSQMMALDALLSLTGRFTFSGKSYTEALLLKIAGFDQPYNA*************************CSWEKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIAAWLTHMLSTLPDTGVRGTARRSLLDEFINVLQSSRNLEEKILTALALKTFISDPVALEELGKYAKCIYGTLRKLKKYSAVVTDIQKALMNLSSVNATELWHCNEVTELDSSTNGEVLSLIHLKGRVLSSHSDGTIKMWDSGKRVLRLIQEVREHTRAVTCLYVPSSGDKLYSGSLDKTIRVWSIKPEEIHCLQVHNVKEAVHELTANAEIACFVSPATGVKVYNWSGAIKHINFNKHVKSLVMTGDKLYCGCSGYSIQEVDLGNLTSTTFYAGTKKLLGKQTIHSLHMHNGLLFAGGSSVDGTAGKVFSISSKTAVGSFTTGIDIQHLAVNSDFIFTATKCGTIEVWLKERVTRVASVKANNSGGGHAKITCLGTG*******
**********QKDIVRLMITSVGSFIQDRLINQEERTQHKEQCAERLAAED*************QAVLANLDWGIEALEEAI**************************S**QTAGVPNFYLSAWAHLNLSYLWKLRNNVQNSVLHALEMFSIDPFFSRIDFAPELWKELFLPQMSSIV********************LSFTADLDQFFN*********************YGDSLDENTRMFAKYYKDC********************************************************************************************DFVCPITGQIFNDPVTLETGQTYERKAIQEWLKRGNTTCP**************NYVLKRLITSWKE******************************************************************SVISQASVETIINGLKPYVTCLCTSENLQECETAVLAIARLWKESKGDPGVHAYLLKPTIINGFAEILSASLSREVLRTSVYILSELMVADESVGDILTSVDSDFDCLAALLKNGLGEAAVLIYQLRPAFAQLSAHEFIPSLVQLVLNKTEEFDELQFVMEPKDAAIEMLEQILMGG************ISANGIPALIKCLDRVEVRRSIVSILLCCMHADKSCKTLIAKRIELSHVLDLFHDGNDSVRGICINFLSELVLLNRRTFSNQILQVIRDEGSFSTMHTFLVYLQMAPMEQQPATASLLLQLDLLVEPRKMSMYREEAVEALIEALRRKDFPNSQMMALDALLSLTGRFTFSGKSYTEALLLKIAGFDQPYNALMKPERL******************CSWEKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIAAWLTHMLSTLPDTGVRGTARRSLLDEFINVLQSSRNLEEKILTALALKTFISDPVALEELGKYAKCIYGTLRKLKKYSAVVTDIQKALMNLSSVNATELWHCNEVTELDSSTNGEVLSLIHLKGRVLSSHSDGTIKMWDSGKRVLRLIQEVREHTRAVTCLYVPSSGDKLYSGSLDKTIRVWSIKPEEIHCLQVHNVKEAVHELTANAEIACFVSPATGVKVYNWSGAIKHINFNKHVKSLVMTGDKLYCGCSGYSIQEVDLGNLTSTTFYAGTKKLLGKQTIHSLHMHNGLLFAGGSSVDGTAGKVFSISSKTAVGSFTTGIDIQHLAVNSDFIFTATKCGTIEVWLKERVTRVASVKANNSGGGHAKITCLGTGVDGHP**
MAGNYRFAMDQKDIVRLMITSVGSFIQDRLINQEE*********ERLAAEDGSNDKDSEFRYSDQAVLANLDWGIEALEEAINTSNMETKLARLDYAEKMLQVCAMLDSDQQTAGVPNFYLSAWAHLNLSYLWKLRNNVQNSVLHALEMFSIDPFFSRIDFAPELWKELFLPQMSSIVGWYSEARHRLVMEAIPDSSDLSFTADLDQFFNESLIFSMRPEQVEKLQQLEQLYGDSLDENTRMFAKYYKDCMNSDSSTRTKVIPMLPIAEPPATPLHEFSRSIPDYVKFGPVLPKSAGFSAVLK************************************PPKDFVCPITGQIFNDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLCSNSLPKTNYVLKRLITSWKEQYPDLAQEFSY**********SPLKDMTLASSPSRTFNFHIHNNTDDHINERRKRF***********VISQASVETIINGLKPYVTCLCTSENLQECETAVLAIARLWKESKGDPGVHAYLLKPTIINGFAEILSASLSREVLRTSVYILSELMVADESVGDILTSVDSDFDCLAALLKNGLGEAAVLIYQLRPAFAQLSAHEFIPSLVQLVLNKTEEFDELQFVMEPKDAAIEMLEQILMGGDKKSRSITALSLISANGIPALIKCLDRVEVRRSIVSILLCCMHADKSCKTLIAKRIELSHVLDLFHDGNDSVRGICINFLSELVLLNRRTFSNQILQVIRDEGSFSTMHTFLVYLQMAPMEQQPATASLLLQLDLLVEPRKMSMYREEAVEALIEALRRKDFPNSQMMALDALLSLTGRFTFSGKSYTEALLLKIAGFDQPYNALMKPER********************SWEKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIAAWLTHMLSTLPDTGVRGTARRSLLDEFINVLQSSRNLEEKILTALALKTFISDPVALEELGKYAKCIYGTLRKLKKYSAVVTDIQKALMNLSSVNATELWHCNEVTELDSSTNGEVLSLIHLKGRVLSSHSDGTIKMWDSGKRVLRLIQEVREHTRAVTCLYVPSSGDKLYSGSLDKTIRVWSIKPEEIHCLQVHNVKEAVHELTANAEIACFVSPATGVKVYNWSGAIKHINFNKHVKSLVMTGDKLYCGCSGYSIQEVDLGNLTSTTFYAGTKKLLGKQTIHSLHMHNGLLFAGGSSVDGTAGKVFSISSKTAVGSFTTGIDIQHLAVNSDFIFTATKCGTIEVWLKERVTRVASVKANNSGGGHAKITCLGTGVDGHPYK
****YRFAMDQKDIVRLMITSVGSFIQDRLINQEERTQHKEQCAERLAAEDGSNDKDSEFRYSDQAVLANLDWGIEALEEAINTSNMETKLARLDYAEKMLQVCAMLDSDQQTAGVPNFYLSAWAHLNLSYLWKLRNNVQNSVLHALEMFSIDPFFSRIDFAPELWKELFLPQMSSIVGWYSEARHRLVMEAIPDSSDLSFTADLDQFFNESLIFSMRPEQVEKLQQLEQLYGDSLDENTRMFAKYYKDCMNSDSSTRTKVIPMLPIAEPPATPLHEFSRSIPDYVKFGPVLPKSAGFSAVLKSKSNMRG**************************RSRPPKDFVCPITGQIFNDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLCSNSLPKTNYVLKRLITSWKEQYPDLAQ*********************LASSPSRTFNFHIHNNTDDHINERRKRFTQAANATSPTSVISQASVETIINGLKPYVTCLCTSENLQECETAVLAIARLWKESKGDPGVHAYLLKPTIINGFAEILSASLSREVLRTSVYILSELMVADESVGDILTSVDSDFDCLAALLKNGLGEAAVLIYQLRPAFAQLSAHEFIPSLVQLVLNKTEEFDELQFVMEPKDAAIEMLEQILMGGDKKSRSITALSLISANGIPALIKCLDRVEVRRSIVSILLCCMHADKSCKTLIAKRIELSHVLDLFHDGNDSVRGICINFLSELVLLNRRTFSNQILQVIRDEGSFSTMHTFLVYLQMAPMEQQPATASLLLQLDLLVEPRKMSMYREEAVEALIEALRRKDFPNSQMMALDALLSLTGRFTFSGKSYTEALLLKIAGFDQPYNALMKPERLSKPESEMVESMEEEEQAACSWEKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIAAWLTHMLSTLPDTGVRGTARRSLLDEFINVLQSSRNLEEKILTALALKTFISDPVALEELGKYAKCIYGTLRKLKKYSAVVTDIQKALMNLSSVNATELWHCNEVTELDSSTNGEVLSLIHLKGRVLSSHSDGTIKMWDSGKRVLRLIQEVREHTRAVTCLYVPSSGDKLYSGSLDKTIRVWSIKPEEIHCLQVHNVKEAVHELTANAEIACFVSPATGVKVYNWSGAIKHINFNKHVKSLVMTGDKLYCGCSGYSIQEVDLGNLTSTTFYAGTKKLLGKQTIHSLHMHNGLLFAGGSSVDGTAGKVFSISSKTAVGSFTTGIDIQHLAVNSDFIFTATKCGTIEVWLKERVTRVASVKANNSGGGHAKITCLGTGVDG****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGNYRFAMDQKDIVRLMITSVGSFIQDRLINQEERTQHKEQCAERLAAEDGSNDKDSEFRYSDQAVLANLDWGIEALEEAINTSNMETKLARLDYAEKMLQVCAMLDSDQQTAGVPNFYLSAWAHLNLSYLWKLRNNVQNSVLHALEMFSIDPFFSRIDFAPELWKELFLPQMSSIVGWYSEARHRLVMEAIPDSSDLSFTADLDQFFNESLIFSMRPEQVEKLQQLEQLYGDSLDENTRMFAKYYKDCMNSDSSTRTKVIPMLPIAEPPATPLHEFSRSIPDYVKFGPVLPKSAGFSAVLKSKSNMRGPSSPCNESDEGSQSCNSLPCSEKMTSRSRPPKDFVCPITGQIFNDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLCSNSLPKTNYVLKRLITSWKEQYPDLAQEFSYSETPKHSFGSSPLKDMTLASSPSRTFNFHIHNNTDDHINERRKRFTQAANATSPTSVISQASVETIINGLKPYVTCLCTSENLQECETAVLAIARLWKESKGDPGVHAYLLKPTIINGFAEILSASLSREVLRTSVYILSELMVADESVGDILTSVDSDFDCLAALLKNGLGEAAVLIYQLRPAFAQLSAHEFIPSLVQLVLNKTEEFDELQFVMEPKDAAIEMLEQILMGGDKKSRSITALSLISANGIPALIKCLDRVEVRRSIVSILLCCMHADKSCKTLIAKRIELSHVLDLFHDGNDSVRGICINFLSELVLLNRRTFSNQILQVIRDEGSFSTMHTFLVYLQMAPMEQQPATASLLLQLDLLVEPRKMSMYREEAVEALIEALRRKDFPNSQMMALDALLSLTGRFTFSGKSYTEALLLKIAGFDQPYNALMKPERLSKPESEMVESMEEEEQAACSWEKRVAFVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIAAWLTHMLSTLPDTGVRGTARRSLLDEFINVLQSSRNLEEKILTALALKTFISDPVALEELGKYAKCIYGTLRKLKKYSAVVTDIQKALMNLSSVNATELWHCNEVTELDSSTNGEVLSLIHLKGRVLSSHSDGTIKMWDSGKRVLRLIQEVREHTRAVTCLYVPSSGDKLYSGSLDKTIRVWSIKPEEIHCLQVHNVKEAVHELTANAEIACFVSPATGVKVYNWSGAIKHINFNKHVKSLVMTGDKLYCGCSGYSIQEVDLGNLTSTTFYAGTKKLLGKQTIHSLHMHNGLLFAGGSSVDGTAGKVFSISSKTAVGSFTTGIDIQHLAVNSDFIFTATKCGTIEVWLKERVTRVASVKANNSGGGHAKITCLGTGVDGHPYK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1306 2.2.26 [Sep-21-2011]
C6L7U11485 Putative E3 ubiquitin-pro N/A no 0.753 0.662 0.695 0.0
D1FP531488 Putative E3 ubiquitin-pro N/A no 0.754 0.661 0.687 0.0
D1FP571485 Putative E3 ubiquitin-pro N/A no 0.753 0.662 0.680 0.0
Q9C9A6628 U-box domain-containing p no no 0.342 0.711 0.261 2e-18
Q8GUG9612 U-box domain-containing p no no 0.269 0.575 0.250 2e-16
Q5VRH9611 U-box domain-containing p no no 0.052 0.111 0.521 4e-14
Q9C7R6729 U-box domain-containing p no no 0.181 0.325 0.284 8e-14
Q9SNC6660 U-box domain-containing p no no 0.052 0.103 0.492 2e-13
Q9ZV31654 U-box domain-containing p no no 0.052 0.105 0.471 3e-13
Q0IMG9694 E3 ubiquitin-protein liga no no 0.054 0.102 0.466 4e-13
>sp|C6L7U1|LIN1_LOTJA Putative E3 ubiquitin-protein ligase LIN-1 OS=Lotus japonicus GN=CERBERUS PE=2 SV=2 Back     alignment and function desciption
 Score = 1380 bits (3572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/991 (69%), Positives = 803/991 (81%), Gaps = 7/991 (0%)

Query: 312  SSPCNESDEGSQSCNSLPCSEKMTSRSRPPKDFVCPITGQIFNDPVTLETGQTYERKAIQ 371
            SS C ESD+G QS NSLP  EK++  S+PPKDFVCPITGQIF DPVTLETGQTYERKAIQ
Sbjct: 484  SSLC-ESDDGYQSFNSLPKLEKLSMGSKPPKDFVCPITGQIFCDPVTLETGQTYERKAIQ 542

Query: 372  EWLKRGNTTCPITRQPLCSNSLPKTNYVLKRLITSWKEQYPDLAQEFSYSETPKHSFGSS 431
            EWL+ GNTTCPITRQPL ++ LPKTNYVLKRLITSWKEQ P+LAQEFS   TP+ S  S 
Sbjct: 543  EWLRTGNTTCPITRQPLSASILPKTNYVLKRLITSWKEQNPELAQEFSNVNTPRGSSCSP 602

Query: 432  PLKDMTLASSPSRTFNFHIHNNTDDHINERRKRFTQAANATSPTSVISQASVETIINGLK 491
              KD+ + S+  RT +   H N D +  +R  RF  AA  TSPTSV+SQA+VETI+N LK
Sbjct: 603  SAKDIPMLSTRQRTTDSPNHKNKD-YARQRSNRFMPAAITTSPTSVLSQAAVETIVNSLK 661

Query: 492  PYVTCLCTSENLQECETAVLAIARLWKESKGDPGVHAYLLKPTIINGFAEILSASLSREV 551
            PY++ LCTSENL ECE AVL IARL K+SK +P +H+YL KPTIING  EILSAS +REV
Sbjct: 662  PYISSLCTSENLPECEEAVLKIARLLKDSKTNPQIHSYLSKPTIINGLVEILSASRNREV 721

Query: 552  LRTSVYILSELMVADESVGDILTSVDSDFDCLAALLKNGLGEAAVLIYQLRPAFAQLSAH 611
            LRTS+YILSEL+  D+SV + L SVDSDFDCLA LLKNGL EAA+LIYQLRP FAQLSAH
Sbjct: 722  LRTSIYILSELIFTDDSVAETLNSVDSDFDCLATLLKNGLAEAALLIYQLRPVFAQLSAH 781

Query: 612  EFIPSLVQLVLNKTEEFDELQFVMEPKDAAIEMLEQILMGGDKKSRSITALSLISANGIP 671
            E IPSLV ++ NK EE D+ Q V++PKDAAI +LEQ LMGGD+ SRS+ A S+ISANGIP
Sbjct: 782  ELIPSLVDVIQNKNEELDDFQLVIDPKDAAIAILEQTLMGGDEYSRSLNASSVISANGIP 841

Query: 672  ALIKCLDRVEVRRSIVSILLCCMHADKSCKTLIAKRIELSHVLDLFHDGNDSVRGICINF 731
             L+K L+R+E RRS+VS+LLCCM A+KSCK LIA RIELS VL+LFH GNDSVRG C+ F
Sbjct: 842  TLVKYLERMEGRRSVVSVLLCCMQAEKSCKNLIANRIELSPVLELFHSGNDSVRGTCVEF 901

Query: 732  LSELVLLNRRTFSNQILQVIRDEGSFSTMHTFLVYLQMAPMEQQPATASLLLQLDLLVEP 791
            LSELV LNRRT  NQIL  I+DEG+FSTMHTFLVYLQMAPME Q A ASLLLQLDLL EP
Sbjct: 902  LSELVQLNRRTSCNQILHTIKDEGAFSTMHTFLVYLQMAPMEHQLAVASLLLQLDLLAEP 961

Query: 792  RKMSMYREEAVEALIEALRRKDFPNSQMMALDALLSLTGRFTFSGKSYTEALLLKIAGFD 851
            RKMS+YREEAVE LIEAL +KDF N+QM ALDALL L G  + SGKSYTEA LLKIAGFD
Sbjct: 962  RKMSIYREEAVETLIEALWQKDFSNTQMKALDALLFLIGHISSSGKSYTEAWLLKIAGFD 1021

Query: 852  QPYNALMKPERLSKPESEMVESMEEEEQAACSWEKRVAFVLCNHEKGSIFKALEECLKSN 911
            QPYNALMK E+L + +++++E+ME+E+ A  SW+KR+A VLCNHE GSIFKALEECLKSN
Sbjct: 1022 QPYNALMKVEQLGQHDNDLIETMEDEKNALNSWQKRIASVLCNHENGSIFKALEECLKSN 1081

Query: 912  SLEMAKSCLVIAAWLTHMLSTLPDTGVRGTARRSLLDEFINVLQSSRNLEEKILTALALK 971
            SL+MAKSCLV+A WLTHML TLPDTGVR  AR+SLL+E INVLQSS+NLEEKIL  LALK
Sbjct: 1082 SLKMAKSCLVLATWLTHMLYTLPDTGVRDVARKSLLEEVINVLQSSKNLEEKILATLALK 1141

Query: 972  TFISDPVALEELGKYAKCIYGTLRKLKKYSAVVTDIQKALMNLSSVNATELWHCNEVTEL 1031
            TFISDP   E L  YAK IY TLR+LKKYS V  DI K ++NL SV+ TELW C EV EL
Sbjct: 1142 TFISDPSTHEALRVYAKSIYRTLRRLKKYSVVAVDIMKVILNLKSVDVTELWSCKEVVEL 1201

Query: 1032 DSSTNGEVLSLIHLKGRVLSSHSDGTIKMWDSGKRVLRLIQEVREHTRAVTCLYVPSSGD 1091
            D S+NGEVLS+++L G+VLS H+DGTIK+WD+ KR+ R+IQE  EHT+AVT L   SSGD
Sbjct: 1202 DLSSNGEVLSMVYLNGQVLSGHTDGTIKVWDARKRIPRVIQETHEHTKAVTSLC--SSGD 1259

Query: 1092 KLYSGSLDKTIRVWSIKPEEIHCLQVHNVKEAVHELTANAEIACFVSPATGVKVYNWSGA 1151
            +LYSGSLDKTIRVW+IK + I C+ V+++KEAVHEL AN ++AC+VS  TGVKV+NWS A
Sbjct: 1260 RLYSGSLDKTIRVWTIKSDGIKCIDVYDIKEAVHELAANDKLACYVSQGTGVKVFNWSEA 1319

Query: 1152 IKHINFNKHVKSLVMTGDKLYCGCSGYSIQEVDLGNLTSTTFYAGTKKLLGKQTIHSLHM 1211
             K INF+K+VKSL + GDKLYCGCSGYSIQEVDL   TS +F+ GT+KLLGKQTIHSL +
Sbjct: 1320 PKLINFSKYVKSLAVAGDKLYCGCSGYSIQEVDLSTYTSNSFFTGTRKLLGKQTIHSLQI 1379

Query: 1212 HNGLLFAGGSSVDGTAGKVFSISSKTAVGSFTTGIDIQHLAVNSDFIFTATKCGTIEVWL 1271
            H+  LFA GSSVD TAGK+FS+S K  VGS +TG+DI  +A+NSDFIF  TK GTIEVWL
Sbjct: 1380 HDDYLFACGSSVDATAGKIFSLSQKMVVGSLSTGLDIHRIAINSDFIFAGTKFGTIEVWL 1439

Query: 1272 KERVTRVASVKANNSGGGHAKITCLGTGVDG 1302
            K++ TRVAS+K     GGH KIT L + VDG
Sbjct: 1440 KDKFTRVASIKM---AGGHTKITSLVSDVDG 1467
Putative E3 ubiquitin-protein ligase involved in the rhizobial infection process. Plays an important role in the early steps of infection thread formation and in growth and differentiation of nodules.
Lotus japonicus (taxid: 34305)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|D1FP53|LIN_MEDTR Putative E3 ubiquitin-protein ligase LIN OS=Medicago truncatula GN=LIN PE=2 SV=1 Back     alignment and function description
>sp|D1FP57|LIN2_LOTJA Putative E3 ubiquitin-protein ligase LIN-2 OS=Lotus japonicus GN=LIN PE=1 SV=1 Back     alignment and function description
>sp|Q9C9A6|PUB10_ARATH U-box domain-containing protein 10 OS=Arabidopsis thaliana GN=PUB10 PE=2 SV=1 Back     alignment and function description
>sp|Q8GUG9|PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis thaliana GN=PUB11 PE=2 SV=2 Back     alignment and function description
>sp|Q5VRH9|PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q9C7R6|PUB17_ARATH U-box domain-containing protein 17 OS=Arabidopsis thaliana GN=PUB17 PE=2 SV=1 Back     alignment and function description
>sp|Q9SNC6|PUB13_ARATH U-box domain-containing protein 13 OS=Arabidopsis thaliana GN=PUB13 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZV31|PUB12_ARATH U-box domain-containing protein 12 OS=Arabidopsis thaliana GN=PUB12 PE=2 SV=1 Back     alignment and function description
>sp|Q0IMG9|SL11_ORYSJ E3 ubiquitin-protein ligase SPL11 OS=Oryza sativa subsp. japonica GN=SPL11 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1306
255538954 1427 hypothetical protein RCOM_1598060 [Ricin 0.727 0.665 0.748 0.0
359492749 1494 PREDICTED: putative E3 ubiquitin-protein 0.755 0.660 0.735 0.0
302142671 1510 unnamed protein product [Vitis vinifera] 0.755 0.653 0.735 0.0
147781088 1494 hypothetical protein VITISV_011516 [Viti 0.755 0.660 0.732 0.0
224061993 1518 predicted protein [Populus trichocarpa] 0.750 0.645 0.696 0.0
356535486 1481 PREDICTED: uncharacterized protein LOC10 0.750 0.661 0.687 0.0
254749428 1477 U-box protein with unknown function [Lot 0.753 0.666 0.695 0.0
353558931 1485 RecName: Full=Putative E3 ubiquitin-prot 0.753 0.662 0.695 0.0
357442765 1490 U-box domain-containing protein [Medicag 0.754 0.661 0.687 0.0
353558688 1488 RecName: Full=Putative E3 ubiquitin-prot 0.754 0.661 0.687 0.0
>gi|255538954|ref|XP_002510542.1| hypothetical protein RCOM_1598060 [Ricinus communis] gi|223551243|gb|EEF52729.1| hypothetical protein RCOM_1598060 [Ricinus communis] Back     alignment and taxonomy information
 Score = 1480 bits (3832), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 716/957 (74%), Positives = 830/957 (86%), Gaps = 7/957 (0%)

Query: 350  GQIFNDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLCSNSLPKTNYVLKRLITSWKE 409
            GQ+F DPVTLETGQTYERKAIQEWLKRGNTTCPITRQPL +NSLPKTNYVLKRLITSWKE
Sbjct: 456  GQLFIDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLSANSLPKTNYVLKRLITSWKE 515

Query: 410  QYPDLAQEFSYSETPKHSFGSSPLKDMTLASSPSRTFNFHIHNNTDDHINERRKRFTQAA 469
            QYPDLAQEFSYSETP++SF SS +K+ TL S PSR F+F   N   ++I++R KRF ++ 
Sbjct: 516  QYPDLAQEFSYSETPRNSFNSSAIKESTLVSIPSR-FDFLSQNCAGNYIHQRSKRFVRST 574

Query: 470  NATSPTSVISQASVETIINGLKPYVTCLCTSENLQECETAVLAIARLWKESKGDPGVHAY 529
             +TSPTSVISQA+++TIINGLKPY++CLCTSENLQECE AVLAIA+LWK+SKGDPG+H+Y
Sbjct: 575  VSTSPTSVISQATIDTIINGLKPYISCLCTSENLQECEAAVLAIAKLWKDSKGDPGLHSY 634

Query: 530  LLKPTIINGFAEILSASLSREVLRTSVYILSELMVADESVGDILTSVDSDFDCLAALLKN 589
            L KPTIING+ EILS+SL+REVLRTS+YILSEL+ +DESVG+ILTSVDSDFDCLAALLKN
Sbjct: 635  LFKPTIINGYVEILSSSLNREVLRTSIYILSELLFSDESVGEILTSVDSDFDCLAALLKN 694

Query: 590  GLGEAAVLIYQLRPAFAQLSAHEFIPSLVQLVLNKTEEFDELQFVMEPKDAAIEMLEQIL 649
            GL EAAVLIYQLRP FAQLSAH FIPSLV L+  K E+ D+LQ V+EPKDAAI +LEQIL
Sbjct: 695  GLAEAAVLIYQLRPTFAQLSAHNFIPSLVHLIQMKNEDSDDLQLVIEPKDAAIALLEQIL 754

Query: 650  MGGDKKSRSITALSLISANGIPALIKCLDRVEVRRSIVSILLCCMHADKSCKTLIAKRIE 709
             GG++ S+SI A S+ISANGIPAL+KCLDR++ R+SI+SILLCC+ ADKSC+  IA RIE
Sbjct: 755  TGGNENSQSINAFSVISANGIPALLKCLDRMDGRKSIISILLCCVLADKSCRDFIASRIE 814

Query: 710  LSHVLDLFHDGNDSVRGICINFLSELVLLNRRTFSNQILQVIRDEGSFSTMHTFLVYLQM 769
            L  VL++FH GND VRG+CI+ LSELV LNRRTF NQIL++I++EGSFSTMHTFLVYLQM
Sbjct: 815  LCPVLEIFHSGNDCVRGVCIDLLSELVQLNRRTFCNQILKIIKEEGSFSTMHTFLVYLQM 874

Query: 770  APMEQQPATASLLLQLDLLVEPRKMSMYREEAVEALIEALRRKDFPNSQMMALDALLSLT 829
            APMEQQP  A+LLLQLDLLVEPRKMS+YREEAVE LIEAL +K+F NSQMMALDAL+SL+
Sbjct: 875  APMEQQPTIATLLLQLDLLVEPRKMSIYREEAVETLIEALHKKEFSNSQMMALDALVSLS 934

Query: 830  GRFTFSGKSYTEALLLKIAGFDQPYNALMKPERLSKPESEMVESMEEEEQAACSWEKRVA 889
            GR T SG+ Y EA LLKIAG+DQPYNALMK E L K E+++ E+ME+EE+AA SWE +VA
Sbjct: 935  GRLTSSGRYYLEAWLLKIAGYDQPYNALMKAEGLKKGENDLAETMEDEEKAASSWETKVA 994

Query: 890  FVLCNHEKGSIFKALEECLKSNSLEMAKSCLVIAAWLTHMLSTLPDTGVRGTARRSLLDE 949
            FVLCNHEKGSIFK LEEC KSNS+EMAKSCLVI+ WL +MLS LPD GVR  AR+ LLDE
Sbjct: 995  FVLCNHEKGSIFKGLEECFKSNSIEMAKSCLVISTWLVYMLSVLPDIGVREVARKYLLDE 1054

Query: 950  FINVLQSSRNLEEKILTALALKTFISDPVALEELGKYAKCIYGTLRKLKKYSAVVTDIQK 1009
            FINVLQSSRN+EEKIL ALALKTF+ D  ALEEL KYAKCIY TLRK K+ S V+ D+ K
Sbjct: 1055 FINVLQSSRNIEEKILAALALKTFVIDGAALEELEKYAKCIYTTLRKFKRTSPVIADVLK 1114

Query: 1010 ALMNLSSVNATELWHCNEVTELDSSTNGEVLSLIHLKGRVLSSHSDGTIKMWDSGKRVLR 1069
            +LMNL+SVNA +LW+C EV EL+SS+NGEVLSL+HL+GRV+SSHSDGTIK+WD+GKRVLR
Sbjct: 1115 SLMNLASVNAVKLWNCTEVVELESSSNGEVLSLLHLRGRVISSHSDGTIKVWDAGKRVLR 1174

Query: 1070 LIQEVREHTRAVTCLYVPSSGDKLYSGSLDKTIRVWSIKPEEIHCLQVHNVKEAVHELTA 1129
            LIQEVREHT+AVTC+ VPS GDKLYSGSLDKTIRVW IKPEEIHC+QVH+VKEAV  LTA
Sbjct: 1175 LIQEVREHTKAVTCICVPSFGDKLYSGSLDKTIRVWVIKPEEIHCVQVHDVKEAVFGLTA 1234

Query: 1130 NAEIACFVSPATGVK----VYNWSGAIKHINFNKHVKSLVMTGDKLYCGCSGYSIQEVDL 1185
            NA++ACF S  TGVK    +YNWSG  KH+ FNK+VKSL MTGDKL+CGCSGYSIQEVDL
Sbjct: 1235 NAKVACFTSQGTGVKASAPIYNWSGIPKHVTFNKNVKSLAMTGDKLFCGCSGYSIQEVDL 1294

Query: 1186 GNLTSTTFYAGTKKLLGKQTIHSLHMHNGLLFAGGSSVDGTAGKVFSISSKTAVGSFTTG 1245
              LTSTTFY+GT+KLLGKQ I+SLH+++ LLFAGGS+VDG AGKVFS S K   GSF+TG
Sbjct: 1295 RKLTSTTFYSGTRKLLGKQNIYSLHINDDLLFAGGSAVDGAAGKVFSHSKKAVKGSFSTG 1354

Query: 1246 IDIQHLAVNSDFIFTATKCGTIEVWLKERVTRVASVKANNSGGGHAKITCLGTGVDG 1302
            +DI H+  N++FIFTATKC  IEVWLKE VT+VAS+K N  GGGHAKIT +   VDG
Sbjct: 1355 LDISHIVGNNEFIFTATKCEVIEVWLKESVTKVASIKVN--GGGHAKITSVALDVDG 1409

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359492749|ref|XP_002279863.2| PREDICTED: putative E3 ubiquitin-protein ligase LIN-1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|302142671|emb|CBI19874.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147781088|emb|CAN74785.1| hypothetical protein VITISV_011516 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224061993|ref|XP_002300701.1| predicted protein [Populus trichocarpa] gi|222842427|gb|EEE79974.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356535486|ref|XP_003536276.1| PREDICTED: uncharacterized protein LOC100776142 [Glycine max] Back     alignment and taxonomy information
>gi|254749428|dbj|BAH86605.1| U-box protein with unknown function [Lotus japonicus] gi|254749430|dbj|BAH86606.1| U-box protein with unknown function [Lotus japonicus] Back     alignment and taxonomy information
>gi|353558931|sp|C6L7U1.2|LIN1_LOTJA RecName: Full=Putative E3 ubiquitin-protein ligase LIN-1; AltName: Full=Protein cerberus Back     alignment and taxonomy information
>gi|357442765|ref|XP_003591660.1| U-box domain-containing protein [Medicago truncatula] gi|358346073|ref|XP_003637097.1| U-box domain-containing protein [Medicago truncatula] gi|355480708|gb|AES61911.1| U-box domain-containing protein [Medicago truncatula] gi|355503032|gb|AES84235.1| U-box domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|353558688|sp|D1FP53.1|LIN_MEDTR RecName: Full=Putative E3 ubiquitin-protein ligase LIN; Short=MtLIN gi|219522090|gb|ACL14419.1| putative E3 ubiquitin ligase [Medicago truncatula] gi|219522092|gb|ACL14420.1| putative E3 ubiquitin ligase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1306
TAIR|locus:2013990628 AT1G71020 [Arabidopsis thalian 0.251 0.522 0.286 4e-17
TAIR|locus:2013688729 PUB17 "plant U-box 17" [Arabid 0.192 0.344 0.279 5.8e-14
DICTYBASE|DDB_G0286735694 DDB_G0286735 "C3HC4-type zinc 0.166 0.314 0.283 6e-13
TAIR|locus:2012136421 PUB26 "plant U-box 26" [Arabid 0.193 0.600 0.271 4.5e-12
TAIR|locus:2082682632 PUB14 "plant U-box 14" [Arabid 0.193 0.400 0.283 1.1e-11
TAIR|locus:2075140660 PUB13 "plant U-box 13" [Arabid 0.174 0.345 0.280 3e-11
UNIPROTKB|Q5VRH9611 PUB12 "U-box domain-containing 0.052 0.111 0.521 5.8e-11
TAIR|locus:2017719612 AT1G23030 [Arabidopsis thalian 0.135 0.289 0.296 7.5e-11
UNIPROTKB|Q0IMG9694 SPL11 "E3 ubiquitin-protein li 0.215 0.404 0.245 1.2e-10
TAIR|locus:2090604421 PUB25 "plant U-box 25" [Arabid 0.195 0.605 0.265 1.2e-10
TAIR|locus:2013990 AT1G71020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 218 (81.8 bits), Expect = 4.0e-17, Sum P(2) = 4.0e-17
 Identities = 107/373 (28%), Positives = 165/373 (44%)

Query:   239 NTRMFAKYYKDCMNSDSSTRTKVIPMLPIAEPPATPLHEFSRSIPDYVKFGPVLP-KSAG 297
             N++ F+    + M  D+S+  KVI  L     P T +H    S+ D  KF    P KS+ 
Sbjct:   156 NSKKFSSGLSEPMEKDASSNRKVIEKLESI--PET-VH----SLSDEKKFESPPPWKSSS 208

Query:   298 FS-AVLKSKS--NMRGPSSPCNESDEGSQSCNSLPCSEKMTSRSRPPKDFVCPITGQIFN 354
              S A   SK   + R   +    SD+ SQ       S+ +T     P+DF+CPI+ ++  
Sbjct:   209 VSLAFFLSKDGDDERLEKAVTENSDD-SQK------SDNLTI----PEDFLCPISLELMK 257

Query:   355 DPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLCSNSLPKTNYVLKRLITSWKEQYPDL 414
             DP  + TGQTYER  IQ W+  GN +CP T+Q L  N     NYVL+ LI+ W  ++ ++
Sbjct:   258 DPAIVSTGQTYERSFIQRWIDCGNLSCPKTQQKL-ENFTLTPNYVLRSLISQWCTKH-NI 315

Query:   415 AQEFSYSE-TPKHSFGSSPLKDMTLASSPSRTFNFHIHNNTDDHINERRKRFTQAANATS 473
              Q   Y     K+S GS   +D++   S  R     + + +   I +RR   ++   + S
Sbjct:   316 EQPGGYMNGRTKNSDGS--FRDLSGDMSAIRALVCKLSSQS---IEDRRTAVSEI-RSLS 369

Query:   474 PTSVISQASVETIINGLKPYVTCLCTSENLQEC-ETAVLAIARLWKESKGDPGVHAYLLK 532
               S  ++  +     G  P +  L TS+   E  E AV  I  L   S  +      +L 
Sbjct:   370 KRSTDNRILIAEA--GAIPVLVKLLTSDGDTETQENAVTCILNL---SIYEHNKELIMLA 424

Query:   533 PTIINGFAEILSASLSREVLRTSVYILSELMVADESVGDILTSVDSDFDCLAALLK---- 588
               + +    +L A  S E    +   L  L +ADE+   I+         L  LL+    
Sbjct:   425 GAVTS-IVLVLRAG-SMEARENAAATLFSLSLADEN--KIIIGASGAIMALVDLLQYGSV 480

Query:   589 NGLGEAAVLIYQL 601
              G  +AA  ++ L
Sbjct:   481 RGKKDAATALFNL 493
GO:0000151 "ubiquitin ligase complex" evidence=IEA
GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005871 "kinesin complex" evidence=IEA
GO:0016567 "protein ubiquitination" evidence=IEA
GO:0019894 "kinesin binding" evidence=IEA
TAIR|locus:2013688 PUB17 "plant U-box 17" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286735 DDB_G0286735 "C3HC4-type zinc finger-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2012136 PUB26 "plant U-box 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082682 PUB14 "plant U-box 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075140 PUB13 "plant U-box 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VRH9 PUB12 "U-box domain-containing protein 12" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2017719 AT1G23030 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q0IMG9 SPL11 "E3 ubiquitin-protein ligase SPL11" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2090604 PUB25 "plant U-box 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.20.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00014413001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (1050 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1306
smart0050463 smart00504, Ubox, Modified RING finger domain 1e-20
pfam0456473 pfam04564, U-box, U-box domain 2e-15
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 6e-13
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-10
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-09
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-09
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 1e-08
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 7e-06
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-05
smart0032040 smart00320, WD40, WD40 repeats 1e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-05
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-05
pfam1178957 pfam11789, zf-Nse, Zinc-finger of the MIZ type in 6e-05
>gnl|CDD|128780 smart00504, Ubox, Modified RING finger domain Back     alignment and domain information 
 Score = 86.1 bits (214), Expect = 1e-20
 Identities = 31/66 (46%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 343 DFVCPITGQIFNDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLCSNSL-PKTNYVLK 401
           +F+CPI+ ++  DPV L +GQTYER AI++WL   + T P+T QPL    L P  N  LK
Sbjct: 1   EFLCPISLEVMKDPVILPSGQTYERSAIEKWLLS-HGTDPVTGQPLTHEDLIP--NLALK 57

Query: 402 RLITSW 407
             I  W
Sbjct: 58  SAIQEW 63

Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination. Length = 63
>gnl|CDD|203049 pfam04564, U-box, U-box domain Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|192832 pfam11789, zf-Nse, Zinc-finger of the MIZ type in Nse subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1306
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.97
KOG0286343 consensus G-protein beta subunit [General function 99.97
KOG0315311 consensus G-protein beta subunit-like protein (con 99.97
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.97
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.96
KOG0295406 consensus WD40 repeat-containing protein [Function 99.96
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.96
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.95
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.95
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.95
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.95
KOG0293519 consensus WD40 repeat-containing protein [Function 99.95
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.95
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.95
KOG0263707 consensus Transcription initiation factor TFIID, s 99.95
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.95
KOG0645312 consensus WD40 repeat protein [General function pr 99.94
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.94
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.94
KOG0295406 consensus WD40 repeat-containing protein [Function 99.94
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.94
KOG0296399 consensus Angio-associated migratory cell protein 99.94
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.94
KOG0286343 consensus G-protein beta subunit [General function 99.93
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.93
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.93
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.93
PLN00181793 protein SPA1-RELATED; Provisional 99.93
KOG0266456 consensus WD40 repeat-containing protein [General 99.93
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.93
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.93
KOG0315311 consensus G-protein beta subunit-like protein (con 99.93
KOG0263707 consensus Transcription initiation factor TFIID, s 99.92
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.92
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.92
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.92
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.92
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.92
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.92
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.92
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.91
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.91
KOG0645312 consensus WD40 repeat protein [General function pr 99.91
KOG0296399 consensus Angio-associated migratory cell protein 99.91
KOG0266456 consensus WD40 repeat-containing protein [General 99.91
PTZ00420 568 coronin; Provisional 99.9
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.9
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.9
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.9
KOG0293519 consensus WD40 repeat-containing protein [Function 99.9
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.9
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.9
PTZ00421 493 coronin; Provisional 99.9
KOG0643327 consensus Translation initiation factor 3, subunit 99.9
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.89
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.89
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.89
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.89
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.89
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.89
PLN00181793 protein SPA1-RELATED; Provisional 99.89
KOG0294362 consensus WD40 repeat-containing protein [Function 99.89
KOG1539 910 consensus WD repeat protein [General function pred 99.88
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.88
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.88
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.88
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.87
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.87
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.87
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.87
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.86
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.86
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.86
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.86
KOG0300481 consensus WD40 repeat-containing protein [Function 99.86
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.86
KOG0268 433 consensus Sof1-like rRNA processing protein (conta 99.86
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.86
KOG0289506 consensus mRNA splicing factor [General function p 99.85
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.85
PTZ00421 493 coronin; Provisional 99.85
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.85
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.85
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.85
KOG0643327 consensus Translation initiation factor 3, subunit 99.85
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.85
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.85
KOG0641350 consensus WD40 repeat protein [General function pr 99.85
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.84
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.84
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.84
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.84
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.84
PTZ00420 568 coronin; Provisional 99.84
KOG0289506 consensus mRNA splicing factor [General function p 99.83
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.83
KOG0300481 consensus WD40 repeat-containing protein [Function 99.83
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.83
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.82
KOG0294362 consensus WD40 repeat-containing protein [Function 99.82
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.81
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.81
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.81
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.81
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.8
KOG0267 825 consensus Microtubule severing protein katanin p80 99.8
KOG1539 910 consensus WD repeat protein [General function pred 99.8
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.8
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.8
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.8
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.79
KOG0270463 consensus WD40 repeat-containing protein [Function 99.79
KOG0267 825 consensus Microtubule severing protein katanin p80 99.79
KOG0646 476 consensus WD40 repeat protein [General function pr 99.79
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.78
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.78
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.78
KOG2096420 consensus WD40 repeat protein [General function pr 99.77
KOG1274 933 consensus WD40 repeat protein [General function pr 99.76
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.75
KOG0641350 consensus WD40 repeat protein [General function pr 99.75
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.75
KOG4283397 consensus Transcription-coupled repair protein CSA 99.75
KOG2055514 consensus WD40 repeat protein [General function pr 99.74
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.74
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.74
KOG0302440 consensus Ribosome Assembly protein [General funct 99.74
KOG0639705 consensus Transducin-like enhancer of split protei 99.74
KOG4328498 consensus WD40 protein [Function unknown] 99.73
KOG0302440 consensus Ribosome Assembly protein [General funct 99.73
KOG1273405 consensus WD40 repeat protein [General function pr 99.73
KOG2048 691 consensus WD40 repeat protein [General function pr 99.72
KOG0646476 consensus WD40 repeat protein [General function pr 99.71
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.71
KOG2096420 consensus WD40 repeat protein [General function pr 99.71
KOG0639705 consensus Transducin-like enhancer of split protei 99.71
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.71
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.7
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.7
KOG4283397 consensus Transcription-coupled repair protein CSA 99.7
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.69
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.69
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.69
KOG1274 933 consensus WD40 repeat protein [General function pr 99.69
KOG1063 764 consensus RNA polymerase II elongator complex, sub 99.68
KOG4328498 consensus WD40 protein [Function unknown] 99.68
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.67
KOG1273405 consensus WD40 repeat protein [General function pr 99.66
KOG2048 691 consensus WD40 repeat protein [General function pr 99.65
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.65
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.64
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.64
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.63
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.61
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.61
KOG4224550 consensus Armadillo repeat protein VAC8 required f 99.61
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.61
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.6
KOG2055514 consensus WD40 repeat protein [General function pr 99.59
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.59
KOG0649325 consensus WD40 repeat protein [General function pr 99.58
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.57
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.56
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.55
KOG0270463 consensus WD40 repeat-containing protein [Function 99.55
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.55
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.54
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.54
KOG0649325 consensus WD40 repeat protein [General function pr 99.52
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.52
KOG4227 609 consensus WD40 repeat protein [General function pr 99.51
COG2319466 FOG: WD40 repeat [General function prediction only 99.5
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.49
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.47
KOG1188376 consensus WD40 repeat protein [General function pr 99.47
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.47
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.47
COG2319 466 FOG: WD40 repeat [General function prediction only 99.46
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.45
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.44
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.44
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.44
KOG1188376 consensus WD40 repeat protein [General function pr 99.44
KOG1963 792 consensus WD40 repeat protein [General function pr 99.43
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.42
PRK11028330 6-phosphogluconolactonase; Provisional 99.4
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.4
KOG0771398 consensus Prolactin regulatory element-binding pro 99.39
KOG1334559 consensus WD40 repeat protein [General function pr 99.39
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.39
PRK01742429 tolB translocation protein TolB; Provisional 99.37
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.36
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.35
KOG14451012 consensus Tumor-specific antigen (contains WD repe 99.34
PF05804708 KAP: Kinesin-associated protein (KAP) 99.34
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.32
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.31
PRK11028330 6-phosphogluconolactonase; Provisional 99.31
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.29
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.28
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.27
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.26
KOG0771398 consensus Prolactin regulatory element-binding pro 99.26
KOG1963 792 consensus WD40 repeat protein [General function pr 99.25
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.25
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.23
PF05804708 KAP: Kinesin-associated protein (KAP) 99.21
KOG2111346 consensus Uncharacterized conserved protein, conta 99.21
KOG2321 703 consensus WD40 repeat protein [General function pr 99.18
KOG1310 758 consensus WD40 repeat protein [General function pr 99.16
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.15
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.15
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.14
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.14
KOG1334 559 consensus WD40 repeat protein [General function pr 99.14
PRK03629429 tolB translocation protein TolB; Provisional 99.13
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.12
PRK01742429 tolB translocation protein TolB; Provisional 99.11
KOG2111 346 consensus Uncharacterized conserved protein, conta 99.1
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.1
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.09
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.08
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.06
KOG1409404 consensus Uncharacterized conserved protein, conta 99.05
PRK04922433 tolB translocation protein TolB; Provisional 99.04
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.04
PRK05137435 tolB translocation protein TolB; Provisional 99.03
PRK04922433 tolB translocation protein TolB; Provisional 99.02
PRK02889427 tolB translocation protein TolB; Provisional 99.02
PRK05137435 tolB translocation protein TolB; Provisional 99.02
KOG4227 609 consensus WD40 repeat protein [General function pr 99.01
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 98.99
KOG2139 445 consensus WD40 repeat protein [General function pr 98.98
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 98.98
KOG2321 703 consensus WD40 repeat protein [General function pr 98.98
KOG1310 758 consensus WD40 repeat protein [General function pr 98.98
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.93
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.93
PRK03629429 tolB translocation protein TolB; Provisional 98.93
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.92
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.91
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 98.89
PRK02889427 tolB translocation protein TolB; Provisional 98.89
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 98.88
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.87
KOG2139445 consensus WD40 repeat protein [General function pr 98.86
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.81
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.79
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.77
KOG0287442 consensus Postreplication repair protein RAD18 [Re 98.76
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.76
PRK04792448 tolB translocation protein TolB; Provisional 98.75
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.75
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.73
KOG4547 541 consensus WD40 repeat-containing protein [General 98.72
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.72
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.71
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.71
PRK00178430 tolB translocation protein TolB; Provisional 98.7
PRK00178430 tolB translocation protein TolB; Provisional 98.66
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.66
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.65
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.64
COG5432391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.63
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.62
PRK04792448 tolB translocation protein TolB; Provisional 98.61
KOG4547 541 consensus WD40 repeat-containing protein [General 98.6
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 98.58
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.58
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 98.57
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.56
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.54
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.53
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.51
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.49
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.49
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.49
KOG2315 566 consensus Predicted translation initiation factor 98.48
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.47
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.46
PRK01029428 tolB translocation protein TolB; Provisional 98.45
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.45
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.45
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.44
PHA02929238 N1R/p28-like protein; Provisional 98.41
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.4
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.39
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.39
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.38
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.38
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.37
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.36
KOG3914 390 consensus WD repeat protein WDR4 [Function unknown 98.31
KOG2695425 consensus WD40 repeat protein [General function pr 98.3
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.29
KOG0311381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.26
COG4946 668 Uncharacterized protein related to the periplasmic 98.23
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.22
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.22
KOG1048717 consensus Neural adherens junction protein Plakoph 98.22
PRK01029428 tolB translocation protein TolB; Provisional 98.2
KOG2177386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.19
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.18
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.17
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.16
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.15
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.15
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.13
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.12
PHA02926242 zinc finger-like protein; Provisional 98.11
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.11
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.1
KOG1409 404 consensus Uncharacterized conserved protein, conta 98.08
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.07
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.05
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.04
TIGR00570309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.04
PF1463444 zf-RING_5: zinc-RING finger domain 98.03
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.02
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.02
KOG1048717 consensus Neural adherens junction protein Plakoph 98.02
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.01
KOG4199461 consensus Uncharacterized conserved protein [Funct 98.0
KOG2315 566 consensus Predicted translation initiation factor 97.99
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.99
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 97.94
KOG2695425 consensus WD40 repeat protein [General function pr 97.94
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.91
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.91
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.89
PRK04043419 tolB translocation protein TolB; Provisional 97.88
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 97.88
KOG2314 698 consensus Translation initiation factor 3, subunit 97.86
KOG4714319 consensus Nucleoporin [Nuclear structure] 97.86
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 97.82
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.82
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.82
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.81
KOG1912 1062 consensus WD40 repeat protein [General function pr 97.79
KOG4199461 consensus Uncharacterized conserved protein [Funct 97.78
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.78
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.78
PRK09687280 putative lyase; Provisional 97.77
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.76
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.76
KOG2660331 consensus Locus-specific chromosome binding protei 97.76
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 97.76
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.75
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.73
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.72
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.69
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 97.68
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.67
COG5222427 Uncharacterized conserved protein, contains RING Z 97.67
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 97.66
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.66
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.64
KOG4159398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.64
PRK09687280 putative lyase; Provisional 97.6
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 97.57
PRK04043419 tolB translocation protein TolB; Provisional 97.56
KOG3621 726 consensus WD40 repeat-containing protein [General 97.53
KOG0297391 consensus TNF receptor-associated factor [Signal t 97.5
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.49
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 97.49
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 97.49
KOG2314 698 consensus Translation initiation factor 3, subunit 97.46
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 97.42
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 97.41
COG4946668 Uncharacterized protein related to the periplasmic 97.41
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.4
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 97.39
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 97.35
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 97.35
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.35
KOG0824324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.34
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.34
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.32
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.31
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.31
KOG2122 2195 consensus Beta-catenin-binding protein APC, contai 97.24
COG5152259 Uncharacterized conserved protein, contains RING a 97.18
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.15
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.14
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.11
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 97.04
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.01
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.0
KOG1008 783 consensus Uncharacterized conserved protein, conta 96.94
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.86
KOG1008 783 consensus Uncharacterized conserved protein, conta 96.84
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.78
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 96.77
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 96.75
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 96.72
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 96.72
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 96.7
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.66
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.63
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.62
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 96.62
KOG1222791 consensus Kinesin associated protein KAP [Intracel 96.58
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.57
KOG1002791 consensus Nucleotide excision repair protein RAD16 96.5
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.46
KOG1222791 consensus Kinesin associated protein KAP [Intracel 96.32
PRK02888 635 nitrous-oxide reductase; Validated 96.27
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.24
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 96.23
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 96.17
KOG4367699 consensus Predicted Zn-finger protein [Function un 96.16
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 96.15
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.12
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.02
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 95.97
KOG3621 726 consensus WD40 repeat-containing protein [General 95.96
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.88
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.88
TIGR02270410 conserved hypothetical protein. Members are found 95.74
KOG4649 354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 95.72
PHA02713557 hypothetical protein; Provisional 95.58
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 95.57
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 95.56
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 95.55
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 95.53
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 95.51
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 95.44
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 95.35
KOG2042943 consensus Ubiquitin fusion degradation protein-2 [ 95.3
KOG4646173 consensus Uncharacterized conserved protein, conta 95.27
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.24
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 95.22
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 95.15
PF05536543 Neurochondrin: Neurochondrin 95.06
PF05536543 Neurochondrin: Neurochondrin 95.04
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.0
PF04641260 Rtf2: Rtf2 RING-finger 94.99
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 94.91
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 94.87
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 94.74
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 94.64
KOG3039303 consensus Uncharacterized conserved protein [Funct 94.61
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 94.56
PF01602526 Adaptin_N: Adaptin N terminal region; InterPro: IP 94.56
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 94.47
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 94.36
KOG2444238 consensus WD40 repeat protein [General function pr 94.28
COG0823425 TolB Periplasmic component of the Tol biopolymer t 94.18
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 94.18
KOG01681051 consensus Putative ubiquitin fusion degradation pr 93.98
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 93.97
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 93.97
COG3391381 Uncharacterized conserved protein [Function unknow 93.95
COG1413335 FOG: HEAT repeat [Energy production and conversion 93.72
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 93.7
KOG2395644 consensus Protein involved in vacuole import and d 93.62
COG3391381 Uncharacterized conserved protein [Function unknow 93.61
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 93.6
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 93.6
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 93.59
COG0823425 TolB Periplasmic component of the Tol biopolymer t 93.57
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 93.55
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 93.53
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 93.5
KOG2734536 consensus Uncharacterized conserved protein [Funct 93.45
KOG0946970 consensus ER-Golgi vesicle-tethering protein p115 93.41
smart0032040 WD40 WD40 repeats. Note that these repeats are per 93.24
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 93.19
KOG21711075 consensus Karyopherin (importin) beta 3 [Nuclear s 93.15
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 93.11
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 93.02
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 93.02
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 92.94
PTZ00429746 beta-adaptin; Provisional 92.91
KOG3039303 consensus Uncharacterized conserved protein [Funct 92.8
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 92.67
KOG2395 644 consensus Protein involved in vacuole import and d 92.57
PHA03098534 kelch-like protein; Provisional 92.47
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 92.36
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 92.27
KOG2444238 consensus WD40 repeat protein [General function pr 92.11
PRK02888 635 nitrous-oxide reductase; Validated 91.87
PHA02713557 hypothetical protein; Provisional 91.83
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 91.81
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 91.76
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 91.72
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 91.63
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 91.61
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 91.61
PF10433504 MMS1_N: Mono-functional DNA-alkylating methyl meth 91.53
COG5175480 MOT2 Transcriptional repressor [Transcription] 91.43
COG3386307 Gluconolactonase [Carbohydrate transport and metab 91.29
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 91.25
KOG1001674 consensus Helicase-like transcription factor HLTF/ 91.22
COG3490366 Uncharacterized protein conserved in bacteria [Fun 91.2
KOG08251134 consensus PHD Zn-finger protein [General function 91.12
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=1.8e-38  Score=344.15  Aligned_cols=301  Identities=17%  Similarity=0.252  Sum_probs=259.9

Q ss_pred             hccccccccccccccccc-----cEEEEEeCCCcEEEEeCCC--ceEEcccCCCCEEEEEEeCC--EEEEEECCCcEEEE
Q 000744          991 YGTLRKLKKYSAVVTDIQ-----KALMNLSSVNATELWHCNE--VTELDSSTNGEVLSLIHLKG--RVLSSHSDGTIKMW 1061 (1306)
Q Consensus       991 ~~~l~~l~ghs~~V~~i~-----~~Lasgs~Dg~I~IWd~~~--~~~i~~~H~~~V~sl~fspd--~LaSgs~Dg~I~vW 1061 (1306)
                      ..+-..+.||.+.|-++.     ..|+||+.|.++|+||+.+  ...+..+|...|.|++|+||  .|+||+.||+|++|
T Consensus       105 trCssS~~GH~e~Vl~~~fsp~g~~l~tGsGD~TvR~WD~~TeTp~~t~KgH~~WVlcvawsPDgk~iASG~~dg~I~lw  184 (480)
T KOG0271|consen  105 TRCSSSIAGHGEAVLSVQFSPTGSRLVTGSGDTTVRLWDLDTETPLFTCKGHKNWVLCVAWSPDGKKIASGSKDGSIRLW  184 (480)
T ss_pred             ceeccccCCCCCcEEEEEecCCCceEEecCCCceEEeeccCCCCcceeecCCccEEEEEEECCCcchhhccccCCeEEEe
Confidence            355678899999998877     7999999999999999875  55666899999999999997  99999999999999


Q ss_pred             eCCCCccceEEEEcccCccEEEEEEcC-----CCCEEEEEeCCCcEEEEEcCCCceeEEEee-cCCCCeEEEEe-CCcEE
Q 000744         1062 DSGKRVLRLIQEVREHTRAVTCLYVPS-----SGDKLYSGSLDKTIRVWSIKPEEIHCLQVH-NVKEAVHELTA-NAEIA 1134 (1306)
Q Consensus      1062 d~~t~~~~~i~~l~~H~~~V~sl~fsp-----dg~~L~Sgs~DgtI~VWdi~~~~~~~i~~~-~~~~~V~sl~~-~~~~v 1134 (1306)
                      |.++|. +....+.+|+..|++++|.|     ..++|+|+|.||+|+|||+..+  .++... .|..+|+|+.| ...++
T Consensus       185 dpktg~-~~g~~l~gH~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~--~~~~~lsgHT~~VTCvrwGG~gli  261 (480)
T KOG0271|consen  185 DPKTGQ-QIGRALRGHKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLG--TCVRTLSGHTASVTCVRWGGEGLI  261 (480)
T ss_pred             cCCCCC-cccccccCcccceeEEeecccccCCCccceecccCCCCEEEEEccCc--eEEEEeccCccceEEEEEcCCceE
Confidence            999884 56688999999999999976     4679999999999999999987  444443 47799999999 46666


Q ss_pred             EEEcCCCeEEEEEecCC---EEEeccCCCeEEEEEe-------------CC-------------------------EEEE
Q 000744         1135 CFVSPATGVKVYNWSGA---IKHINFNKHVKSLVMT-------------GD-------------------------KLYC 1173 (1306)
Q Consensus      1135 ~~s~dg~~I~i~~~~~~---~~l~~~~~~V~sl~~s-------------~d-------------------------~L~s 1173 (1306)
                      ..++.++.|++|.....   ..+.+|..+|+.++.+             ++                         .+++
T Consensus       262 ySgS~DrtIkvw~a~dG~~~r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~erlVS  341 (480)
T KOG0271|consen  262 YSGSQDRTIKVWRALDGKLCRELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSGERLVS  341 (480)
T ss_pred             EecCCCceEEEEEccchhHHHhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHHHHHhhccCcceeEE
Confidence            66666677999998753   2356788899988877             22                         3999


Q ss_pred             EECCCcEEEEECCCCc-eeEEecCcccccCCc-cEEEEEEeCCcEEEEEEecCCCEEEEEECCCCceEEEEecC-CCEEE
Q 000744         1174 GCSGYSIQEVDLGNLT-STTFYAGTKKLLGKQ-TIHSLHMHNGLLFAGGSSVDGTAGKVFSISSKTAVGSFTTG-IDIQH 1250 (1306)
Q Consensus      1174 gs~Dg~I~iwDl~~~~-~~~~~~~~~~l~gh~-~I~sl~~s~~~~llas~s~Dg~~I~IWD~~t~~~l~~l~~~-~~V~s 1250 (1306)
                      |+.|.++.+|+....+ ++.      ++.||+ -|+.+.|+|++.+++++|.|. +|++||-++|+.+.+|.+| ..|+.
T Consensus       342 gsDd~tlflW~p~~~kkpi~------rmtgHq~lVn~V~fSPd~r~IASaSFDk-SVkLW~g~tGk~lasfRGHv~~VYq  414 (480)
T KOG0271|consen  342 GSDDFTLFLWNPFKSKKPIT------RMTGHQALVNHVSFSPDGRYIASASFDK-SVKLWDGRTGKFLASFRGHVAAVYQ  414 (480)
T ss_pred             ecCCceEEEecccccccchh------hhhchhhheeeEEECCCccEEEEeeccc-ceeeeeCCCcchhhhhhhccceeEE
Confidence            9999999999876543 443      567888 999999999999999999999 8999999999999999965 56999


Q ss_pred             EEEcCc--EEEEEECCCcEEEEECCCCeEEEEEecccCCCCCCCeEEEEEcCCCCccC
Q 000744         1251 LAVNSD--FIFTATKCGTIEVWLKERVTRVASVKANNSGGGHAKITCLGTGVDGHPYK 1306 (1306)
Q Consensus      1251 la~spd--~Lasgs~Dg~I~IWd~~tg~~l~~l~~~~~~~~~~~V~slafSpdg~~La 1306 (1306)
                      ++|+.|  +|++||.|.++++|++++.+....+.+     |.+.|+++.|+|||+.++
T Consensus       415 vawsaDsRLlVS~SkDsTLKvw~V~tkKl~~DLpG-----h~DEVf~vDwspDG~rV~  467 (480)
T KOG0271|consen  415 VAWSADSRLLVSGSKDSTLKVWDVRTKKLKQDLPG-----HADEVFAVDWSPDGQRVA  467 (480)
T ss_pred             EEeccCccEEEEcCCCceEEEEEeeeeeecccCCC-----CCceEEEEEecCCCceee
Confidence            999999  999999999999999999998888875     889999999999998764

>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG1048 consensus Neural adherens junction protein Plakophilin and related Armadillo repeat proteins [Signal transduction mechanisms; Extracellular structures] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4199 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2122 consensus Beta-catenin-binding protein APC, contains ARM repeats [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1222 consensus Kinesin associated protein KAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG2042 consensus Ubiquitin fusion degradation protein-2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4646 consensus Uncharacterized conserved protein, contains ARM repeats [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2734 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF10433 MMS1_N: Mono-functional DNA-alkylating methyl methanesulfonate N-term; PDB: 2B5M_A 4A0K_C 4A0B_C 3I7L_A 2B5N_C 3I8E_A 4A09_A 4A0A_A 3EI4_C 2B5L_A Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1306
1t1h_A78 Nmr Solution Structure Of The U Box Domain From Atp 5e-12
1gxr_A337 Wd40 Region Of Human Groucho/tle1 Length = 337 1e-05
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 3e-04
2oxq_C80 Structure Of The Ubch5 :chip U-Box Complex Length = 4e-04
2f42_A179 Dimerization And U-Box Domains Of Zebrafish C-Termi 6e-04
>pdb|1T1H|A Chain A, Nmr Solution Structure Of The U Box Domain From Atpub14, An Armadillo Repeat Containing Protein From Arabidopsis Thaliana Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
Query: 341 PKDFVCPITGQIFNDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLCSNSLPKTNYVL 400
           P+ F CPI+ ++  DPV + TGQTYER +IQ+WL  G+ TCP +++ L    L   NYVL
Sbjct: 6   PEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGL-TPNYVL 64
Query: 401 KRLITSWKE 409
           K LI  W E
Sbjct: 65  KSLIALWCE 73
>pdb|1GXR|A Chain A, Wd40 Region Of Human Groucho/tle1 Length = 337 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|2OXQ|C Chain C, Structure Of The Ubch5 :chip U-Box Complex Length = 80 Back     alignment and structure
>pdb|2F42|A Chain A, Dimerization And U-Box Domains Of Zebrafish C-Terminal Of Hsp70 Interacting Protein Length = 179 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1306
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 6e-17
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-11
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 2e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-11
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-07
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 8e-06
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-10
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-09
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-06
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 9e-10
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 9e-10
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-05
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-04
d2ovrb2 342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-09
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-08
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-04
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-04
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 4e-09
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-04
d1wgma_98 g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Hu 5e-09
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-08
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-07
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 2e-04
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 5e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 1e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 1e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-05
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-07
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 2e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 5e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-06
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-06
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 2e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-05
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-04
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.001
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 4e-05
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-04
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-04
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 3e-04
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 5e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 6e-04
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.002
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 0.002
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.003
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: E3 ubiquitin ligase PUB14
species: Thale-cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 74.7 bits (183), Expect = 6e-17
 Identities = 34/71 (47%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 340 PPKDFVCPITGQIFNDPVTLETGQTYERKAIQEWLKRGNTTCPITRQPLCSNSLPKTNYV 399
            P+ F CPI+ ++  DPV + TGQTYER +IQ+WL  G+ TCP +++ L    L   NYV
Sbjct: 5   FPEYFRCPISLELMKDPVIVSTGQTYERSSIQKWLDAGHKTCPKSQETLLHAGL-TPNYV 63

Query: 400 LKRLITSWKEQ 410
           LK LI  W E 
Sbjct: 64  LKSLIALWCES 74
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1306
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.98
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.98
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.98
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.96
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.95
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.95
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.94
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.92
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.9
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.88
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.88
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.85
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.85
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.82
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.81
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.8
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.8
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.79
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.79
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.77
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.77
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.75
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.75
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.74
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.73
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.72
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.68
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.68
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.68
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.62
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.61
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.55
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.52
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.49
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.44
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.42
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.4
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.33
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.21
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.15
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.13
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.13
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.98
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.86
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.86
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 98.79
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.79
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.69
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.41
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 98.26
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.26
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 98.26
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.25
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.19
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.17
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.16
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.09
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.05
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 97.93
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 97.89
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 97.8
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 97.79
d1b3ua_588 Constant regulatory domain of protein phosphatase 97.72
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 97.59
d1b3ua_588 Constant regulatory domain of protein phosphatase 97.52
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.52
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.49
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.44
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 97.38
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 97.29
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 96.84
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 96.66
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 96.39
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 96.25
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.21
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 95.78
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 95.77
d1u6gc_1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 94.98
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.68
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 94.62
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 94.25
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 93.17
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 92.97
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 92.96
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 92.85
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 92.78
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 89.74
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 88.87
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 84.06
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 83.98
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 83.92
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 82.02
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 80.25
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1e-31  Score=242.39  Aligned_cols=269  Identities=12%  Similarity=0.161  Sum_probs=218.4

Q ss_pred             CCCCCCCCCCCCCCCCC-----CEEEEEECCCCEEEEECCC-------CEEECCCCCCCEEEEEEECC--EEEEEECCCC
Q ss_conf             02312322222323452-----1999981799099993997-------45872668987899999599--9999988992
Q 000744          992 GTLRKLKKYSAVVTDIQ-----KALMNLSSVNATELWHCNE-------VTELDSSTNGEVLSLIHLKG--RVLSSHSDGT 1057 (1306)
Q Consensus       992 ~~l~~l~ghs~~V~~i~-----~~Lasgs~Dg~I~IWd~~~-------~~~i~~~H~~~V~sI~fspd--~LaSgs~Dg~ 1057 (1306)
                      +.+..+ +|...|.++.     ++|++|+ ||.|++||+..       ......+|.+.|.+++|+|+  +|++|+.||+
T Consensus        43 ~~~~~~-~H~~~V~~v~fs~~g~~latg~-dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~~~dg~  120 (337)
T d1gxra_          43 RQINTL-NHGEVVCAVTISNPTRHVYTGG-KGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEAST  120 (337)
T ss_dssp             EEEEEE-CCSSCCCEEEECSSSSEEEEEC-BSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTTSSEEEEEESSSE
T ss_pred             EEEEEC-CCCCCEEEEEECCCCCEEEEEE-CCEEEEEECCCCCCCCEEEEEEECCCCCCEEEEEECCCCCEEEEEECCCC
T ss_conf             499987-9999289999989999999997-99889977367763311687640488996899998679988988612332


Q ss_pred             EEEEECCCCCCCEEEEECCCCCCEEEEEECCCCCEEEEEECCCCEEEEECCCCCEEEEEE-ECCCCCEEEEEE--CCCEE
Q ss_conf             999958888511178980358668999996899999999589939999768995369983-147888479972--79279
Q 000744         1058 IKMWDSGKRVLRLIQEVREHTRAVTCLYVPSSGDKLYSGSLDKTIRVWSIKPEEIHCLQV-HNVKEAVHELTA--NAEIA 1134 (1306)
Q Consensus      1058 I~IWd~~t~~~~~i~~l~~H~~~V~si~fspdg~~L~Sgs~DgtI~IWdi~~~~~~~i~~-~~~~~~V~si~~--~~~~i 1134 (1306)
                      |++||+.....+....+..|...+.++.|+|++.++++++.|+.|++|++.+++  +... ..+...+.++.|  ....+
T Consensus       121 i~iwd~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~--~~~~~~~~~~~v~~l~~s~~~~~~  198 (337)
T d1gxra_         121 LSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQT--LVRQFQGHTDGASCIDISNDGTKL  198 (337)
T ss_dssp             EEEEECCCC--EEEEEEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTE--EEEEECCCSSCEEEEEECTTSSEE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             111111111111111111111111111111111111111111111111111111--111111111111101234443211


Q ss_pred             EEECCCCEEEEEEECCC--EEEECCCCCEEEEEEECC--EEEEEECCCCEEEEECCCCCEEEEECCCCCCCCCC-CEEEE
Q ss_conf             99829994999982597--898426998689999199--99999789819999899992468831732212886-57999
Q 000744         1135 CFVSPATGVKVYNWSGA--IKHINFNKHVKSLVMTGD--KLYCGCSGYSIQEVDLGNLTSTTFYAGTKKLLGKQ-TIHSL 1209 (1306)
Q Consensus      1135 ~~s~dg~~I~i~~~~~~--~~l~~~~~~V~si~~s~~--~L~sgs~Dg~I~iwDl~~~~~~~~~~~~~~l~gh~-~I~si 1209 (1306)
                      .....+..+.+|+....  ...+++...|.+++|+++  .+++|+.|+.+++||++++....       ...|. .|+++
T Consensus       199 ~~~~~d~~v~i~d~~~~~~~~~~~~~~~i~~l~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~-------~~~~~~~i~~v  271 (337)
T d1gxra_         199 WTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQ-------LHLHESCVLSL  271 (337)
T ss_dssp             EEEETTSEEEEEETTTTEEEEEEECSSCEEEEEECTTSSEEEEEETTSCEEEEETTSSCEEE-------ECCCSSCEEEE
T ss_pred             CCCCCCCCCCCCCCCCCEEECCCCCCCCEEEEEECCCCCCCCEECCCCCCCCCCCCCCCCCC-------CCCCCCCCCEE
T ss_conf             22356655321111110000024666615799971530300000025642111111111000-------01245654169


Q ss_pred             EEECCCEEEEEEECCCCEEEEEECCCCCEEEEEECCCCEEEEEECCC--EEEEEECCCCEEEEEC
Q ss_conf             99389689999954998799997899935899806997899999286--9999988990999988
Q 000744         1210 HMHNGLLFAGGSSVDGTAGKVFSISSKTAVGSFTTGIDIQHLAVNSD--FIFTATKCGTIEVWLK 1272 (1306)
Q Consensus      1210 ~~s~~~~li~s~s~Dg~~I~IWD~~s~~~i~~l~~~~~V~sia~spd--~Lasgs~Dg~I~IWd~ 1272 (1306)
                      .|++++.++++++.|+ .|++||..+++.+..+.+...|++++|+|+  +|++|+.||+|+|||+
T Consensus       272 ~~s~~g~~l~s~s~Dg-~i~iwd~~~~~~~~~~~~~~~v~~~~~s~d~~~l~t~s~D~~I~vWdl  335 (337)
T d1gxra_         272 KFAYCGKWFVSTGKDN-LLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEV  335 (337)
T ss_dssp             EECTTSSEEEEEETTS-EEEEEETTTCCEEEEEECSSCEEEEEECTTSCEEEEEETTSCEEEEEE
T ss_pred             EECCCCCEEEEEECCC-EEEEEECCCCCEEEECCCCCCEEEEEEECCCCEEEEEECCCEEEEEEE
T ss_conf             9989999999994899-699998999979999269998799999279999999908996999977
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure