Citrus Sinensis ID: 002054
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 974 | ||||||
| 359488677 | 964 | PREDICTED: polyribonucleotide nucleotidy | 0.980 | 0.990 | 0.773 | 0.0 | |
| 224060110 | 961 | predicted protein [Populus trichocarpa] | 0.976 | 0.989 | 0.770 | 0.0 | |
| 255567379 | 958 | polyribonucleotide nucleotidyltransferas | 0.978 | 0.994 | 0.764 | 0.0 | |
| 449515386 | 955 | PREDICTED: LOW QUALITY PROTEIN: polyribo | 0.973 | 0.992 | 0.724 | 0.0 | |
| 296087634 | 905 | unnamed protein product [Vitis vinifera] | 0.908 | 0.977 | 0.764 | 0.0 | |
| 449446674 | 1032 | PREDICTED: polyribonucleotide nucleotidy | 0.985 | 0.930 | 0.686 | 0.0 | |
| 356573319 | 959 | PREDICTED: polyribonucleotide nucleotidy | 0.947 | 0.962 | 0.711 | 0.0 | |
| 297811589 | 992 | hypothetical protein ARALYDRAFT_488299 [ | 0.976 | 0.958 | 0.682 | 0.0 | |
| 15241441 | 991 | polyribonucleotide nucleotidyltransferas | 0.973 | 0.956 | 0.676 | 0.0 | |
| 357150173 | 983 | PREDICTED: LOW QUALITY PROTEIN: polyribo | 0.945 | 0.936 | 0.66 | 0.0 |
| >gi|359488677|ref|XP_002273777.2| PREDICTED: polyribonucleotide nucleotidyltransferase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1524 bits (3947), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 758/980 (77%), Positives = 841/980 (85%), Gaps = 25/980 (2%)
Query: 1 MSSLATKTHPLLNNLPPFLTWRALGFRTICSGRLGFAPCEPAPPTPAPSVAGTKVLETFK 60
M+++A++ +PLL +LP +LTWR+L +RTICSG LGFA P+ P V G KVLETFK
Sbjct: 1 MAAMASRRNPLLTSLPLYLTWRSLRYRTICSGHLGFASSSPSISEQIP-VPGMKVLETFK 59
Query: 61 EEFEIGSRLITLETGKIARFANGAVVLGMDETKVLSTVTSSKGDSVRDFLPLTVDYQEKQ 120
EEFEIGSR IT ETGKIARFANGAVV+ MDETKVLSTV SSKGD+ RDFLPLTVDYQEK
Sbjct: 60 EEFEIGSRSITFETGKIARFANGAVVMSMDETKVLSTVASSKGDAARDFLPLTVDYQEKH 119
Query: 121 FAQGVIPNTYMRREGAPKERELLVGRIIDRPIRPLFPAGFYHEVQVMASVLSSDGKQDPD 180
FAQGVIP T+MRREGAP+ERELL GR+IDRPIRPLFPAGFYHEVQVMASVLSSDGKQDPD
Sbjct: 120 FAQGVIPTTFMRREGAPRERELLCGRLIDRPIRPLFPAGFYHEVQVMASVLSSDGKQDPD 179
Query: 181 IMAANATSAALMLSDIPWGGPIGMIRIGRICGQFIVNPTMDELSLSDLNLVYACTREKTL 240
+MAANATSAALMLSDIPWGGPIG+IRIGRICGQFIVNP+MDELSLSDLNLVYACTR+KTL
Sbjct: 180 VMAANATSAALMLSDIPWGGPIGVIRIGRICGQFIVNPSMDELSLSDLNLVYACTRDKTL 239
Query: 241 MIDVQAREISEKDLEAGLRLAHPEAVKYLEPQIRLAEKAGKQKKEYKLSMISEQTLEKVS 300
MIDVQAREISEKDLEA LRLAHPEAV+YLEPQIRLA +AGK KKEY LSM+S+ T EKV
Sbjct: 240 MIDVQAREISEKDLEAALRLAHPEAVRYLEPQIRLAARAGKSKKEYTLSMVSDITFEKVR 299
Query: 301 NLAEAHIEAVFTDPSYSKFERGEALDKIGQDVKKALEEECDEESLQVLPKAVDTVRKRVI 360
NLAEA IEAVFTD +Y KFERGEALD I QDVK+ALEEECDEESL+VLPK VDTVRK V+
Sbjct: 300 NLAEAPIEAVFTDHTYGKFERGEALDLITQDVKRALEEECDEESLKVLPKVVDTVRKEVV 359
Query: 361 RKRIIAEGVRVDGRQLDEVRPIYCESGNLPILHGSSLFSRGDTQVLCTVTLGAPAEAQRL 420
R+RIIAEG+RVDGR L+EVRP+YCESGNLPILHGSSLFSRGDTQVLCTVTLGAP +AQRL
Sbjct: 360 RRRIIAEGLRVDGRHLNEVRPLYCESGNLPILHGSSLFSRGDTQVLCTVTLGAPGDAQRL 419
Query: 421 ESLVGPPTKRFMLHYSFPPFCINEVGKRVGLNRREVGHGTLAEKALLAVLPPENDFPYTV 480
+SLVGPPTKRFMLHYSFPPF INEVGKRVGLNRREVGHGTLAEKALLAVLPPE +FPYTV
Sbjct: 420 DSLVGPPTKRFMLHYSFPPFSINEVGKRVGLNRREVGHGTLAEKALLAVLPPEEEFPYTV 479
Query: 481 RVNSEVMASDGSTSMATVCGGSMALMDAGIPLQEHVAGVSVGLVSEVDPSTGEIKDYRIL 540
R+NSEVMASDGSTSMATVCGGSMALMDAGIPL+EHVAG+SVGLV+EVDPST IKDYRIL
Sbjct: 480 RINSEVMASDGSTSMATVCGGSMALMDAGIPLREHVAGISVGLVTEVDPSTNTIKDYRIL 539
Query: 541 TDILGLEDHLGDMDFKIAGTRIGVTAIQLDIKPAGIPLDIICECLEHAHKGRLQILDHME 600
TDILGLEDHLGDMDFKIAGTR G+TAIQLDIKPAGIPLDIICECLE A +GRLQILD ME
Sbjct: 540 TDILGLEDHLGDMDFKIAGTRKGITAIQLDIKPAGIPLDIICECLEPALRGRLQILDRME 599
Query: 601 REISAPRTQDDRNSPRLATLKYDNDTLRRLIGPLGALKRKIEEETGGRISVSDGTLTVVA 660
+EI+APRTQ RNSPRLATLK+ ND+LRRL+GP+GALKRKIEEETG RISVSDGTLTVVA
Sbjct: 600 QEINAPRTQHYRNSPRLATLKFSNDSLRRLLGPMGALKRKIEEETGARISVSDGTLTVVA 659
Query: 661 KNRSVMEKVLEKVDFIIGREIEVGGIYKGVVTSVKEYGAFVEFNGGQQGLLHVSELSHEP 720
KN+SVM+KV EKVDFI+GREIE+GGIYKGVVTSVKEYGAFVEFNGGQQGLLH+SELSHEP
Sbjct: 660 KNQSVMDKVQEKVDFIVGREIEIGGIYKGVVTSVKEYGAFVEFNGGQQGLLHISELSHEP 719
Query: 721 VSRVSDVVSVGQQLSLRCIGQDVRGNIKLSLKAVSPRPEADVKGVVEGSVPVNKQATDVW 780
V RVSDVVS+GQQ+SL CIGQDVRGNIKLSLK+ PRP +D VVEGS+P+ KQA VW
Sbjct: 720 VVRVSDVVSIGQQISLMCIGQDVRGNIKLSLKSTLPRPGSDTNNVVEGSIPITKQAPSVW 779
Query: 781 ASVGDV------SNGQNPELPMRKNETPGVNSSTSSTPAVLIRSAAECDEEEKASGFSQS 834
AS+GDV N ELP+ K+ET + TS P+ LIRSAAECDEEEK++GF+QS
Sbjct: 780 ASIGDVPDSEEKQNSDLEELPVAKDETSEGSLPTSKLPSFLIRSAAECDEEEKSAGFNQS 839
Query: 835 SKSTLKSTLASKSNSKPKKFTSQSDFFSSTNIQKSTSFSQREREELAECLFGTEDGDEDN 894
S++T K S SN K K Q+D + ++F+ + +L D
Sbjct: 840 SRNTSKPRSISGSNDKLKTSPPQND-----GDKHGSAFNANSQNDL-----------NDT 883
Query: 895 KGTRVEAIVSAKNLKLGTKVAAKVYQVRARGLVLDLGGGIRGMYRFE-NNEKKDFVVGDE 953
K E AKNLKLG K+ AKVYQ+R GLVLDLGGGIRGMYRFE +N+K+DF VGDE
Sbjct: 884 KEVP-ETCTGAKNLKLGMKLNAKVYQIRTHGLVLDLGGGIRGMYRFEGDNDKRDFKVGDE 942
Query: 954 LLVKCSSFTGKGIPVVSLVD 973
L V CSSF+ KGIPV+SLV+
Sbjct: 943 LHVMCSSFSTKGIPVMSLVE 962
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224060110|ref|XP_002300042.1| predicted protein [Populus trichocarpa] gi|222847300|gb|EEE84847.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255567379|ref|XP_002524669.1| polyribonucleotide nucleotidyltransferase, putative [Ricinus communis] gi|223536030|gb|EEF37688.1| polyribonucleotide nucleotidyltransferase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449515386|ref|XP_004164730.1| PREDICTED: LOW QUALITY PROTEIN: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|296087634|emb|CBI34890.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449446674|ref|XP_004141096.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356573319|ref|XP_003554809.1| PREDICTED: polyribonucleotide nucleotidyltransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297811589|ref|XP_002873678.1| hypothetical protein ARALYDRAFT_488299 [Arabidopsis lyrata subsp. lyrata] gi|297319515|gb|EFH49937.1| hypothetical protein ARALYDRAFT_488299 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15241441|ref|NP_196962.1| polyribonucleotide nucleotidyltransferase [Arabidopsis thaliana] gi|75336830|sp|Q9S7G6.1|PNP2_ARATH RecName: Full=Polyribonucleotide nucleotidyltransferase 2, mitochondrial; Short=AtmtPNPase; AltName: Full=Polynucleotide phosphorylase 2; Short=PNPase 2; Flags: Precursor gi|4971998|emb|CAB43864.1| polynucleotide phosphorylase [Arabidopsis thaliana] gi|4972000|emb|CAB43865.1| polynucleotide phosphorylase [Arabidopsis thaliana] gi|7573307|emb|CAB87625.1| polynucleotide phosphorylase [Arabidopsis thaliana] gi|332004667|gb|AED92050.1| polyribonucleotide nucleotidyltransferase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357150173|ref|XP_003575367.1| PREDICTED: LOW QUALITY PROTEIN: polyribonucleotide nucleotidyltransferase-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 974 | ||||||
| TAIR|locus:2222662 | 991 | AT5G14580 "AT5G14580" [Arabido | 0.836 | 0.822 | 0.717 | 0.0 | |
| UNIPROTKB|P50849 | 705 | pnp "Polyribonucleotide nucleo | 0.702 | 0.970 | 0.415 | 8.2e-138 | |
| TIGR_CMR|CHY_1758 | 731 | CHY_1758 "polyribonucleotide n | 0.714 | 0.952 | 0.417 | 1.2e-136 | |
| TIGR_CMR|GSU_1593 | 697 | GSU_1593 "polyribonucleotide n | 0.699 | 0.977 | 0.419 | 4e-136 | |
| UNIPROTKB|Q0BWM9 | 713 | pnp "Polyribonucleotide nucleo | 0.694 | 0.948 | 0.42 | 6e-135 | |
| UNIPROTKB|P05055 | 711 | pnp "polynucleotide phosphoryl | 0.708 | 0.970 | 0.401 | 4.8e-133 | |
| TIGR_CMR|BA_3944 | 712 | BA_3944 "polyribonucleotide nu | 0.699 | 0.956 | 0.402 | 2.7e-132 | |
| TIGR_CMR|SO_1209 | 699 | SO_1209 "polyribonucleotide nu | 0.708 | 0.987 | 0.391 | 5.7e-130 | |
| UNIPROTKB|Q8TCS8 | 783 | PNPT1 "Polyribonucleotide nucl | 0.731 | 0.909 | 0.378 | 1.4e-128 | |
| UNIPROTKB|Q5RCW2 | 783 | PNPT1 "Polyribonucleotide nucl | 0.731 | 0.909 | 0.376 | 7.6e-128 |
| TAIR|locus:2222662 AT5G14580 "AT5G14580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3002 (1061.8 bits), Expect = 0., Sum P(2) = 0.
Identities = 597/832 (71%), Positives = 685/832 (82%)
Query: 1 MSSLATKTHPLLNNLPPFLTWRALGFRTICSGRLGFXXXXXXXXXXXXXXXGTKVLETFK 60
MSS+ + +LP FL WRALGFRTICSGRLGF GTK+LE+FK
Sbjct: 1 MSSIVNRASSA--SLPNFLAWRALGFRTICSGRLGFAPSVPDSPVSA----GTKILESFK 54
Query: 61 EEFEIGSRLITLETGKIARFANGAVVLGMDETKVLSTVTSSKGDSVRDFLPLTVDYQEKQ 120
EEFE+GSR+++ ETGKIARFANG+VVLGMDETKVLSTVT +K DS RDFLPLTVDYQEKQ
Sbjct: 55 EEFEVGSRVVSFETGKIARFANGSVVLGMDETKVLSTVTCAKTDSPRDFLPLTVDYQEKQ 114
Query: 121 FAQGVIPNTYMRREGAPKERELLVGRIIDRPIRPLFPAGFYHEVQVMASVLSSDGKQDPD 180
+AQG+IPNTYMRREGAPKERELL GR+IDRPIRPLFP GFYHEVQ+MASVLSSDGKQDPD
Sbjct: 115 YAQGLIPNTYMRREGAPKERELLCGRLIDRPIRPLFPTGFYHEVQIMASVLSSDGKQDPD 174
Query: 181 IMAANATSAALMLSDXXXXXXXXXXXXXXXXXQFIVNPTMDELSLSDLNLVYACTREKTL 240
I+AANA+SAALMLSD QF+VNPTMDELS SDLNL+YACTR+KT+
Sbjct: 175 ILAANASSAALMLSDVPWGGPIGVIRIGRICGQFVVNPTMDELSSSDLNLIYACTRDKTM 234
Query: 241 MIDVQAREISEKDLEAGLRLAHPEAVKYLEPQIRLAEKAGKQKKEYKLSMISEQTLEKVS 300
MIDVQ+REISEKDL A LRLAHPEAVKYL+PQIRLAEKAGKQKKEYKLSM+S++TLEKV+
Sbjct: 235 MIDVQSREISEKDLAAALRLAHPEAVKYLDPQIRLAEKAGKQKKEYKLSMLSDKTLEKVA 294
Query: 301 NLAEAHIEAVFTDPSYSKFERGEALDKIGQDVKKALEEECDEESLQVLPKAVDTXXXXXX 360
+LA IE+VFTDPSY KFERGEALD IG+DV+K EEE D+ESL +LPKAVDT
Sbjct: 295 DLAATRIESVFTDPSYGKFERGEALDNIGKDVRKVFEEEGDQESLSILPKAVDTVRKKVV 354
Query: 361 XXXXXAEGVRVDGRQLDEVRPIYCESGNLPILHGSSLFSRGDTQVLCTVTLGAPAEAQRL 420
++G RVDGR +DEVRPIYCES LP LHGS+LFSRGDTQVLCTVTLGAPAEAQ L
Sbjct: 355 RSRMISDGFRVDGRHVDEVRPIYCESHYLPALHGSALFSRGDTQVLCTVTLGAPAEAQSL 414
Query: 421 ESLVGPPTKRFMLHYSFPPFCINEVGKRVGLNRREVGHGTLAEKALLAVLPPENDFPYTV 480
+SLVGPP KRFMLHYSFPP+C NEVGKR GLNRREVGHGTLAEKALLAVLPPE FPYT+
Sbjct: 415 DSLVGPPKKRFMLHYSFPPYCTNEVGKRGGLNRREVGHGTLAEKALLAVLPPEEAFPYTI 474
Query: 481 RVNSEVMASDGSTSMATVCGGSMALMDAGIPLQEHVAGVSVGLVSEVDPSTGEIKDYRIL 540
R+NSEVM+SDGSTSMA+VCGGSMALMDAGIPL+ HVAGVSVGL+++VDPS+GEIKDYRI+
Sbjct: 475 RINSEVMSSDGSTSMASVCGGSMALMDAGIPLRAHVAGVSVGLITDVDPSSGEIKDYRIV 534
Query: 541 TDILGLEDHLGDMDFKIAGTRIGVTAIQLDIKPAGIPLDIICECLEHAHKGRLQILDHME 600
TDILGLEDHLGDMDFKIAGTR GVTAIQLDIKPAGIPLDI+CE LE+A + RLQILDHME
Sbjct: 535 TDILGLEDHLGDMDFKIAGTRDGVTAIQLDIKPAGIPLDIVCESLENAREARLQILDHME 594
Query: 601 REISAPRTQDDRNSPRLATLKYDNDTLRRLIGPLGALKRKIEEETGGRISVSDGTLTVVA 660
R I++PR QD SPRLATLKY ND+LR LIGP+G LKRKIE ETG R+S+ +GTLT+VA
Sbjct: 595 RNINSPRGQDGAYSPRLATLKYSNDSLRTLIGPMGVLKRKIEVETGARLSIDNGTLTIVA 654
Query: 661 KNRSVMEKVLEKVDFIIGREIEVGGIYKGVVTSVKEYGAFVEFNGGQQGLLHVSELSHEP 720
KN+ VMEK E+VDFIIGRE+ VGG+YKG V+S+KEYGAFVEF GGQQGLLH+SELSHEP
Sbjct: 655 KNQDVMEKAQEQVDFIIGRELVVGGVYKGTVSSIKEYGAFVEFPGGQQGLLHMSELSHEP 714
Query: 721 VSRVSDVVSVGQQLSLRCIGQDVRGNIKLSLKAVSPRPEADVKGVVEGSVPVNKQATDVW 780
VS+VSDV+ +GQ ++ CI DVRGNIKLS KA+ P+P+ G PV K+++ V+
Sbjct: 715 VSKVSDVLDIGQCITTMCIETDVRGNIKLSRKALLPKPKRKPASDA-GKDPVMKESSTVY 773
Query: 781 ---ASVGDVSNGQNPELPMRKNETPGVNSSTSSTPAVLIRSAAECDEEEKAS 829
+SVG++ P + TP + S S PAV+IR+A EC+E EK+S
Sbjct: 774 IENSSVGEIVASM-PSIV-----TP-LQKSRLSVPAVVIRTAVECNEAEKSS 818
|
|
| UNIPROTKB|P50849 pnp "Polyribonucleotide nucleotidyltransferase" [Bacillus subtilis subsp. subtilis str. 168 (taxid:224308)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CHY_1758 CHY_1758 "polyribonucleotide nucleotidyltransferase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_1593 GSU_1593 "polyribonucleotide nucleotidyltransferase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0BWM9 pnp "Polyribonucleotide nucleotidyltransferase" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P05055 pnp "polynucleotide phosphorylase monomer" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|BA_3944 BA_3944 "polyribonucleotide nucleotidyltransferase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_1209 SO_1209 "polyribonucleotide nucleotidyltransferase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8TCS8 PNPT1 "Polyribonucleotide nucleotidyltransferase 1, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5RCW2 PNPT1 "Polyribonucleotide nucleotidyltransferase 1, mitochondrial" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 974 | |||
| PRK11824 | 693 | PRK11824, PRK11824, polynucleotide phosphorylase/p | 0.0 | |
| TIGR03591 | 684 | TIGR03591, polynuc_phos, polyribonucleotide nucleo | 0.0 | |
| COG1185 | 692 | COG1185, Pnp, Polyribonucleotide nucleotidyltransf | 0.0 | |
| TIGR02696 | 719 | TIGR02696, pppGpp_PNP, guanosine pentaphosphate sy | 1e-167 | |
| PLN00207 | 891 | PLN00207, PLN00207, polyribonucleotide nucleotidyl | 1e-155 | |
| cd11364 | 223 | cd11364, RNase_PH_PNPase_2, Polyribonucleotide nuc | 1e-137 | |
| cd11363 | 229 | cd11363, RNase_PH_PNPase_1, Polyribonucleotide nuc | 1e-116 | |
| pfam01138 | 129 | pfam01138, RNase_PH, 3' exoribonuclease family, do | 5e-30 | |
| cd11358 | 218 | cd11358, RNase_PH, RNase PH-like 3'-5' exoribonucl | 6e-29 | |
| pfam01138 | 129 | pfam01138, RNase_PH, 3' exoribonuclease family, do | 2e-26 | |
| cd04472 | 68 | cd04472, S1_PNPase, S1_PNPase: Polynucleotide phos | 2e-24 | |
| PRK03983 | 244 | PRK03983, PRK03983, exosome complex exonuclease Rr | 1e-22 | |
| cd11370 | 226 | cd11370, RNase_PH_RRP41, RRP41 subunit of eukaryot | 1e-21 | |
| TIGR02065 | 230 | TIGR02065, ECX1, archaeal exosome-like complex exo | 1e-21 | |
| COG0689 | 230 | COG0689, Rph, RNase PH [Translation, ribosomal str | 2e-21 | |
| cd11366 | 214 | cd11366, RNase_PH_archRRP41, RRP41 subunit of arch | 1e-18 | |
| COG1098 | 129 | COG1098, VacB, Predicted RNA binding protein (cont | 6e-18 | |
| PRK08059 | 123 | PRK08059, PRK08059, general stress protein 13; Val | 7e-18 | |
| pfam03726 | 80 | pfam03726, PNPase, Polyribonucleotide nucleotidylt | 8e-18 | |
| cd05692 | 69 | cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: R | 2e-17 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 4e-16 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 2e-15 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 7e-15 | |
| cd05684 | 79 | cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N | 1e-14 | |
| smart00316 | 72 | smart00316, S1, Ribosomal protein S1-like RNA-bind | 3e-14 | |
| cd05686 | 73 | cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-b | 2e-13 | |
| PRK08582 | 139 | PRK08582, PRK08582, hypothetical protein; Provisio | 9e-13 | |
| cd11371 | 210 | cd11371, RNase_PH_MTR3, MTR3 subunit of eukaryotic | 5e-12 | |
| pfam00575 | 74 | pfam00575, S1, S1 RNA binding domain | 8e-12 | |
| cd11372 | 199 | cd11372, RNase_PH_RRP46, RRP46 subunit of eukaryot | 2e-11 | |
| cd05688 | 68 | cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: R | 2e-11 | |
| TIGR01966 | 236 | TIGR01966, RNasePH, ribonuclease PH | 2e-11 | |
| cd05685 | 68 | cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain | 5e-11 | |
| PRK07400 | 318 | PRK07400, PRK07400, 30S ribosomal protein S1; Revi | 6e-11 | |
| cd11358 | 218 | cd11358, RNase_PH, RNase PH-like 3'-5' exoribonucl | 2e-10 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 3e-10 | |
| cd00164 | 65 | cd00164, S1_like, S1_like: Ribosomal protein S1-li | 3e-10 | |
| COG2183 | 780 | COG2183, Tex, Transcriptional accessory protein [T | 4e-10 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 7e-10 | |
| pfam03725 | 68 | pfam03725, RNase_PH_C, 3' exoribonuclease family, | 8e-10 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 1e-09 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 2e-09 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 2e-09 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 2e-09 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 3e-09 | |
| cd05698 | 70 | cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs | 1e-08 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 2e-08 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 2e-08 | |
| cd11363 | 229 | cd11363, RNase_PH_PNPase_1, Polyribonucleotide nuc | 4e-08 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 4e-08 | |
| COG1093 | 269 | COG1093, SUI2, Translation initiation factor 2, al | 4e-08 | |
| cd04473 | 77 | cd04473, S1_RecJ_like, S1_RecJ_like: The S1 domain | 7e-08 | |
| cd04452 | 76 | cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha sub | 1e-07 | |
| PRK06299 | 565 | PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | 2e-07 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 2e-07 | |
| PRK04282 | 271 | PRK04282, PRK04282, exosome complex RNA-binding pr | 2e-07 | |
| cd11362 | 227 | cd11362, RNase_PH_bact, Ribonuclease PH | 2e-07 | |
| PRK07899 | 486 | PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | 3e-07 | |
| PRK13806 | 491 | PRK13806, rpsA, 30S ribosomal protein S1; Provisio | 5e-07 | |
| PRK07252 | 120 | PRK07252, PRK07252, hypothetical protein; Provisio | 6e-07 | |
| cd04461 | 83 | cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs | 8e-07 | |
| cd11365 | 256 | cd11365, RNase_PH_archRRP42, RRP42 subunit of arch | 8e-07 | |
| PRK03987 | 262 | PRK03987, PRK03987, translation initiation factor | 1e-06 | |
| cd11369 | 261 | cd11369, RNase_PH_RRP43, RRP43 subunit of eukaryot | 1e-06 | |
| cd02393 | 61 | cd02393, PNPase_KH, Polynucleotide phosphorylase ( | 2e-06 | |
| PRK05807 | 136 | PRK05807, PRK05807, hypothetical protein; Provisio | 6e-06 | |
| cd05708 | 77 | cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: | 1e-05 | |
| cd05691 | 73 | cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: R | 1e-05 | |
| PRK12269 | 863 | PRK12269, PRK12269, bifunctional cytidylate kinase | 2e-05 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 3e-05 | |
| COG1107 | 715 | COG1107, COG1107, Archaea-specific RecJ-like exonu | 4e-05 | |
| cd05687 | 70 | cd05687, S1_RPS1_repeat_ec1_hs1, S1_RPS1_repeat_ec | 4e-05 | |
| COG0689 | 230 | COG0689, Rph, RNase PH [Translation, ribosomal str | 5e-05 | |
| pfam03725 | 68 | pfam03725, RNase_PH_C, 3' exoribonuclease family, | 5e-05 | |
| COG2123 | 272 | COG2123, COG2123, RNase PH-related exoribonuclease | 9e-05 | |
| PRK06676 | 390 | PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | 1e-04 | |
| PRK00087 | 647 | PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl d | 2e-04 | |
| PRK00173 | 238 | PRK00173, rph, ribonuclease PH; Reviewed | 2e-04 | |
| cd11368 | 259 | cd11368, RNase_PH_RRP45, RRP45 subunit of eukaryot | 2e-04 | |
| cd05690 | 69 | cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: R | 5e-04 | |
| COG0539 | 541 | COG0539, RpsA, Ribosomal protein S1 [Translation, | 7e-04 | |
| COG0831 | 100 | COG0831, UreA, Urea amidohydrolase (urease) gamma | 0.001 | |
| cd11367 | 272 | cd11367, RNase_PH_RRP42, RRP42 subunit of eukaryot | 0.001 | |
| TIGR00717 | 516 | TIGR00717, rpsA, ribosomal protein S1 | 0.002 | |
| cd04453 | 88 | cd04453, S1_RNase_E, S1_RNase_E: RNase E and RNase | 0.002 | |
| cd05689 | 72 | cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: R | 0.003 | |
| cd04471 | 83 | cd04471, S1_RNase_R, S1_RNase_R: RNase R C-termina | 0.004 |
| >gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
Score = 871 bits (2254), Expect = 0.0
Identities = 331/701 (47%), Positives = 465/701 (66%), Gaps = 14/701 (1%)
Query: 57 ETFKEEFEIGSRLITLETGKIARFANGAVVLGMDETKVLSTVTSSKGDSV-RDFLPLTVD 115
+ E G R +TLETGK+AR ANGAV++ +T VL TV +SK +DF PLTVD
Sbjct: 3 NKIVKSIEFGGRTLTLETGKLARQANGAVLVRYGDTVVLVTVVASKEPKEGQDFFPLTVD 62
Query: 116 YQEKQFAQGVIPNTYMRREGAPKERELLVGRIIDRPIRPLFPAGFYHEVQVMASVLSSDG 175
Y+EK +A G IP + +REG P E+E L R+IDRPIRPLFP GF +EVQV+A+VLS D
Sbjct: 63 YEEKTYAAGKIPGGFFKREGRPSEKETLTSRLIDRPIRPLFPKGFRNEVQVVATVLSVDP 122
Query: 176 KQDPDIMAANATSAALMLSDIPWGGPIGMIRIGRICGQFIVNPTMDELSLSDLNLVYACT 235
+ DPDI+A SAAL +S IP+ GPI +R+G I G+F++NPT++EL SDL+LV A T
Sbjct: 123 ENDPDILAMIGASAALSISGIPFNGPIAAVRVGYIDGEFVLNPTVEELEESDLDLVVAGT 182
Query: 236 REKTLMIDVQAREISEKDLEAGLRLAHPEAVKYLEPQIRLAEKAGKQKKEYKLSMISEQT 295
++ LM++ +A+E+SE+ + + H + ++ Q LA +AG K E++ + E+
Sbjct: 183 KDAVLMVESEAKELSEEVMLEAIEFGHEAIQELIDAQEELAAEAGP-KWEWQPPEVDEEL 241
Query: 296 LEKVSNLAEAHIEAVFTDPSYSKFERGEALDKIGQDVKKAL-EEECDEESLQVLPKAVDT 354
V LAEA ++ + K ER ALD I ++V +AL EE +EE + + +A
Sbjct: 242 KAAVKELAEAKLKEAYQIT--DKQEREAALDAIKEEVLEALAAEEEEEEDEKEIKEAFKK 299
Query: 355 VRKRVIRKRIIAEGVRVDGRQLDEVRPIYCESGNLPILHGSSLFSRGDTQVLCTVTLGAP 414
+ K+++R+RI+ EG+R+DGR+LDE+RPI E G LP HGS+LF+RG+TQ L TLG
Sbjct: 300 LEKKIVRRRILEEGIRIDGRKLDEIRPISIEVGVLPRTHGSALFTRGETQALVVATLGTL 359
Query: 415 AEAQRLESLVGPPTKRFMLHYSFPPFCINEVGKRVGLNRREVGHGTLAEKALLAVLPPEN 474
+ Q ++ L G KRFMLHY+FPP+ + E G+ RRE+GHG LAE+AL VLP E
Sbjct: 360 RDEQIIDGLEGEYKKRFMLHYNFPPYSVGETGRVGSPGRREIGHGALAERALEPVLPSEE 419
Query: 475 DFPYTVRVNSEVMASDGSTSMATVCGGSMALMDAGIPLQEHVAGVSVGLVSEVDPSTGEI 534
+FPYT+RV SE++ S+GS+SMA+VCG S+ALMDAG+P++ VAG+++GL+ E D
Sbjct: 420 EFPYTIRVVSEILESNGSSSMASVCGSSLALMDAGVPIKAPVAGIAMGLIKEGD------ 473
Query: 535 KDYRILTDILGLEDHLGDMDFKIAGTRIGVTAIQLDIKPAGIPLDIICECLEHAHKGRLQ 594
Y +LTDILG EDHLGDMDFK+AGTR G+TA+Q+DIK GI +I+ E LE A +GRL
Sbjct: 474 -KYAVLTDILGDEDHLGDMDFKVAGTRDGITALQMDIKIDGITREILEEALEQAKEGRLH 532
Query: 595 ILDHMEREISAPRTQDDRNSPRLATLKYDNDTLRRLIGPLGALKRKIEEETGGRISVSD- 653
IL M IS PR + +PR+ T+K D +R +IGP G R+I EETG +I + D
Sbjct: 533 ILGKMNEAISEPRAELSPYAPRIETIKIPPDKIRDVIGPGGKTIREITEETGAKIDIEDD 592
Query: 654 GTLTVVAKNRSVMEKVLEKVDFIIGREIEVGGIYKGVVTSVKEYGAFVEFNGGQQGLLHV 713
GT+ + A + E E+++ I E EVG IY+G V + ++GAFVE G+ GL+H+
Sbjct: 593 GTVKIAATDGEAAEAAKERIEGIT-AEPEVGEIYEGKVVRIVDFGAFVEILPGKDGLVHI 651
Query: 714 SELSHEPVSRVSDVVSVGQQLSLRCIGQDVRGNIKLSLKAV 754
SE++ E V +V DV+ G ++ ++ + D RG I+LS KAV
Sbjct: 652 SEIADERVEKVEDVLKEGDEVKVKVLEIDKRGRIRLSRKAV 692
|
Length = 693 |
| >gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|224106 COG1185, Pnp, Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|131743 TIGR02696, pppGpp_PNP, guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >gnl|CDD|215104 PLN00207, PLN00207, polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206769 cd11364, RNase_PH_PNPase_2, Polyribonucleotide nucleotidyltransferase, repeat 2 | Back alignment and domain information |
|---|
| >gnl|CDD|206768 cd11363, RNase_PH_PNPase_1, Polyribonucleotide nucleotidyltransferase, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|216323 pfam01138, RNase_PH, 3' exoribonuclease family, domain 1 | Back alignment and domain information |
|---|
| >gnl|CDD|206766 cd11358, RNase_PH, RNase PH-like 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >gnl|CDD|216323 pfam01138, RNase_PH, 3' exoribonuclease family, domain 1 | Back alignment and domain information |
|---|
| >gnl|CDD|239918 cd04472, S1_PNPase, S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235187 PRK03983, PRK03983, exosome complex exonuclease Rrp41; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206775 cd11370, RNase_PH_RRP41, RRP41 subunit of eukaryotic exosome | Back alignment and domain information |
|---|
| >gnl|CDD|131120 TIGR02065, ECX1, archaeal exosome-like complex exonuclease 1 | Back alignment and domain information |
|---|
| >gnl|CDD|223761 COG0689, Rph, RNase PH [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|206771 cd11366, RNase_PH_archRRP41, RRP41 subunit of archaeal exosome | Back alignment and domain information |
|---|
| >gnl|CDD|224023 COG1098, VacB, Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|181215 PRK08059, PRK08059, general stress protein 13; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217697 pfam03726, PNPase, Polyribonucleotide nucleotidyltransferase, RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240197 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|240189 cd05684, S1_DHX8_helicase, S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >gnl|CDD|197648 smart00316, S1, Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240191 cd05686, S1_pNO40, S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|236305 PRK08582, PRK08582, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206776 cd11371, RNase_PH_MTR3, MTR3 subunit of eukaryotic exosome | Back alignment and domain information |
|---|
| >gnl|CDD|216000 pfam00575, S1, S1 RNA binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|206777 cd11372, RNase_PH_RRP46, RRP46 subunit of eukaryotic exosome | Back alignment and domain information |
|---|
| >gnl|CDD|240193 cd05688, S1_RPS1_repeat_ec3, S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|131021 TIGR01966, RNasePH, ribonuclease PH | Back alignment and domain information |
|---|
| >gnl|CDD|240190 cd05685, S1_Tex, S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >gnl|CDD|180960 PRK07400, PRK07400, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|206766 cd11358, RNase_PH, RNase PH-like 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|238094 cd00164, S1_like, S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|225094 COG2183, Tex, Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|217696 pfam03725, RNase_PH_C, 3' exoribonuclease family, domain 2 | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|240203 cd05698, S1_Rrp5_repeat_hs6_sc5, S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|206768 cd11363, RNase_PH_PNPase_1, Polyribonucleotide nucleotidyltransferase, repeat 1 | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224018 COG1093, SUI2, Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|239919 cd04473, S1_RecJ_like, S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >gnl|CDD|239899 cd04452, S1_IF2_alpha, S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|235775 PRK06299, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235268 PRK04282, PRK04282, exosome complex RNA-binding protein Rrp42; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206767 cd11362, RNase_PH_bact, Ribonuclease PH | Back alignment and domain information |
|---|
| >gnl|CDD|236126 PRK07899, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237516 PRK13806, rpsA, 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180908 PRK07252, PRK07252, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239908 cd04461, S1_Rrp5_repeat_hs8_sc7, S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >gnl|CDD|206770 cd11365, RNase_PH_archRRP42, RRP42 subunit of archaeal exosome | Back alignment and domain information |
|---|
| >gnl|CDD|235188 PRK03987, PRK03987, translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|206774 cd11369, RNase_PH_RRP43, RRP43 subunit of eukaryotic exosome | Back alignment and domain information |
|---|
| >gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >gnl|CDD|235614 PRK05807, PRK05807, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240213 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >gnl|CDD|240196 cd05691, S1_RPS1_repeat_ec6, S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|105491 PRK12269, PRK12269, bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|224032 COG1107, COG1107, Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|240192 cd05687, S1_RPS1_repeat_ec1_hs1, S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|223761 COG0689, Rph, RNase PH [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|217696 pfam03725, RNase_PH_C, 3' exoribonuclease family, domain 2 | Back alignment and domain information |
|---|
| >gnl|CDD|225034 COG2123, COG2123, RNase PH-related exoribonuclease [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|235851 PRK06676, rpsA, 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234623 PRK00087, PRK00087, 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|178914 PRK00173, rph, ribonuclease PH; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|206773 cd11368, RNase_PH_RRP45, RRP45 subunit of eukaryotic exosome | Back alignment and domain information |
|---|
| >gnl|CDD|240195 cd05690, S1_RPS1_repeat_ec5, S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|223613 COG0539, RpsA, Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|223901 COG0831, UreA, Urea amidohydrolase (urease) gamma subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|206772 cd11367, RNase_PH_RRP42, RRP42 subunit of eukaryotic exosome | Back alignment and domain information |
|---|
| >gnl|CDD|233102 TIGR00717, rpsA, ribosomal protein S1 | Back alignment and domain information |
|---|
| >gnl|CDD|239900 cd04453, S1_RNase_E, S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|240194 cd05689, S1_RPS1_repeat_ec4, S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >gnl|CDD|239917 cd04471, S1_RNase_R, S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 974 | |||
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 100.0 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 100.0 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 100.0 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 100.0 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 100.0 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 100.0 | |
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 100.0 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 100.0 | |
| TIGR02065 | 230 | ECX1 archaeal exosome-like complex exonuclease 1. | 100.0 | |
| PRK03983 | 244 | exosome complex exonuclease Rrp41; Provisional | 100.0 | |
| PRK00173 | 238 | rph ribonuclease PH; Reviewed | 100.0 | |
| TIGR01966 | 236 | RNasePH ribonuclease PH. This bacterial enzyme, ri | 100.0 | |
| PRK11824 | 693 | polynucleotide phosphorylase/polyadenylase; Provis | 100.0 | |
| PRK04282 | 271 | exosome complex RNA-binding protein Rrp42; Provisi | 100.0 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| TIGR03591 | 684 | polynuc_phos polyribonucleotide nucleotidyltransfe | 100.0 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 100.0 | |
| COG0539 | 541 | RpsA Ribosomal protein S1 [Translation, ribosomal | 100.0 | |
| TIGR02065 | 230 | ECX1 archaeal exosome-like complex exonuclease 1. | 100.0 | |
| COG0689 | 230 | Rph RNase PH [Translation, ribosomal structure and | 100.0 | |
| PLN00207 | 891 | polyribonucleotide nucleotidyltransferase; Provisi | 100.0 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 100.0 | |
| PRK00173 | 238 | rph ribonuclease PH; Reviewed | 100.0 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 100.0 | |
| KOG1068 | 245 | consensus Exosomal 3'-5' exoribonuclease complex, | 100.0 | |
| TIGR01966 | 236 | RNasePH ribonuclease PH. This bacterial enzyme, ri | 100.0 | |
| PRK03983 | 244 | exosome complex exonuclease Rrp41; Provisional | 100.0 | |
| COG2123 | 272 | RNase PH-related exoribonuclease [Translation, rib | 99.98 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 99.97 | |
| COG1185 | 692 | Pnp Polyribonucleotide nucleotidyltransferase (pol | 99.97 | |
| COG0689 | 230 | Rph RNase PH [Translation, ribosomal structure and | 99.97 | |
| PRK06299 | 565 | rpsA 30S ribosomal protein S1; Reviewed | 99.97 | |
| TIGR02696 | 719 | pppGpp_PNP guanosine pentaphosphate synthetase I/p | 99.97 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 99.97 | |
| TIGR00717 | 516 | rpsA ribosomal protein S1. This model provides tru | 99.96 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 99.96 | |
| PRK13806 | 491 | rpsA 30S ribosomal protein S1; Provisional | 99.95 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 99.95 | |
| KOG1069 | 217 | consensus Exosomal 3'-5' exoribonuclease complex, | 99.95 | |
| KOG1614 | 291 | consensus Exosomal 3'-5' exoribonuclease complex, | 99.95 | |
| PRK04282 | 271 | exosome complex RNA-binding protein Rrp42; Provisi | 99.94 | |
| KOG1613 | 298 | consensus Exosomal 3'-5' exoribonuclease complex, | 99.94 | |
| KOG1069 | 217 | consensus Exosomal 3'-5' exoribonuclease complex, | 99.92 | |
| COG2123 | 272 | RNase PH-related exoribonuclease [Translation, rib | 99.92 | |
| KOG1067 | 760 | consensus Predicted RNA-binding polyribonucleotide | 99.9 | |
| KOG1068 | 245 | consensus Exosomal 3'-5' exoribonuclease complex, | 99.9 | |
| KOG1612 | 288 | consensus Exosomal 3'-5' exoribonuclease complex, | 99.88 | |
| PF01138 | 132 | RNase_PH: 3' exoribonuclease family, domain 1 This | 99.88 | |
| PRK07899 | 486 | rpsA 30S ribosomal protein S1; Reviewed | 99.86 | |
| PRK06676 | 390 | rpsA 30S ribosomal protein S1; Reviewed | 99.83 | |
| PRK00087 | 647 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | 99.78 | |
| COG1098 | 129 | VacB Predicted RNA binding protein (contains ribos | 99.72 | |
| PF01138 | 132 | RNase_PH: 3' exoribonuclease family, domain 1 This | 99.71 | |
| KOG1614 | 291 | consensus Exosomal 3'-5' exoribonuclease complex, | 99.63 | |
| PRK07400 | 318 | 30S ribosomal protein S1; Reviewed | 99.61 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 99.53 | |
| KOG1070 | 1710 | consensus rRNA processing protein Rrp5 [RNA proces | 99.52 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 99.51 | |
| PTZ00248 | 319 | eukaryotic translation initiation factor 2 subunit | 99.51 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 99.48 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 99.48 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 99.44 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 99.4 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 99.36 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 99.35 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 99.34 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 99.33 | |
| cd05703 | 73 | S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R | 99.32 | |
| cd04452 | 76 | S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr | 99.32 | |
| COG1098 | 129 | VacB Predicted RNA binding protein (contains ribos | 99.31 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 99.31 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 99.31 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 99.31 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 99.31 | |
| PHA02945 | 88 | interferon resistance protein; Provisional | 99.3 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 99.29 | |
| PF03726 | 83 | PNPase: Polyribonucleotide nucleotidyltransferase, | 99.29 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 99.27 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 99.25 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 99.24 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 99.24 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 99.23 | |
| cd05708 | 77 | S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a | 99.22 | |
| COG1093 | 269 | SUI2 Translation initiation factor 2, alpha subuni | 99.22 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 99.2 | |
| PRK08059 | 123 | general stress protein 13; Validated | 99.2 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 99.17 | |
| KOG1612 | 288 | consensus Exosomal 3'-5' exoribonuclease complex, | 99.17 | |
| cd05789 | 86 | S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. | 99.15 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 99.14 | |
| cd05694 | 74 | S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp | 99.12 | |
| cd05685 | 68 | S1_Tex S1_Tex: The C-terminal S1 domain of a trans | 99.11 | |
| KOG1613 | 298 | consensus Exosomal 3'-5' exoribonuclease complex, | 99.11 | |
| cd05695 | 66 | S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t | 99.1 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 99.1 | |
| cd05705 | 74 | S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a | 99.09 | |
| cd04465 | 67 | S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib | 99.08 | |
| cd05693 | 100 | S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp | 99.06 | |
| cd05703 | 73 | S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: R | 99.03 | |
| PRK03987 | 262 | translation initiation factor IF-2 subunit alpha; | 99.02 | |
| PF00575 | 74 | S1: S1 RNA binding domain; InterPro: IPR003029 Rib | 99.01 | |
| cd05688 | 68 | S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p | 99.01 | |
| cd04471 | 83 | S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai | 98.98 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 98.97 | |
| cd04454 | 82 | S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- | 98.97 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 98.95 | |
| COG2183 | 780 | Tex Transcriptional accessory protein [Transcripti | 98.95 | |
| PRK08582 | 139 | hypothetical protein; Provisional | 98.94 | |
| cd04461 | 83 | S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp | 98.94 | |
| cd05696 | 71 | S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a t | 98.93 | |
| cd05697 | 69 | S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a t | 98.93 | |
| cd05695 | 66 | S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a t | 98.93 | |
| cd05704 | 72 | S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a | 98.91 | |
| cd05706 | 73 | S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a | 98.91 | |
| cd05702 | 70 | S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R | 98.9 | |
| cd04473 | 77 | S1_RecJ_like S1_RecJ_like: The S1 domain of the ar | 98.89 | |
| cd05698 | 70 | S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp | 98.88 | |
| cd05686 | 73 | S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding dom | 98.87 | |
| cd05707 | 68 | S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a | 98.86 | |
| PRK05807 | 136 | hypothetical protein; Provisional | 98.85 | |
| PF03725 | 68 | RNase_PH_C: 3' exoribonuclease family, domain 2 Th | 98.84 | |
| cd05689 | 72 | S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal p | 98.83 | |
| cd05690 | 69 | S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal p | 98.8 | |
| cd02393 | 61 | PNPase_KH Polynucleotide phosphorylase (PNPase) K | 98.79 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 98.77 | |
| cd05692 | 69 | S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal p | 98.77 | |
| PRK07252 | 120 | hypothetical protein; Provisional | 98.75 | |
| cd05708 | 77 | S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a | 98.74 | |
| PTZ00248 | 319 | eukaryotic translation initiation factor 2 subunit | 98.74 | |
| cd05789 | 86 | S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain. | 98.72 | |
| cd05691 | 73 | S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal p | 98.71 | |
| cd05693 | 100 | S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp | 98.71 | |
| cd04460 | 99 | S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. | 98.69 | |
| cd05687 | 70 | S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Rib | 98.68 | |
| cd05684 | 79 | S1_DHX8_helicase S1_DHX8_helicase: The N-terminal | 98.68 | |
| cd04452 | 76 | S1_IF2_alpha S1_IF2_alpha: The alpha subunit of tr | 98.67 | |
| smart00316 | 72 | S1 Ribosomal protein S1-like RNA-binding domain. | 98.66 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 98.65 | |
| cd04465 | 67 | S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Rib | 98.65 | |
| cd05702 | 70 | S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: R | 98.64 | |
| PRK08059 | 123 | general stress protein 13; Validated | 98.63 | |
| cd05685 | 68 | S1_Tex S1_Tex: The C-terminal S1 domain of a trans | 98.63 | |
| cd04471 | 83 | S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domai | 98.61 | |
| cd04453 | 88 | S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-lik | 98.61 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 98.61 | |
| PRK09521 | 189 | exosome complex RNA-binding protein Csl4; Provisio | 98.6 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 98.6 | |
| cd04472 | 68 | S1_PNPase S1_PNPase: Polynucleotide phosphorylase | 98.58 | |
| cd04455 | 67 | S1_NusA S1_NusA: N-utilizing substance A protein ( | 98.5 | |
| cd04454 | 82 | S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA- | 98.47 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 98.43 | |
| cd04455 | 67 | S1_NusA S1_NusA: N-utilizing substance A protein ( | 98.43 | |
| PHA02945 | 88 | interferon resistance protein; Provisional | 98.43 | |
| cd05688 | 68 | S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal p | 98.41 | |
| cd05791 | 92 | S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. | 98.37 | |
| PF03725 | 68 | RNase_PH_C: 3' exoribonuclease family, domain 2 Th | 98.35 | |
| PRK09521 | 189 | exosome complex RNA-binding protein Csl4; Provisio | 98.34 | |
| COG1093 | 269 | SUI2 Translation initiation factor 2, alpha subuni | 98.34 | |
| TIGR00448 | 179 | rpoE DNA-directed RNA polymerase (rpoE), archaeal | 98.3 | |
| PRK03987 | 262 | translation initiation factor IF-2 subunit alpha; | 98.26 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 98.2 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 98.18 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 98.18 | |
| cd00164 | 65 | S1_like S1_like: Ribosomal protein S1-like RNA-bin | 98.17 | |
| COG1095 | 183 | RPB7 DNA-directed RNA polymerase, subunit E' [Tran | 98.16 | |
| PRK09202 | 470 | nusA transcription elongation factor NusA; Validat | 98.11 | |
| PRK08563 | 187 | DNA-directed RNA polymerase subunit E'; Provisiona | 98.06 | |
| cd04460 | 99 | S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain. | 97.93 | |
| PHA02858 | 86 | EIF2a-like PKR inhibitor; Provisional | 97.9 | |
| cd02395 | 120 | SF1_like-KH Splicing factor 1 (SF1) K homology RNA | 97.89 | |
| PRK04163 | 235 | exosome complex RNA-binding protein Rrp4; Provisio | 97.83 | |
| COG2183 | 780 | Tex Transcriptional accessory protein [Transcripti | 97.8 | |
| TIGR02063 | 709 | RNase_R ribonuclease R. This family consists of an | 97.79 | |
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 97.79 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 97.74 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 97.71 | |
| TIGR01953 | 341 | NusA transcription termination factor NusA. This m | 97.65 | |
| PRK12327 | 362 | nusA transcription elongation factor NusA; Provisi | 97.58 | |
| PRK11642 | 813 | exoribonuclease R; Provisional | 97.56 | |
| cd02394 | 62 | vigilin_like_KH K homology RNA-binding domain_vigi | 97.56 | |
| TIGR00757 | 414 | RNaseEG ribonuclease, Rne/Rng family. The C-termin | 97.55 | |
| KOG2916 | 304 | consensus Translation initiation factor 2, alpha s | 97.54 | |
| cd05790 | 86 | S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai | 97.49 | |
| cd05791 | 92 | S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain. | 97.49 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 97.48 | |
| COG2996 | 287 | Predicted RNA-bindining protein (contains S1 and H | 97.45 | |
| TIGR00448 | 179 | rpoE DNA-directed RNA polymerase (rpoE), archaeal | 97.38 | |
| PF00013 | 60 | KH_1: KH domain syndrome, contains KH motifs.; Int | 97.36 | |
| TIGR00358 | 654 | 3_prime_RNase VacB and RNase II family 3'-5' exori | 97.36 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 97.27 | |
| cd04462 | 88 | S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly | 97.25 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 97.23 | |
| cd05699 | 72 | S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t | 97.18 | |
| COG1095 | 183 | RPB7 DNA-directed RNA polymerase, subunit E' [Tran | 97.16 | |
| PRK08563 | 187 | DNA-directed RNA polymerase subunit E'; Provisiona | 97.15 | |
| cd05790 | 86 | S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domai | 97.01 | |
| PTZ00162 | 176 | DNA-directed RNA polymerase II subunit 7; Provisio | 96.99 | |
| cd04462 | 88 | S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA poly | 96.93 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 96.75 | |
| PF13509 | 61 | S1_2: S1 domain; PDB: 3GO5_A. | 96.74 | |
| cd00105 | 64 | KH-I K homology RNA-binding domain, type I. KH bin | 96.72 | |
| PF10447 | 82 | EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I | 96.71 | |
| COG0557 | 706 | VacB Exoribonuclease R [Transcription] | 96.7 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 96.65 | |
| PF10447 | 82 | EXOSC1: Exosome component EXOSC1/CSL4; InterPro: I | 96.59 | |
| PRK05054 | 644 | exoribonuclease II; Provisional | 96.46 | |
| TIGR00757 | 414 | RNaseEG ribonuclease, Rne/Rng family. The C-termin | 96.34 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 96.25 | |
| smart00322 | 69 | KH K homology RNA-binding domain. | 96.22 | |
| cd05699 | 72 | S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a t | 96.16 | |
| TIGR03665 | 172 | arCOG04150 arCOG04150 universal archaeal KH domain | 96.1 | |
| PRK12328 | 374 | nusA transcription elongation factor NusA; Provisi | 95.96 | |
| PRK11712 | 489 | ribonuclease G; Provisional | 95.95 | |
| PRK13763 | 180 | putative RNA-processing protein; Provisional | 95.91 | |
| COG1107 | 715 | Archaea-specific RecJ-like exonuclease, contains D | 95.9 | |
| PRK10811 | 1068 | rne ribonuclease E; Reviewed | 95.9 | |
| cd02396 | 65 | PCBP_like_KH K homology RNA-binding domain, PCBP_l | 95.89 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 95.89 | |
| PHA02858 | 86 | EIF2a-like PKR inhibitor; Provisional | 95.72 | |
| PTZ00162 | 176 | DNA-directed RNA polymerase II subunit 7; Provisio | 95.58 | |
| COG1097 | 239 | RRP4 RNA-binding protein Rrp4 and related proteins | 95.29 | |
| KOG1856 | 1299 | consensus Transcription elongation factor SPT6 [RN | 95.27 | |
| TIGR02062 | 639 | RNase_B exoribonuclease II. This family consists o | 95.17 | |
| COG0557 | 706 | VacB Exoribonuclease R [Transcription] | 95.14 | |
| PRK12329 | 449 | nusA transcription elongation factor NusA; Provisi | 94.55 | |
| KOG2191 | 402 | consensus RNA-binding protein NOVA1/PASILLA and re | 94.29 | |
| PF13014 | 43 | KH_3: KH domain | 93.26 | |
| KOG3409 | 193 | consensus Exosomal 3'-5' exoribonuclease complex, | 92.78 | |
| KOG0119 | 554 | consensus Splicing factor 1/branch point binding p | 92.68 | |
| COG1530 | 487 | CafA Ribonucleases G and E [Translation, ribosomal | 92.5 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 91.93 | |
| PRK10811 | 1068 | rne ribonuclease E; Reviewed | 91.27 | |
| PF10246 | 104 | MRP-S35: Mitochondrial ribosomal protein MRP-S35; | 90.84 | |
| KOG1856 | 1299 | consensus Transcription elongation factor SPT6 [RN | 90.51 | |
| PRK12442 | 87 | translation initiation factor IF-1; Reviewed | 90.4 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 90.16 | |
| KOG3409 | 193 | consensus Exosomal 3'-5' exoribonuclease complex, | 90.06 | |
| TIGR00008 | 68 | infA translation initiation factor IF-1. This fami | 89.66 | |
| COG1096 | 188 | Predicted RNA-binding protein (consists of S1 doma | 89.24 | |
| PRK11712 | 489 | ribonuclease G; Provisional | 88.33 | |
| TIGR03319 | 514 | YmdA_YtgF conserved hypothetical protein YmdA/YtgF | 88.18 | |
| COG1094 | 194 | Predicted RNA-binding protein (contains KH domains | 87.99 | |
| PRK00106 | 535 | hypothetical protein; Provisional | 87.42 | |
| KOG3298 | 170 | consensus DNA-directed RNA polymerase subunit E' [ | 87.24 | |
| KOG2193 | 584 | consensus IGF-II mRNA-binding protein IMP, contain | 86.83 | |
| KOG1676 | 600 | consensus K-homology type RNA binding proteins [RN | 86.08 | |
| PRK12704 | 520 | phosphodiesterase; Provisional | 85.87 | |
| KOG2916 | 304 | consensus Translation initiation factor 2, alpha s | 85.82 | |
| cd02134 | 61 | NusA_KH NusA_K homology RNA-binding domain (KH). N | 84.29 | |
| KOG3298 | 170 | consensus DNA-directed RNA polymerase subunit E' [ | 83.61 | |
| PF08292 | 122 | RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; I | 83.3 | |
| PF00313 | 66 | CSD: 'Cold-shock' DNA-binding domain; InterPro: IP | 81.97 |
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.7e-166 Score=1415.99 Aligned_cols=690 Identities=47% Similarity=0.768 Sum_probs=672.4
Q ss_pred cceeeeeeEEECCeEEEEEeCccCcCCCcEEEEEeCCeEEEEEEEeCCCCCCCCceeeEeeccccccccCCCCCcccccc
Q 002054 55 VLETFKEEFEIGSRLITLETGKIARFANGAVVLGMDETKVLSTVTSSKGDSVRDFLPLTVDYQEKQFAQGVIPNTYMRRE 134 (974)
Q Consensus 55 ~~~~~~~~~~~~~r~i~~etg~~a~~A~GSa~v~~G~T~Vl~tv~~~~~~~~~~f~pL~v~y~e~~~a~g~ip~~~~~Re 134 (974)
||+....+++||||++++|||++|+||+|||+++||+|.|||||++.+.+++.|||||||+|+||+||+|||||||+|||
T Consensus 1 ~~~~~~~~~~~~~~~l~~etg~~A~qa~gav~~~~gdt~vl~t~~~~~~~~~~dF~PLtV~y~Ek~yaaGkiPGgf~kRE 80 (692)
T COG1185 1 MFNKIVKTIEWGGRTLTLETGKIARQANGAVLVRYGDTVVLATVVASKPKEGQDFFPLTVNYEEKTYAAGKIPGGFFKRE 80 (692)
T ss_pred CCcceEEEEEECCeeEEEEcchhhhhcCccEEEEECCeEEEEEEeecCCCCCCCccceeEeeeeehhccCcCCCcccccC
Confidence 46778889999999999999999999999999999999999999999878899999999999999999999999999999
Q ss_pred CCCCchhhhHHHhhcCCccccccCCCCCceEEEEEEEeccCCCChhhHHHHHHHHHhhcCCCCCCCCeEEEEEEEECCEE
Q 002054 135 GAPKERELLVGRIIDRPIRPLFPAGFYHEVQVMASVLSSDGKQDPDIMAANATSAALMLSDIPWGGPIGMIRIGRICGQF 214 (974)
Q Consensus 135 g~p~~~eil~~RlidR~lrplfp~~~~~~~~i~~~vl~~dg~~~~~~~ai~aAs~AL~~s~iP~~~~v~av~vg~i~g~~ 214 (974)
|||+++|||+|||||||||||||++|++++||+++|+|+|+.++|+++|++|||+||++|+|||.+||+|||||++||+|
T Consensus 81 Grpse~e~L~sRLIDRpiRPlFp~g~~~evqIv~tvls~D~~~~pdi~a~~gaSaAl~is~iPf~gpi~~vrvg~idg~~ 160 (692)
T COG1185 81 GRPSEKEILTSRLIDRPIRPLFPKGFRNEVQIVNTVLSVDPENDPDILAMVGASAALSLSGIPFLGPIGAVRVGYIDGIF 160 (692)
T ss_pred CCCCccchhhhhhcccccccccchhhccceEEEEEEEEECCCCCHHHHHHHHHHHHHhccCCCccCccceEEEEEECCEE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEcCCHHHHhcCccceeEeeeCCeEEEEEecCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCccccccccCCCHH
Q 002054 215 IVNPTMDELSLSDLNLVYACTREKTLMIDVQAREISEKDLEAGLRLAHPEAVKYLEPQIRLAEKAGKQKKEYKLSMISEQ 294 (974)
Q Consensus 215 vldPt~~e~~~s~~~l~v~~t~~~i~mie~~~~~~~e~~~~~al~~a~~~~~~i~~~~~~~~~~~g~~k~~~~~~~~~~~ 294 (974)
|+|||++|.+.|++||+|+||.++|+|+|+++++++|++|++||.+||+.++.++++|+++..++|++++++.....+++
T Consensus 161 vlNPt~~e~~~s~lDlvVAGT~~aV~MVE~~a~~l~E~~ml~Av~fg~~~~~~~~~~qe~l~~~~g~~~~~~~~~~~~~~ 240 (692)
T COG1185 161 VLNPTLEELEESKLDLVVAGTKDAVNMVESEADELDEEVMLEAVEFGHEAIQSVINAQEELALEVGKKKWELEPPSLDEE 240 (692)
T ss_pred EECCChHHhhhcceeeEecCChhhhheeecccccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCccccccccCccHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999988889888889999
Q ss_pred HHHHHHHHHHHHHHhhhcCCCCChhHHHHHHHHHHHHHHHHhhhccchhhhchHHHHHHHHHHHHHHHHHHhcCCcCCCC
Q 002054 295 TLEKVSNLAEAHIEAVFTDPSYSKFERGEALDKIGQDVKKALEEECDEESLQVLPKAVDTVRKRVIRKRIIAEGVRVDGR 374 (974)
Q Consensus 295 ~~~~~~~~~~~~~~~~~~~~~~~k~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~il~~~~R~DGR 374 (974)
+...+++.+.+++.+++.+ .+|++|..+++++++++.+.|..++ .....++..+|+.++++.+|.+|++.++|+|||
T Consensus 241 l~~~i~~~~~~~l~~a~~i--~~K~eR~~~~~~~~~~i~~~~~~~e-~~~~~~~~~~~~~l~~~~vR~~Il~~~vR~DGR 317 (692)
T COG1185 241 LEAKVRDLAEDELKEAVGI--REKQERSAALDAIKEKIEEELSGEE-ESSLKEIKAILEKLEKKPVRRLILEGKVRIDGR 317 (692)
T ss_pred HHHHHHHHhHHHHHHHhcc--cchhhhhhhHHHHHHHHHHHHhhhc-cccHHHHHHHHHHHhHHHHHHHHhcCCcccCCC
Confidence 9999999999999999988 5999999999999999999997542 122578999999999999999999999999999
Q ss_pred CCCCccCeEEEeCCCCCCCcceEEEeCCeEEEEEEEeCCCchhhhccccCCCCceeEEEEEecCCCCccccccccCCCch
Q 002054 375 QLDEVRPIYCESGNLPILHGSSLFSRGDTQVLCTVTLGAPAEAQRLESLVGPPTKRFMLHYSFPPFCINEVGKRVGLNRR 454 (974)
Q Consensus 375 ~~~e~R~I~ie~g~l~~a~GSal~~~G~T~Vl~~Vtl~~p~~~~~~d~~~~~~~~~~~v~~~f~p~s~~e~~~~~~~~rr 454 (974)
..+++|||.|++|+||++|||++|+||+||.++++|||++.++|.+|.+.++..++|++||||||||+||++|.++|+||
T Consensus 318 ~~~~VRpi~~ev~~lpr~HGS~LFtRGeTQal~v~TLG~~~d~Qvid~l~~e~~krfm~hYNFPp~SvGE~g~~g~p~RR 397 (692)
T COG1185 318 FGDEVRPIGIEVGVLPRTHGSALFTRGETQALVVVTLGTPRDAQVIDILEGEYKKRFLLHYNFPPFSVGETGRMGSPGRR 397 (692)
T ss_pred CcceeeeeeEEecCCCCccchhhhccCCCcceEEEEcCCcchhhhhhhccchhhhheeeeccCCCCCccccCCCCCCCcc
Confidence 99999999999999999999999999999999999999999999999999888999999999999999999999999999
Q ss_pred hhhHHHHHHHHhhhcCCCCCCCCeEEEEEEEEEcCCCChhhHHHHHHHHHHHHcCCCccccccceeeeeeccCCCCCCcc
Q 002054 455 EVGHGTLAEKALLAVLPPENDFPYTVRVNSEVMASDGSTSMATVCGGSMALMDAGIPLQEHVAGVSVGLVSEVDPSTGEI 534 (974)
Q Consensus 455 e~~~~~l~eral~~vi~~~~~~p~tI~V~v~VLesdGs~~~A~v~aa~lAL~dagvPi~~~vagvs~gli~~~d~~~~~~ 534 (974)
|+|||+|++|++.+++|..+.|||+||++++|++||||++||++|+++|||||||||++.+|||++|||+.++|
T Consensus 398 EiGHG~LA~Ral~~vlp~~e~fpytiRvVsEi~eSNGSsSmaSVCg~sLaLmdAGVPIk~pVAGIAMGLI~eg~------ 471 (692)
T COG1185 398 EIGHGALAERALAPVLPSEEEFPYTIRVVSEILESNGSSSMASVCGGSLALMDAGVPIKAPVAGIAMGLIKEGD------ 471 (692)
T ss_pred cccCchhhHHHHhhhCCchhcCCceeeeeehhhcccCcccchhhhhhHHHHHhCCCcccccccchhccceecCC------
Confidence 99999999999999999989999999999999999999999999999999999999999999999999999865
Q ss_pred cceEEEecCCccccccCCccEEEEeeCCceEEEEeeccCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCC
Q 002054 535 KDYRILTDILGLEDHLGDMDFKIAGTRIGVTAIQLDIKPAGIPLDIICECLEHAHKGRLQILDHMEREISAPRTQDDRNS 614 (974)
Q Consensus 535 ~~~~iL~Dp~~~Ee~~~d~d~~Va~t~~gI~alq~~~k~~~i~~e~l~~al~~A~~~~~~I~~~m~~~i~~~~~~~~~~~ 614 (974)
+|.+|+||.++|||+|||||+||||.+|||++|||+|..|++.++|.+||.||+.+|.||+..|.+++++||.++++||
T Consensus 472 -~~~vLsDI~G~EDhlGDMDFKVAGT~~GiTAlQMDiKi~Git~eim~~AL~QAk~aRlhIL~~M~~ai~~pr~els~~a 550 (692)
T COG1185 472 -KYAVLSDILGDEDHLGDMDFKVAGTDDGITALQMDIKIKGITKEIMKKALEQAKGARLHILIVMNEAISEPRKELSPYA 550 (692)
T ss_pred -ceEeeccccccccccCCceeEEecCCCcceeeeeeeeecCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhccC
Confidence 8999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CcceeeeeccchhhhhcCCCccchhhhhhhhCceEEee-CCEEEEEecCHHHHHHHHHHHHHHhhcccccCcEEEEEEEE
Q 002054 615 PRLATLKYDNDTLRRLIGPLGALKRKIEEETGGRISVS-DGTLTVVAKNRSVMEKVLEKVDFIIGREIEVGGIYKGVVTS 693 (974)
Q Consensus 615 p~~~~~~i~~~ki~~vIg~gGk~i~~i~~~~g~~Idi~-dg~v~i~~~~~~~~~~a~~~i~~l~~~~~~~G~i~~G~V~~ 693 (974)
|++.+++|+++||+++|||||++|++|+++||++|||+ ||+|++++.+.+..++|+++|+.++ .++++|++|.|+|++
T Consensus 551 Pri~t~~i~~dKI~dvIG~gGk~I~~I~eetg~~IdieddGtv~i~~s~~~~~~~ak~~I~~i~-~e~evg~iy~G~V~r 629 (692)
T COG1185 551 PRIETIKIDPDKIRDVIGPGGKTIKAITEETGVKIDIEDDGTVKIAASDGESAKKAKERIEAIT-REVEVGEVYEGTVVR 629 (692)
T ss_pred CceEEEccCHHHHhhccCCcccchhhhhhhhCcEEEecCCCcEEEEecchHHHHHHHHHHHHHH-hhcccccEEEEEEEE
Confidence 99999999999999999999999999999999999997 8999999999999999999999998 799999999999999
Q ss_pred EeeceEEEEEcCCeEEEEecccCCCccccccccccccCCEEEEEEEEEccCCceEEEEeccC
Q 002054 694 VKEYGAFVEFNGGQQGLLHVSELSHEPVSRVSDVVSVGQQLSLRCIGQDVRGNIKLSLKAVS 755 (974)
Q Consensus 694 i~~~G~fV~l~~g~~Glvhisels~~~v~~~~~~~~vGd~V~vkVl~id~~gri~LS~K~~~ 755 (974)
+.+||+||+|.||.+||||+|++++.++.++++++++||.|.||++++|++||+.||+|...
T Consensus 630 i~~fGaFv~l~~gkdgl~hiS~~~~~rv~kv~dvlk~Gd~v~Vkv~~iD~~Gri~ls~~~~~ 691 (692)
T COG1185 630 IVDFGAFVELLPGKDGLVHISQLAKERVEKVEDVLKEGDEVKVKVIEIDKQGRIRLSIKAVL 691 (692)
T ss_pred EeecceEEEecCCcceeEEehhhhhhhhhcccceeecCceEEEEEeeecccCCccceehhcc
Confidence 99999999999999999999999999999999999999999999999999999999999764
|
|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >TIGR02065 ECX1 archaeal exosome-like complex exonuclease 1 | Back alignment and domain information |
|---|
| >PRK03983 exosome complex exonuclease Rrp41; Provisional | Back alignment and domain information |
|---|
| >PRK00173 rph ribonuclease PH; Reviewed | Back alignment and domain information |
|---|
| >TIGR01966 RNasePH ribonuclease PH | Back alignment and domain information |
|---|
| >PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional | Back alignment and domain information |
|---|
| >PRK04282 exosome complex RNA-binding protein Rrp42; Provisional | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >COG0539 RpsA Ribosomal protein S1 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02065 ECX1 archaeal exosome-like complex exonuclease 1 | Back alignment and domain information |
|---|
| >COG0689 Rph RNase PH [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN00207 polyribonucleotide nucleotidyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK00173 rph ribonuclease PH; Reviewed | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >KOG1068 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp41 and related exoribonucleases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR01966 RNasePH ribonuclease PH | Back alignment and domain information |
|---|
| >PRK03983 exosome complex exonuclease Rrp41; Provisional | Back alignment and domain information |
|---|
| >COG2123 RNase PH-related exoribonuclease [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0689 Rph RNase PH [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK06299 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >TIGR00717 rpsA ribosomal protein S1 | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13806 rpsA 30S ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >KOG1069 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp46 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1614 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp45 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK04282 exosome complex RNA-binding protein Rrp42; Provisional | Back alignment and domain information |
|---|
| >KOG1613 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp43 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1069 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp46 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2123 RNase PH-related exoribonuclease [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1067 consensus Predicted RNA-binding polyribonucleotide nucleotidyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1068 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp41 and related exoribonucleases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1612 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp42 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01138 RNase_PH: 3' exoribonuclease family, domain 1 This Prosite family only includes Ribonuclease PH; InterPro: IPR001247 The PH (phosphorolytic) domain is responsible for 3'-5' exoribonuclease activity, although in some proteins this domain has lost its catalytic function | Back alignment and domain information |
|---|
| >PRK07899 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK06676 rpsA 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >PRK00087 4-hydroxy-3-methylbut-2-enyl diphosphate reductase/S1 RNA-binding domain protein; Reviewed | Back alignment and domain information |
|---|
| >COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01138 RNase_PH: 3' exoribonuclease family, domain 1 This Prosite family only includes Ribonuclease PH; InterPro: IPR001247 The PH (phosphorolytic) domain is responsible for 3'-5' exoribonuclease activity, although in some proteins this domain has lost its catalytic function | Back alignment and domain information |
|---|
| >KOG1614 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp45 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK07400 30S ribosomal protein S1; Reviewed | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >COG1098 VacB Predicted RNA binding protein (contains ribosomal protein S1 domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02945 interferon resistance protein; Provisional | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PF03726 PNPase: Polyribonucleotide nucleotidyltransferase, RNA binding domain; InterPro: IPR015848 The PH (phosphorolytic) domain is responsible for 3'-5' exoribonuclease activity, although in some proteins this domain has lost its catalytic function | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK08059 general stress protein 13; Validated | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >KOG1612 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp42 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05694 S1_Rrp5_repeat_hs2_sc2 S1_Rrp5_repeat_hs2_sc2: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >KOG1613 consensus Exosomal 3'-5' exoribonuclease complex, subunit Rrp43 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK03987 translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >PF00575 S1: S1 RNA binding domain; InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >COG2183 Tex Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >PRK08582 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains | Back alignment and domain information |
|---|
| >cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05695 S1_Rrp5_repeat_hs3 S1_Rrp5_repeat_hs3: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04473 S1_RecJ_like S1_RecJ_like: The S1 domain of the archaea-specific RecJ-like exonuclease | Back alignment and domain information |
|---|
| >cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK05807 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03725 RNase_PH_C: 3' exoribonuclease family, domain 2 This Prosite family only includes Ribonuclease PH; InterPro: IPR015847 The PH (phosphorolytic) domain is responsible for 3'-5' exoribonuclease activity, although in some proteins this domain has lost its catalytic function | Back alignment and domain information |
|---|
| >cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >PRK07252 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional | Back alignment and domain information |
|---|
| >cd05789 S1_Rrp4 S1_Rrp4: Rrp4 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05684 S1_DHX8_helicase S1_DHX8_helicase: The N-terminal S1 domain of human ATP-dependent RNA helicase DHX8, a DEAH (Asp-Glu-Ala-His) box polypeptide | Back alignment and domain information |
|---|
| >cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >smart00316 S1 Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >cd04465 S1_RPS1_repeat_ec2_hs2 S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05702 S1_Rrp5_repeat_hs11_sc8 S1_Rrp5_repeat_hs11_sc8: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >PRK08059 general stress protein 13; Validated | Back alignment and domain information |
|---|
| >cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa | Back alignment and domain information |
|---|
| >cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain | Back alignment and domain information |
|---|
| >cd04453 S1_RNase_E S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >PRK09521 exosome complex RNA-binding protein Csl4; Provisional | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >cd04472 S1_PNPase S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd04454 S1_Rrp4_like S1_Rrp4_like: Rrp4-like, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PHA02945 interferon resistance protein; Provisional | Back alignment and domain information |
|---|
| >cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain | Back alignment and domain information |
|---|
| >cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PF03725 RNase_PH_C: 3' exoribonuclease family, domain 2 This Prosite family only includes Ribonuclease PH; InterPro: IPR015847 The PH (phosphorolytic) domain is responsible for 3'-5' exoribonuclease activity, although in some proteins this domain has lost its catalytic function | Back alignment and domain information |
|---|
| >PRK09521 exosome complex RNA-binding protein Csl4; Provisional | Back alignment and domain information |
|---|
| >COG1093 SUI2 Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form | Back alignment and domain information |
|---|
| >PRK03987 translation initiation factor IF-2 subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >PRK09202 nusA transcription elongation factor NusA; Validated | Back alignment and domain information |
|---|
| >PRK08563 DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >cd04460 S1_RpoE S1_RpoE: RpoE, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PHA02858 EIF2a-like PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >PRK04163 exosome complex RNA-binding protein Rrp4; Provisional | Back alignment and domain information |
|---|
| >COG2183 Tex Transcriptional accessory protein [Transcription] | Back alignment and domain information |
|---|
| >TIGR02063 RNase_R ribonuclease R | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >TIGR01953 NusA transcription termination factor NusA | Back alignment and domain information |
|---|
| >PRK12327 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK11642 exoribonuclease R; Provisional | Back alignment and domain information |
|---|
| >cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like | Back alignment and domain information |
|---|
| >TIGR00757 RNaseEG ribonuclease, Rne/Rng family | Back alignment and domain information |
|---|
| >KOG2916 consensus Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >cd05791 S1_CSL4 S1_CSL4: CSL4, S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2996 Predicted RNA-bindining protein (contains S1 and HTH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00448 rpoE DNA-directed RNA polymerase (rpoE), archaeal and eukaryotic form | Back alignment and domain information |
|---|
| >PF00013 KH_1: KH domain syndrome, contains KH motifs | Back alignment and domain information |
|---|
| >TIGR00358 3_prime_RNase VacB and RNase II family 3'-5' exoribonucleases | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >COG1095 RPB7 DNA-directed RNA polymerase, subunit E' [Transcription] | Back alignment and domain information |
|---|
| >PRK08563 DNA-directed RNA polymerase subunit E'; Provisional | Back alignment and domain information |
|---|
| >cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain | Back alignment and domain information |
|---|
| >PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional | Back alignment and domain information |
|---|
| >cd04462 S1_RNAPII_Rpb7 S1_RNAPII_Rpb7: Eukaryotic RNA polymerase II (RNAPII) Rpb7 subunit C-terminal S1 domain | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >PF13509 S1_2: S1 domain; PDB: 3GO5_A | Back alignment and domain information |
|---|
| >cd00105 KH-I K homology RNA-binding domain, type I | Back alignment and domain information |
|---|
| >PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions [] | Back alignment and domain information |
|---|
| >COG0557 VacB Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF10447 EXOSC1: Exosome component EXOSC1/CSL4; InterPro: IPR019495 The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions [] | Back alignment and domain information |
|---|
| >PRK05054 exoribonuclease II; Provisional | Back alignment and domain information |
|---|
| >TIGR00757 RNaseEG ribonuclease, Rne/Rng family | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >smart00322 KH K homology RNA-binding domain | Back alignment and domain information |
|---|
| >cd05699 S1_Rrp5_repeat_hs7 S1_Rrp5_repeat_hs7: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits | Back alignment and domain information |
|---|
| >TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein | Back alignment and domain information |
|---|
| >PRK12328 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PRK11712 ribonuclease G; Provisional | Back alignment and domain information |
|---|
| >PRK13763 putative RNA-processing protein; Provisional | Back alignment and domain information |
|---|
| >COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10811 rne ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >PHA02858 EIF2a-like PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >PTZ00162 DNA-directed RNA polymerase II subunit 7; Provisional | Back alignment and domain information |
|---|
| >COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1856 consensus Transcription elongation factor SPT6 [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02062 RNase_B exoribonuclease II | Back alignment and domain information |
|---|
| >COG0557 VacB Exoribonuclease R [Transcription] | Back alignment and domain information |
|---|
| >PRK12329 nusA transcription elongation factor NusA; Provisional | Back alignment and domain information |
|---|
| >KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >PF13014 KH_3: KH domain | Back alignment and domain information |
|---|
| >KOG3409 consensus Exosomal 3'-5' exoribonuclease complex, subunit ski4 (Csl4) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG1530 CafA Ribonucleases G and E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK10811 rne ribonuclease E; Reviewed | Back alignment and domain information |
|---|
| >PF10246 MRP-S35: Mitochondrial ribosomal protein MRP-S35; InterPro: IPR019375 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >KOG1856 consensus Transcription elongation factor SPT6 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12442 translation initiation factor IF-1; Reviewed | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3409 consensus Exosomal 3'-5' exoribonuclease complex, subunit ski4 (Csl4) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00008 infA translation initiation factor IF-1 | Back alignment and domain information |
|---|
| >COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11712 ribonuclease G; Provisional | Back alignment and domain information |
|---|
| >TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF | Back alignment and domain information |
|---|
| >COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00106 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3298 consensus DNA-directed RNA polymerase subunit E' [Transcription] | Back alignment and domain information |
|---|
| >KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK12704 phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >KOG2916 consensus Translation initiation factor 2, alpha subunit (eIF-2alpha) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) | Back alignment and domain information |
|---|
| >KOG3298 consensus DNA-directed RNA polymerase subunit E' [Transcription] | Back alignment and domain information |
|---|
| >PF08292 RNA_pol_Rbc25: RNA polymerase III subunit Rpc25; InterPro: IPR013238 Rpc25 is a strongly conserved subunit of RNA polymerase III and has homology to Rpa43 in RNA polymerase I, Rpb7 in RNA polymerase II and the archaeal RpoE subunit | Back alignment and domain information |
|---|
| >PF00313 CSD: 'Cold-shock' DNA-binding domain; InterPro: IPR002059 When Escherichia coli is exposed to a temperature drop from 37 to 10 degrees centigrade, a 4-5 hour lag phase occurs, after which growth is resumed at a reduced rate [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 974 | ||||
| 3cdi_A | 723 | Crystal Structure Of E. Coli Pnpase Length = 723 | 1e-145 | ||
| 4aid_A | 726 | Crystal Structure Of C. Crescentus Pnpase Bound To | 1e-139 | ||
| 4aim_A | 726 | Crystal Structure Of C. Crescentus Pnpase Bound To | 1e-139 | ||
| 4am3_A | 717 | Crystal Structure Of C. Crescentus Pnpase Bound To | 1e-139 | ||
| 3u1k_A | 630 | Crystal Structure Of Human Pnpase Length = 630 | 1e-131 | ||
| 3cdj_A | 559 | Crystal Structure Of The E. Coli KhS1 DOMAIN TRUNCA | 1e-118 | ||
| 3h1c_A | 549 | Crystal Structure Of Polynucleotide Phosphorylase ( | 1e-118 | ||
| 3gcm_A | 549 | Crystal Structure Of E. Coli Polynucleotide Phospho | 1e-118 | ||
| 1e3p_A | 757 | Tungstate Derivative Of Streptomyces Antibioticus P | 1e-101 | ||
| 1e3h_A | 757 | Semet Derivative Of Streptomyces Antibioticus Pnpas | 3e-93 | ||
| 3m7n_D | 258 | Archaeoglobus Fulgidus Exosome With Rna Bound To Th | 2e-17 | ||
| 2ba0_F | 258 | Archaeal Exosome Core Length = 258 | 8e-17 | ||
| 2wnr_B | 240 | The Structure Of Methanothermobacter Thermautotroph | 6e-15 | ||
| 2br2_B | 248 | Rnase Ph Core Of The Archaeal Exosome Length = 248 | 7e-15 | ||
| 3l7z_B | 245 | Crystal Structure Of The S. Solfataricus Archaeal E | 7e-15 | ||
| 2je6_B | 250 | Structure Of A 9-Subunit Archaeal Exosome Length = | 8e-14 | ||
| 2pnz_A | 249 | Crystal Structure Of The P. Abyssi Exosome Rnase Ph | 1e-13 | ||
| 1sro_A | 76 | S1 Rna Binding Domain, Nmr, 20 Structures Length = | 1e-11 | ||
| 1uds_A | 255 | Crystal Structure Of The Trna Processing Enzyme Rna | 2e-10 | ||
| 2k4k_A | 130 | Solution Structure Of Gsp13 From Bacillus Subtilis | 3e-10 | ||
| 1udn_A | 255 | Crystal Structure Of The Trna Processing Enzyme Rna | 4e-10 | ||
| 1udo_A | 255 | Crystal Structure Of The Trna Processing Enzyme Rna | 5e-10 | ||
| 2nn6_B | 249 | Structure Of The Human Rna Exosome Composed Of Rrp4 | 9e-10 | ||
| 1udq_A | 255 | Crystal Structure Of The Trna Processing Enzyme Rna | 1e-09 | ||
| 3dd6_A | 255 | Crystal Structure Of Rph, An Exoribonuclease From B | 4e-09 | ||
| 1r6l_A | 239 | Crystal Structure Of The Trna Processing Enzyme Rna | 8e-09 | ||
| 1r6m_A | 239 | Crystal Structure Of The Trna Processing Enzyme Rna | 1e-08 | ||
| 1oyp_A | 245 | Crystal Structure Of The Phosphorolytic Exoribonucl | 2e-07 | ||
| 1oys_A | 245 | Crystal Structure Of The Phosphorolytic Exoribonucl | 3e-07 | ||
| 4ifd_B | 248 | Crystal Structure Of An 11-subunit Eukaryotic Exoso | 1e-06 | ||
| 2wp8_B | 246 | Yeast Rrp44 Nuclease Length = 246 | 1e-06 | ||
| 2eqs_A | 103 | Solution Structure Of The S1 Rna Binding Domain Of | 2e-06 | ||
| 3bzc_A | 785 | Crystal Structure Of The Tex Protein From Pseudomon | 3e-06 | ||
| 2oce_A | 780 | Crystal Structure Of Tex Family Protein Pa5201 From | 4e-06 | ||
| 3b4t_A | 262 | Crystal Structure Of Mycobacterium Tuberculosis Rna | 1e-05 | ||
| 3hkm_A | 246 | Crystal Structure Of Rice(Oryza Sativa) Rrp46 Lengt | 3e-05 | ||
| 2cqo_A | 119 | Solution Structure Of The S1 Rna Binding Domain Of | 3e-05 | ||
| 2nn6_D | 237 | Structure Of The Human Rna Exosome Composed Of Rrp4 | 5e-04 |
| >pdb|3CDI|A Chain A, Crystal Structure Of E. Coli Pnpase Length = 723 | Back alignment and structure |
|
| >pdb|4AID|A Chain A, Crystal Structure Of C. Crescentus Pnpase Bound To Rnase E Recognition Peptide Length = 726 | Back alignment and structure |
| >pdb|4AIM|A Chain A, Crystal Structure Of C. Crescentus Pnpase Bound To Rnase E Recognition Peptide Length = 726 | Back alignment and structure |
| >pdb|4AM3|A Chain A, Crystal Structure Of C. Crescentus Pnpase Bound To Rna Length = 717 | Back alignment and structure |
| >pdb|3U1K|A Chain A, Crystal Structure Of Human Pnpase Length = 630 | Back alignment and structure |
| >pdb|3CDJ|A Chain A, Crystal Structure Of The E. Coli KhS1 DOMAIN TRUNCATED Pnpase Length = 559 | Back alignment and structure |
| >pdb|3H1C|A Chain A, Crystal Structure Of Polynucleotide Phosphorylase (Pnpase) Core Bound To Rnase E And Tungstate Length = 549 | Back alignment and structure |
| >pdb|3GCM|A Chain A, Crystal Structure Of E. Coli Polynucleotide Phosphorylase Bound To Rna And Rnase E Length = 549 | Back alignment and structure |
| >pdb|1E3P|A Chain A, Tungstate Derivative Of Streptomyces Antibioticus Pnpase Gpsi Enzyme Length = 757 | Back alignment and structure |
| >pdb|1E3H|A Chain A, Semet Derivative Of Streptomyces Antibioticus PnpaseGPSI Enzyme Length = 757 | Back alignment and structure |
| >pdb|3M7N|D Chain D, Archaeoglobus Fulgidus Exosome With Rna Bound To The Active Site Length = 258 | Back alignment and structure |
| >pdb|2BA0|F Chain F, Archaeal Exosome Core Length = 258 | Back alignment and structure |
| >pdb|2WNR|B Chain B, The Structure Of Methanothermobacter Thermautotrophicus Exosome Core Assembly Length = 240 | Back alignment and structure |
| >pdb|2BR2|B Chain B, Rnase Ph Core Of The Archaeal Exosome Length = 248 | Back alignment and structure |
| >pdb|3L7Z|B Chain B, Crystal Structure Of The S. Solfataricus Archaeal Exosome Length = 245 | Back alignment and structure |
| >pdb|2JE6|B Chain B, Structure Of A 9-Subunit Archaeal Exosome Length = 250 | Back alignment and structure |
| >pdb|2PNZ|A Chain A, Crystal Structure Of The P. Abyssi Exosome Rnase Ph Ring Complexed With Udp And Gmp Length = 249 | Back alignment and structure |
| >pdb|1SRO|A Chain A, S1 Rna Binding Domain, Nmr, 20 Structures Length = 76 | Back alignment and structure |
| >pdb|1UDS|A Chain A, Crystal Structure Of The Trna Processing Enzyme Rnase Ph R126a Mutant From Aquifex Aeolicus Length = 255 | Back alignment and structure |
| >pdb|2K4K|A Chain A, Solution Structure Of Gsp13 From Bacillus Subtilis Length = 130 | Back alignment and structure |
| >pdb|1UDN|A Chain A, Crystal Structure Of The Trna Processing Enzyme Rnase Ph From Aquifex Aeolicus Length = 255 | Back alignment and structure |
| >pdb|1UDO|A Chain A, Crystal Structure Of The Trna Processing Enzyme Rnase Ph R86a Mutant From Aquifex Aeolicus Length = 255 | Back alignment and structure |
| >pdb|2NN6|B Chain B, Structure Of The Human Rna Exosome Composed Of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, And Rrp40 Length = 249 | Back alignment and structure |
| >pdb|1UDQ|A Chain A, Crystal Structure Of The Trna Processing Enzyme Rnase Ph T125a Mutant From Aquifex Aeolicus Length = 255 | Back alignment and structure |
| >pdb|3DD6|A Chain A, Crystal Structure Of Rph, An Exoribonuclease From Bacillus Anthracis At 1.7 A Resolution Length = 255 | Back alignment and structure |
| >pdb|1R6L|A Chain A, Crystal Structure Of The Trna Processing Enzyme Rnase Ph From Pseudomonas Aeruginosa Length = 239 | Back alignment and structure |
| >pdb|1R6M|A Chain A, Crystal Structure Of The Trna Processing Enzyme Rnase Ph From Pseudomonas Aeruginosa In Complex With Phosphate Length = 239 | Back alignment and structure |
| >pdb|1OYP|A Chain A, Crystal Structure Of The Phosphorolytic Exoribonuclease Rnase Ph From Bacillus Subtilis Length = 245 | Back alignment and structure |
| >pdb|1OYS|A Chain A, Crystal Structure Of The Phosphorolytic Exoribonuclease Rnase Ph From Bacillus Subtilis Length = 245 | Back alignment and structure |
| >pdb|4IFD|B Chain B, Crystal Structure Of An 11-subunit Eukaryotic Exosome Complex Bound To Rna Length = 248 | Back alignment and structure |
| >pdb|2WP8|B Chain B, Yeast Rrp44 Nuclease Length = 246 | Back alignment and structure |
| >pdb|2EQS|A Chain A, Solution Structure Of The S1 Rna Binding Domain Of Human Atp-Dependent Rna Helicase Dhx8 Length = 103 | Back alignment and structure |
| >pdb|3BZC|A Chain A, Crystal Structure Of The Tex Protein From Pseudomonas Aeruginosa, Crystal Form I Length = 785 | Back alignment and structure |
| >pdb|2OCE|A Chain A, Crystal Structure Of Tex Family Protein Pa5201 From Pseudomonas Aeruginosa Length = 780 | Back alignment and structure |
| >pdb|3B4T|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Rnase Ph, The Mycobacterium Tuberculosis Structural Genomics Consortium Target Rv1340 Length = 262 | Back alignment and structure |
| >pdb|3HKM|A Chain A, Crystal Structure Of Rice(Oryza Sativa) Rrp46 Length = 246 | Back alignment and structure |
| >pdb|2CQO|A Chain A, Solution Structure Of The S1 Rna Binding Domain Of Human Hypothetical Protein Flj11067 Length = 119 | Back alignment and structure |
| >pdb|2NN6|D Chain D, Structure Of The Human Rna Exosome Composed Of Rrp41, Rrp45, Rrp46, Rrp43, Mtr3, Rrp42, Csl4, Rrp4, And Rrp40 Length = 237 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 974 | |||
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 0.0 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 0.0 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 0.0 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 0.0 | |
| 3gme_A | 549 | Polyribonucleotide nucleotidyltransferase; protein | 0.0 | |
| 3m7n_D | 258 | Probable exosome complex exonuclease 1; exosome, R | 1e-110 | |
| 2je6_B | 250 | RRP41, exosome complex exonuclease 1; nuclease, hy | 1e-109 | |
| 2je6_B | 250 | RRP41, exosome complex exonuclease 1; nuclease, hy | 9e-05 | |
| 2po1_A | 249 | Probable exosome complex exonuclease 1; RNAse PH, | 1e-107 | |
| 2po1_A | 249 | Probable exosome complex exonuclease 1; RNAse PH, | 3e-05 | |
| 2nn6_B | 249 | Exosome complex exonuclease RRP41; RNA, exosome, P | 1e-103 | |
| 2nn6_B | 249 | Exosome complex exonuclease RRP41; RNA, exosome, P | 2e-05 | |
| 2wnr_B | 240 | Probable exosome complex exonuclease 1; phosphate | 1e-91 | |
| 2wnr_B | 240 | Probable exosome complex exonuclease 1; phosphate | 6e-08 | |
| 3hkm_A | 246 | OS03G0854200 protein; RNAse PH domain, phosphoryla | 3e-84 | |
| 3hkm_A | 246 | OS03G0854200 protein; RNAse PH domain, phosphoryla | 8e-07 | |
| 1oys_A | 245 | Ribonuclease PH; transferase, tRNA processing; 2.4 | 6e-81 | |
| 1oys_A | 245 | Ribonuclease PH; transferase, tRNA processing; 2.4 | 1e-04 | |
| 2nn6_F | 272 | MTR3, exosome component 6; RNA, exosome, PM/SCL, p | 3e-78 | |
| 2nn6_F | 272 | MTR3, exosome component 6; RNA, exosome, PM/SCL, p | 6e-11 | |
| 2wp8_B | 246 | Exosome complex component SKI6; nucleus, hydrolase | 4e-77 | |
| 2wp8_B | 246 | Exosome complex component SKI6; nucleus, hydrolase | 1e-11 | |
| 3dd6_A | 255 | Ribonuclease PH; exoribonuclease, tRNA maturation, | 7e-77 | |
| 3dd6_A | 255 | Ribonuclease PH; exoribonuclease, tRNA maturation, | 3e-04 | |
| 2nn6_D | 237 | Exosome complex exonuclease RRP46; RNA, exosome, P | 2e-71 | |
| 2nn6_D | 237 | Exosome complex exonuclease RRP46; RNA, exosome, P | 1e-14 | |
| 1udn_A | 255 | Ribonuclease PH, RNAse PH; transferase, riken stru | 4e-66 | |
| 1udn_A | 255 | Ribonuclease PH, RNAse PH; transferase, riken stru | 1e-05 | |
| 1r6l_A | 239 | Ribonuclease PH; beta-alpha-beta-alpha fold, hexam | 3e-58 | |
| 3b4t_A | 262 | Ribonuclease PH; RNAse, tRNA nucleotidyltransferas | 5e-53 | |
| 3krn_A | 222 | Protein C14A4.5, confirmed by transcript evidence; | 2e-32 | |
| 3krn_A | 222 | Protein C14A4.5, confirmed by transcript evidence; | 1e-12 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 1e-23 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 6e-23 | |
| 2wnr_A | 271 | Probable exosome complex exonuclease 2; phosphate | 6e-22 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 2e-21 | |
| 3m7n_G | 259 | Probable exosome complex exonuclease 2; exosome, R | 2e-21 | |
| 2nn6_C | 278 | Exosome complex exonuclease RRP43; RNA, exosome, P | 9e-21 | |
| 2je6_A | 277 | RRP42, exosome complex exonuclease 2; nuclease, hy | 1e-20 | |
| 1whu_A | 104 | Polynucleotide phosphorylase; 3'-5' RNA exonucleas | 3e-20 | |
| 2po1_B | 277 | Probable exosome complex exonuclease 2; RNAse PH, | 2e-19 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 4e-18 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 3e-16 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 4e-16 | |
| 2nn6_E | 305 | Exosome complex exonuclease RRP42; RNA, exosome, P | 6e-16 | |
| 2wp8_A | 305 | Exosome complex component RRP45; nucleus, hydrolas | 7e-16 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 1e-15 | |
| 2nn6_A | 358 | Polymyositis/scleroderma autoantigen 1; RNA, exoso | 1e-15 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 1e-14 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 3e-14 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 3e-14 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 6e-13 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 5e-11 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 8e-09 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 4e-08 | |
| 3h36_A | 93 | Polyribonucleotide nucleotidyltransferase; polyrib | 6e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-07 | |
| 4ubp_A | 101 | Protein (urease (chain A)); bacillus pasteurii, ni | 7e-07 | |
| 2fvh_A | 120 | Urease gamma subunit; protein: UREA homolog, struc | 9e-05 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 1e-04 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 2e-04 |
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Length = 723 | Back alignment and structure |
|---|
Score = 890 bits (2303), Expect = 0.0
Identities = 294/716 (41%), Positives = 446/716 (62%), Gaps = 16/716 (2%)
Query: 52 GTKVLETFKEEFEIGSRLITLETGKIARFANGAVVLGMDETKVLSTVTSSKGDSVR---D 108
+L +F+ G +TLETG +AR A AV++ MD+T V TV K + D
Sbjct: 4 DITLLNPIVRKFQYGQHTVTLETGMMARQATAAVMVSMDDTAVFVTVVGQK--KAKPGQD 61
Query: 109 FLPLTVDYQEKQFAQGVIPNTYMRREGAPKERELLVGRIIDRPIRPLFPAGFYHEVQVMA 168
F PLTV+YQE+ +A G IP ++ RREG P E E L+ R+IDRPIRPLFP GF +EVQV+A
Sbjct: 62 FFPLTVNYQERTYAAGRIPGSFFRREGRPSEGETLIARLIDRPIRPLFPEGFVNEVQVIA 121
Query: 169 SVLSSDGKQDPDIMAANATSAALMLSDIPWGGPIGMIRIGRICGQFIVNPTMDELSLSDL 228
+V+S + + +PDI+A SAAL LS IP+ GPIG R+G I Q+++NPT DEL S L
Sbjct: 122 TVVSVNPQVNPDIVAMIGASAALSLSGIPFNGPIGAARVGYINDQYVLNPTQDELKESKL 181
Query: 229 NLVYACTREKTLMIDVQAREISEKDLEAGLRLAHPEAVKYLEPQIRLAEKAGKQKKEYKL 288
+LV A T LM++ +A+ +SE + + H + ++ L ++AGK + +++
Sbjct: 182 DLVVAGTEAAVLMVESEAQLLSEDQMLGAVVFGHEQQQVVIQNINELVKEAGKPRWDWQP 241
Query: 289 SMISEQTLEKVSNLAEAHIEAVFTDPSYSKFERGEALDKIGQDVKKALEEECDEESLQVL 348
++E +V+ LAEA + + K ER +D I + L E + L
Sbjct: 242 EPVNEALNARVAALAEARLSDAYRITD--KQERYAQVDVIKSETIATLLAEDETLDENEL 299
Query: 349 PKAVDTVRKRVIRKRIIAEGVRVDGRQLDEVRPIYCESGNLPILHGSSLFSRGDTQVLCT 408
+ + + K V+R R++A R+DGR+ D +R + +G LP HGS+LF+RG+TQ L T
Sbjct: 300 GEILHAIEKNVVRSRVLAGEPRIDGREKDMIRGLDVRTGVLPRTHGSALFTRGETQALVT 359
Query: 409 VTLGAPAEAQRLESLVGPPTKRFMLHYSFPPFCINEVGKRVGLNRREVGHGTLAEKALLA 468
TLG +AQ L+ L+G T F+ HY+FPP+ + E G RRE+GHG LA++ +LA
Sbjct: 360 ATLGTARDAQVLDELMGERTDTFLFHYNFPPYSVGETGMVGSPKRREIGHGRLAKRGVLA 419
Query: 469 VLPPENDFPYTVRVNSEVMASDGSTSMATVCGGSMALMDAGIPLQEHVAGVSVGLVSEVD 528
V+P + FPYTVRV SE+ S+GS+SMA+VCG S+ALMDAG+P++ VAG+++GLV E D
Sbjct: 420 VMPDMDKFPYTVRVVSEITESNGSSSMASVCGASLALMDAGVPIKAAVAGIAMGLVKEGD 479
Query: 529 PSTGEIKDYRILTDILGLEDHLGDMDFKIAGTRIGVTAIQLDIKPAGIPLDIICECLEHA 588
+Y +L+DILG EDHLGDMDFK+AG+R G++A+Q+DIK GI +I+ L A
Sbjct: 480 -------NYVVLSDILGDEDHLGDMDFKVAGSRDGISALQMDIKIEGITKEIMQVALNQA 532
Query: 589 HKGRLQILDHMEREISAPRTQDDRNSPRLATLKYDNDTLRRLIGPLGALKRKIEEETGGR 648
RL IL ME+ I+APR +PR+ T+K + D ++ +IG G++ R + EETG
Sbjct: 533 KGARLHILGVMEQAINAPRGDISEFAPRIHTIKINPDKIKDVIGKGGSVIRALTEETGTT 592
Query: 649 ISVS-DGTLTVVAKNRSVMEKVLEKVDFIIGREIEVGGIYKGVVTSVKEYGAFVEFNGGQ 707
I + DGT+ + A + + + +++ I EIEVG +Y G VT + ++GAFV GG+
Sbjct: 593 IEIEDDGTVKIAATDGEKAKHAIRRIEEIT-AEIEVGRVYTGKVTRIVDFGAFVAIGGGK 651
Query: 708 QGLLHVSELSHEPVSRVSDVVSVGQQLSLRCIGQDVRGNIKLSLKAVSPRPEADVK 763
+GL+H+S+++ + V +V+D + +GQ++ ++ + D +G I+LS+K + + +
Sbjct: 652 EGLVHISQIADKRVEKVTDYLQMGQEVPVKVLEVDRQGRIRLSIKEATEQSQPAAA 707
|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Length = 726 | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Length = 757 | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 | Back alignment and structure |
|---|
| >3gme_A Polyribonucleotide nucleotidyltransferase; protein-RNA complex, cytoplasm, nucleotidyltransferase, RNA- binding, transferase, hydrolase; 2.40A {Escherichia coli E24377A} PDB: 3gll_A 3gcm_A 3h1c_A 3cdj_A Length = 549 | Back alignment and structure |
|---|
| >3m7n_D Probable exosome complex exonuclease 1; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 3m85_D 2ba0_F 2ba1_E Length = 258 | Back alignment and structure |
|---|
| >2je6_B RRP41, exosome complex exonuclease 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_B* 2jeb_B* 2br2_B 2c37_B* 2c38_B* 2c39_B* 3l7z_B Length = 250 | Back alignment and structure |
|---|
| >2je6_B RRP41, exosome complex exonuclease 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_B* 2jeb_B* 2br2_B 2c37_B* 2c38_B* 2c39_B* 3l7z_B Length = 250 | Back alignment and structure |
|---|
| >2po1_A Probable exosome complex exonuclease 1; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_A* 2pnz_A 2po2_A* Length = 249 | Back alignment and structure |
|---|
| >2po1_A Probable exosome complex exonuclease 1; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_A* 2pnz_A 2po2_A* Length = 249 | Back alignment and structure |
|---|
| >2nn6_B Exosome complex exonuclease RRP41; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 249 | Back alignment and structure |
|---|
| >2nn6_B Exosome complex exonuclease RRP41; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 249 | Back alignment and structure |
|---|
| >2wnr_B Probable exosome complex exonuclease 1; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 240 | Back alignment and structure |
|---|
| >2wnr_B Probable exosome complex exonuclease 1; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 240 | Back alignment and structure |
|---|
| >3hkm_A OS03G0854200 protein; RNAse PH domain, phosphorylase, hydrolase; 1.98A {Oryza sativa japonica group} Length = 246 | Back alignment and structure |
|---|
| >3hkm_A OS03G0854200 protein; RNAse PH domain, phosphorylase, hydrolase; 1.98A {Oryza sativa japonica group} Length = 246 | Back alignment and structure |
|---|
| >1oys_A Ribonuclease PH; transferase, tRNA processing; 2.40A {Bacillus subtilis} SCOP: d.14.1.4 d.101.1.1 PDB: 1oyp_A 1oyr_A Length = 245 | Back alignment and structure |
|---|
| >1oys_A Ribonuclease PH; transferase, tRNA processing; 2.40A {Bacillus subtilis} SCOP: d.14.1.4 d.101.1.1 PDB: 1oyp_A 1oyr_A Length = 245 | Back alignment and structure |
|---|
| >2nn6_F MTR3, exosome component 6; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 272 | Back alignment and structure |
|---|
| >2nn6_F MTR3, exosome component 6; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 272 | Back alignment and structure |
|---|
| >2wp8_B Exosome complex component SKI6; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Length = 246 | Back alignment and structure |
|---|
| >2wp8_B Exosome complex component SKI6; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Length = 246 | Back alignment and structure |
|---|
| >3dd6_A Ribonuclease PH; exoribonuclease, tRNA maturation, RNAse PH., transferase; 1.70A {Bacillus anthracis} Length = 255 | Back alignment and structure |
|---|
| >3dd6_A Ribonuclease PH; exoribonuclease, tRNA maturation, RNAse PH., transferase; 1.70A {Bacillus anthracis} Length = 255 | Back alignment and structure |
|---|
| >2nn6_D Exosome complex exonuclease RRP46; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 237 | Back alignment and structure |
|---|
| >2nn6_D Exosome complex exonuclease RRP46; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 237 | Back alignment and structure |
|---|
| >1udn_A Ribonuclease PH, RNAse PH; transferase, riken structural genomics/proteomics initiative structural genomics; 2.30A {Aquifex aeolicus} SCOP: d.14.1.4 d.101.1.1 PDB: 1udq_A 1uds_A 1udo_A Length = 255 | Back alignment and structure |
|---|
| >1udn_A Ribonuclease PH, RNAse PH; transferase, riken structural genomics/proteomics initiative structural genomics; 2.30A {Aquifex aeolicus} SCOP: d.14.1.4 d.101.1.1 PDB: 1udq_A 1uds_A 1udo_A Length = 255 | Back alignment and structure |
|---|
| >1r6l_A Ribonuclease PH; beta-alpha-beta-alpha fold, hexamer, phosphate bound, transf; HET: NHE; 1.90A {Pseudomonas aeruginosa} SCOP: d.14.1.4 d.101.1.1 PDB: 1r6m_A Length = 239 | Back alignment and structure |
|---|
| >3b4t_A Ribonuclease PH; RNAse, tRNA nucleotidyltransferase, RPHA, STRU genomics, TBSGC; 2.10A {Mycobacterium tuberculosis} Length = 262 | Back alignment and structure |
|---|
| >3krn_A Protein C14A4.5, confirmed by transcript evidence; RNAse PH domain, homodimer, exosome, cell-death-related DNAS hydrolase; 3.92A {Caenorhabditis elegans} Length = 222 | Back alignment and structure |
|---|
| >3krn_A Protein C14A4.5, confirmed by transcript evidence; RNAse PH domain, homodimer, exosome, cell-death-related DNAS hydrolase; 3.92A {Caenorhabditis elegans} Length = 222 | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} Length = 130 | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2wnr_A Probable exosome complex exonuclease 2; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacter thermautotrophicusorganism_taxid} Length = 271 | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3m7n_G Probable exosome complex exonuclease 2; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_H 2ba0_I 3m85_G Length = 259 | Back alignment and structure |
|---|
| >2nn6_C Exosome complex exonuclease RRP43; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 278 | Back alignment and structure |
|---|
| >2je6_A RRP42, exosome complex exonuclease 2; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_A* 2jeb_A* 2br2_A 2c37_A* 2c38_A* 2c39_A* 3l7z_A Length = 277 | Back alignment and structure |
|---|
| >1whu_A Polynucleotide phosphorylase; 3'-5' RNA exonuclease; pnpase, alpha-helical domain, structural genomics; NMR {Mus musculus} SCOP: a.4.9.1 Length = 104 | Back alignment and structure |
|---|
| >2po1_B Probable exosome complex exonuclease 2; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_B* 2pnz_B 2po2_B* Length = 277 | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} Length = 80 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A Length = 175 | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 Length = 182 | Back alignment and structure |
|---|
| >2nn6_E Exosome complex exonuclease RRP42; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 305 | Back alignment and structure |
|---|
| >2wp8_A Exosome complex component RRP45; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} Length = 305 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 109 | Back alignment and structure |
|---|
| >2nn6_A Polymyositis/scleroderma autoantigen 1; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 Length = 358 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* Length = 266 | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A Length = 275 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 Length = 308 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A Length = 785 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} Length = 1030 | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 | Back alignment and structure |
|---|
| >3h36_A Polyribonucleotide nucleotidyltransferase; polyribonucleotide nucleotidyltransfer structural genomics, PSI-2, protein structure initiative; 1.80A {Streptococcus mutans} Length = 93 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4ubp_A Protein (urease (chain A)); bacillus pasteurii, nickel, acetohydroxamic acid, metalloenzyme, hydrolase; HET: KCX; 1.55A {Sporosarcina pasteurii} SCOP: d.8.1.1 PDB: 3ubp_A* 2ubp_A* 1ubp_A* 1s3t_A* 1ie7_A* 1ejx_A* 1a5l_A 1a5k_A 1a5n_A 1a5o_A 1ef2_C* 1ejr_A* 1ejs_A* 1ejt_A* 1eju_A* 1ejv_A* 1a5m_A* 1ejw_A* 1fwa_A* 1fwb_A* ... Length = 101 | Back alignment and structure |
|---|
| >2fvh_A Urease gamma subunit; protein: UREA homolog, structural genomics, PSI, protein STR initiative, TB structural genomics consortium; 1.80A {Mycobacterium tuberculosis} Length = 120 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A Length = 179 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 974 | |||
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 100.0 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 100.0 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 100.0 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 100.0 | |
| 3gme_A | 549 | Polyribonucleotide nucleotidyltransferase; protein | 100.0 | |
| 2nn6_B | 249 | Exosome complex exonuclease RRP41; RNA, exosome, P | 100.0 | |
| 2wnr_B | 240 | Probable exosome complex exonuclease 1; phosphate | 100.0 | |
| 3m7n_D | 258 | Probable exosome complex exonuclease 1; exosome, R | 100.0 | |
| 2po1_A | 249 | Probable exosome complex exonuclease 1; RNAse PH, | 100.0 | |
| 2je6_B | 250 | RRP41, exosome complex exonuclease 1; nuclease, hy | 100.0 | |
| 3hkm_A | 246 | OS03G0854200 protein; RNAse PH domain, phosphoryla | 100.0 | |
| 3b4t_A | 262 | Ribonuclease PH; RNAse, tRNA nucleotidyltransferas | 100.0 | |
| 2wp8_B | 246 | Exosome complex component SKI6; nucleus, hydrolase | 100.0 | |
| 2po1_B | 277 | Probable exosome complex exonuclease 2; RNAse PH, | 100.0 | |
| 3dd6_A | 255 | Ribonuclease PH; exoribonuclease, tRNA maturation, | 100.0 | |
| 3m7n_G | 259 | Probable exosome complex exonuclease 2; exosome, R | 100.0 | |
| 2wnr_A | 271 | Probable exosome complex exonuclease 2; phosphate | 100.0 | |
| 1oys_A | 245 | Ribonuclease PH; transferase, tRNA processing; 2.4 | 100.0 | |
| 2nn6_C | 278 | Exosome complex exonuclease RRP43; RNA, exosome, P | 100.0 | |
| 2nn6_F | 272 | MTR3, exosome component 6; RNA, exosome, PM/SCL, p | 100.0 | |
| 1udn_A | 255 | Ribonuclease PH, RNAse PH; transferase, riken stru | 100.0 | |
| 2je6_A | 277 | RRP42, exosome complex exonuclease 2; nuclease, hy | 100.0 | |
| 1r6l_A | 239 | Ribonuclease PH; beta-alpha-beta-alpha fold, hexam | 100.0 | |
| 2wp8_A | 305 | Exosome complex component RRP45; nucleus, hydrolas | 100.0 | |
| 2nn6_E | 305 | Exosome complex exonuclease RRP42; RNA, exosome, P | 100.0 | |
| 2nn6_A | 358 | Polymyositis/scleroderma autoantigen 1; RNA, exoso | 100.0 | |
| 3dd6_A | 255 | Ribonuclease PH; exoribonuclease, tRNA maturation, | 100.0 | |
| 2je6_B | 250 | RRP41, exosome complex exonuclease 1; nuclease, hy | 100.0 | |
| 2nn6_D | 237 | Exosome complex exonuclease RRP46; RNA, exosome, P | 100.0 | |
| 3b4t_A | 262 | Ribonuclease PH; RNAse, tRNA nucleotidyltransferas | 100.0 | |
| 2wp8_B | 246 | Exosome complex component SKI6; nucleus, hydrolase | 100.0 | |
| 2nn6_F | 272 | MTR3, exosome component 6; RNA, exosome, PM/SCL, p | 100.0 | |
| 1r6l_A | 239 | Ribonuclease PH; beta-alpha-beta-alpha fold, hexam | 100.0 | |
| 2wnr_A | 271 | Probable exosome complex exonuclease 2; phosphate | 100.0 | |
| 3m7n_G | 259 | Probable exosome complex exonuclease 2; exosome, R | 100.0 | |
| 3m7n_D | 258 | Probable exosome complex exonuclease 1; exosome, R | 100.0 | |
| 3krn_A | 222 | Protein C14A4.5, confirmed by transcript evidence; | 100.0 | |
| 1udn_A | 255 | Ribonuclease PH, RNAse PH; transferase, riken stru | 100.0 | |
| 2je6_A | 277 | RRP42, exosome complex exonuclease 2; nuclease, hy | 100.0 | |
| 1oys_A | 245 | Ribonuclease PH; transferase, tRNA processing; 2.4 | 100.0 | |
| 3hkm_A | 246 | OS03G0854200 protein; RNAse PH domain, phosphoryla | 100.0 | |
| 2nn6_C | 278 | Exosome complex exonuclease RRP43; RNA, exosome, P | 100.0 | |
| 2po1_A | 249 | Probable exosome complex exonuclease 1; RNAse PH, | 100.0 | |
| 4aid_A | 726 | Polyribonucleotide nucleotidyltransferase; transfe | 100.0 | |
| 3krn_A | 222 | Protein C14A4.5, confirmed by transcript evidence; | 100.0 | |
| 3cdi_A | 723 | Polynucleotide phosphorylase; mRNA turnover, RNAse | 100.0 | |
| 2nn6_B | 249 | Exosome complex exonuclease RRP41; RNA, exosome, P | 100.0 | |
| 2nn6_E | 305 | Exosome complex exonuclease RRP42; RNA, exosome, P | 100.0 | |
| 2wnr_B | 240 | Probable exosome complex exonuclease 1; phosphate | 100.0 | |
| 2nn6_D | 237 | Exosome complex exonuclease RRP46; RNA, exosome, P | 100.0 | |
| 2nn6_A | 358 | Polymyositis/scleroderma autoantigen 1; RNA, exoso | 99.98 | |
| 2po1_B | 277 | Probable exosome complex exonuclease 2; RNAse PH, | 99.97 | |
| 3u1k_A | 630 | Polyribonucleotide nucleotidyltransferase 1, MITO; | 99.97 | |
| 2wp8_A | 305 | Exosome complex component RRP45; nucleus, hydrolas | 99.97 | |
| 3gme_A | 549 | Polyribonucleotide nucleotidyltransferase; protein | 99.97 | |
| 1e3p_A | 757 | Guanosine pentaphosphate synthetase; polyribonucle | 99.96 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 99.93 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 99.62 | |
| 1y14_B | 171 | B16, RPB7, DNA-directed RNA polymerase II 19 kDa p | 99.62 | |
| 1go3_E | 187 | DNA-directed RNA polymerase subunit E; transferase | 99.59 | |
| 2b8k_G | 215 | B16, DNA-directed RNA polymerase II 19 kDa polypep | 99.56 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 99.55 | |
| 1luz_A | 88 | Protein K3, protein K2; stranded anti-parallel bet | 99.54 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 99.53 | |
| 3go5_A | 285 | Multidomain protein with S1 RNA-binding domains; s | 99.52 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 99.51 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 99.5 | |
| 1whu_A | 104 | Polynucleotide phosphorylase; 3'-5' RNA exonucleas | 99.5 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 99.5 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 99.48 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 99.43 | |
| 2c35_B | 172 | Human RPB7, DNA-directed RNA polymerase II 19 kDa | 99.42 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 99.34 | |
| 2khj_A | 109 | 30S ribosomal protein S1; OB fold, acetylation, ph | 99.33 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 99.33 | |
| 2khi_A | 115 | 30S ribosomal protein S1; acetylation, phosphoprot | 99.33 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 99.25 | |
| 2k52_A | 80 | Uncharacterized protein MJ1198; metal-binding, zin | 99.24 | |
| 3h0g_G | 172 | DNA-directed RNA polymerase II subunit RPB7; trans | 99.16 | |
| 4ayb_E | 180 | DNA-directed RNA polymerase; transferase, multi-su | 99.15 | |
| 2eqs_A | 103 | ATP-dependent RNA helicase DHX8; S1 domain, OB-fol | 99.11 | |
| 2k4k_A | 130 | GSP13, general stress protein 13; cytoplasm, stres | 99.08 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 99.05 | |
| 3h36_A | 93 | Polyribonucleotide nucleotidyltransferase; polyrib | 99.03 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 99.01 | |
| 2cqo_A | 119 | Nucleolar protein of 40 kDa; S1 domain, OB-fold, s | 99.0 | |
| 1luz_A | 88 | Protein K3, protein K2; stranded anti-parallel bet | 98.99 | |
| 2cpq_A | 91 | FragIle X mental retardation syndrome related prot | 98.98 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 98.97 | |
| 1kl9_A | 182 | Eukaryotic translation initiation factor 2 subuni; | 98.97 | |
| 2a19_A | 175 | EIF-2- alpha, eukaryotic translation initiation fa | 98.96 | |
| 2ctk_A | 104 | Vigilin; K homology type I domain, RNA-binding, ce | 98.95 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 98.94 | |
| 2nn6_I | 209 | 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, | 98.92 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 98.9 | |
| 1wi5_A | 119 | RRP5 protein homolog; S1 domain, OB-fold, structur | 98.83 | |
| 3aev_A | 275 | Translation initiation factor 2 subunit alpha; pro | 98.8 | |
| 2je6_I | 251 | RRP4, exosome complex RNA-binding protein 1; nucle | 98.78 | |
| 2ba0_A | 229 | Archeal exosome RNA binding protein RRP4; RNAse PH | 98.73 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 98.71 | |
| 1we8_A | 104 | Tudor and KH domain containing protein; structural | 98.68 | |
| 2z0s_A | 235 | Probable exosome complex RNA-binding protein 1; al | 98.68 | |
| 1q8k_A | 308 | Eukaryotic translation initiation factor 2 subunit | 98.66 | |
| 1vig_A | 71 | Vigilin; RNA-binding protein, ribonucleoprotein; N | 98.58 | |
| 2ctj_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 98.58 | |
| 3cw2_C | 266 | Translation initiation factor 2 subunit alpha; AIF | 98.56 | |
| 2opv_A | 85 | KHSRP protein; KH domain, RNA binding protein, KSR | 98.53 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 98.49 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 98.46 | |
| 2ctm_A | 95 | Vigilin; K homology type I domain, RNA-binding, ce | 98.41 | |
| 1go3_E | 187 | DNA-directed RNA polymerase subunit E; transferase | 98.4 | |
| 1y14_B | 171 | B16, RPB7, DNA-directed RNA polymerase II 19 kDa p | 98.38 | |
| 2ctl_A | 97 | Vigilin; K homology type I domain, RNA-binding, ce | 98.35 | |
| 3bzc_A | 785 | TEX; helix-turn-helix, helix-hairpin-helix, S1 dom | 98.34 | |
| 3psf_A | 1030 | Transcription elongation factor SPT6; nucleus; 2.5 | 98.34 | |
| 2cte_A | 94 | Vigilin; K homology type I domain, RNA-binding, ce | 98.32 | |
| 2axy_A | 73 | Poly(RC)-binding protein 2; protein-DNA complex, D | 98.27 | |
| 2b8k_G | 215 | B16, DNA-directed RNA polymerase II 19 kDa polypep | 98.27 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 98.26 | |
| 4ayb_E | 180 | DNA-directed RNA polymerase; transferase, multi-su | 98.26 | |
| 2hh3_A | 106 | KH-type splicing regulatory protein; KH-RNA bindin | 98.24 | |
| 2c35_B | 172 | Human RPB7, DNA-directed RNA polymerase II 19 kDa | 98.24 | |
| 2bx2_L | 517 | Ribonuclease E, RNAse E; RNA-binding, RNA turnover | 98.22 | |
| 3ayh_B | 203 | DNA-directed RNA polymerase III subunit RPC8; tran | 98.22 | |
| 2yqr_A | 119 | KIAA0907 protein; structure genomics, KH domain, s | 98.21 | |
| 2ba0_A | 229 | Archeal exosome RNA binding protein RRP4; RNAse PH | 98.18 | |
| 2z0s_A | 235 | Probable exosome complex RNA-binding protein 1; al | 98.16 | |
| 2nn6_I | 209 | 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, | 98.16 | |
| 1x4m_A | 94 | FAR upstream element binding protein 1; KH domain, | 98.16 | |
| 3m7n_A | 179 | Putative uncharacterized protein AF_0206; exosome, | 98.16 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 98.15 | |
| 1k1g_A | 131 | SF1-BO isoform; splicing, branch point sequence, p | 98.14 | |
| 1hh2_P | 344 | NUSA, N utilization substance protein A; transcrip | 98.11 | |
| 2p2r_A | 76 | Poly(RC)-binding protein 2; protein-DNA complex, R | 98.1 | |
| 2ckz_B | 218 | C25, DNA-directed RNA polymerase III 25 KD polypep | 98.09 | |
| 2je6_I | 251 | RRP4, exosome complex RNA-binding protein 1; nucle | 98.09 | |
| 1x4n_A | 92 | FAR upstream element binding protein 1; KH domain, | 98.06 | |
| 2ja9_A | 175 | Exosome complex exonuclease RRP40; RNA-binding pro | 98.05 | |
| 2wp8_J | 977 | Exosome complex exonuclease DIS3; nucleus, hydrola | 98.04 | |
| 2nn6_H | 308 | Exosome complex exonuclease RRP4; RNA, exosome, PM | 98.03 | |
| 3h0g_G | 172 | DNA-directed RNA polymerase II subunit RPB7; trans | 98.0 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 98.0 | |
| 1zzk_A | 82 | Heterogeneous nuclear ribonucleoprotein K; KH domi | 97.99 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 97.99 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 97.98 | |
| 1wvn_A | 82 | Poly(RC)-binding protein 1; KH domain, RNA binding | 97.98 | |
| 1dtj_A | 76 | RNA-binding neurooncological ventral antigen 2; KH | 97.97 | |
| 2vnu_D | 760 | Exosome complex exonuclease RRP44; hydrolase-RNA c | 97.97 | |
| 2hh2_A | 107 | KH-type splicing regulatory protein; KH-RNA bindin | 97.94 | |
| 1j5k_A | 89 | Heterogeneous nuclear ribonucleoprotein K; single- | 97.91 | |
| 2bh8_A | 101 | 1B11; transcription, molecular evolution, unique a | 97.88 | |
| 1ec6_A | 87 | RNA-binding protein NOVA-2; KH domain, alpha-beta | 97.84 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 97.73 | |
| 2dgr_A | 83 | Ring finger and KH domain-containing protein 1; st | 97.7 | |
| 2id0_A | 644 | Exoribonuclease 2; RNAse, exonuclease, hydrolyase, | 97.59 | |
| 1k0r_A | 366 | NUSA; two component arrangement, S1 domain, two K- | 97.57 | |
| 2ckz_B | 218 | C25, DNA-directed RNA polymerase III 25 KD polypep | 97.5 | |
| 2ja9_A | 175 | Exosome complex exonuclease RRP40; RNA-binding pro | 97.46 | |
| 3ayh_B | 203 | DNA-directed RNA polymerase III subunit RPC8; tran | 97.44 | |
| 2jzx_A | 160 | Poly(RC)-binding protein 2; PCBP2, KH domains, RNA | 97.39 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 97.37 | |
| 2asb_A | 251 | Transcription elongation protein NUSA; protein-RNA | 97.29 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 97.25 | |
| 2bl5_A | 140 | MGC83862 protein, quaking protein; STAR proteins, | 97.21 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 97.16 | |
| 2bx2_L | 517 | Ribonuclease E, RNAse E; RNA-binding, RNA turnover | 97.13 | |
| 2nn6_G | 289 | Exosome complex exonuclease RRP40; RNA, exosome, P | 97.05 | |
| 3krm_A | 163 | Insulin-like growth factor 2 mRNA-binding protein | 97.04 | |
| 2jvz_A | 164 | KH type-splicing, FAR upstream element-binding pro | 97.03 | |
| 2nn6_H | 308 | Exosome complex exonuclease RRP4; RNA, exosome, PM | 96.94 | |
| 2vnu_D | 760 | Exosome complex exonuclease RRP44; hydrolase-RNA c | 96.92 | |
| 2wp8_J | 977 | Exosome complex exonuclease DIS3; nucleus, hydrola | 96.86 | |
| 1j4w_A | 174 | FUSE binding protein; single-stranded DNA binding | 96.82 | |
| 2anr_A | 178 | Neuro-oncological ventral antigen 1; protein-RNA c | 96.62 | |
| 2nn6_G | 289 | Exosome complex exonuclease RRP40; RNA, exosome, P | 96.13 | |
| 2ctf_A | 102 | Vigilin; K homology type I domain, RNA-binding, ce | 95.69 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 94.52 | |
| 2e3u_A | 219 | PH-DIM2P, hypothetical protein PH1566; PRE-ribosom | 93.96 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 93.67 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 92.22 | |
| 2r7d_A | 469 | Ribonuclease II family protein; structural genomic | 92.15 | |
| 1tua_A | 191 | Hypothetical protein APE0754; structural genomics, | 92.06 | |
| 3n89_A | 376 | Defective in GERM LINE development protein 3, ISO; | 90.69 | |
| 3d0f_A | 106 | Penicillin-binding 1 transmembrane protein MRCA; B | 88.92 | |
| 1wfq_A | 89 | UNR protein; beta-barrel, translational regulation | 87.14 | |
| 2qnd_A | 144 | FMR1 protein; KH domain, eukaryotic KH domains, ta | 85.8 | |
| 3v69_A | 140 | Protein filia; RNA-binding, embryogenesis, KH doma | 85.05 | |
| 2rf4_A | 214 | DNA-directed RNA polymerase I subunit RPA4; transf | 84.32 | |
| 2k5n_A | 74 | Putative cold-shock protein; GFT protein structure | 82.01 | |
| 1h95_A | 79 | CSD, Y-box binding protein; translation factor, tr | 80.01 |
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.6e-158 Score=1418.20 Aligned_cols=697 Identities=42% Similarity=0.703 Sum_probs=543.9
Q ss_pred cceeeeeeEEECCeEEEEEeCccCcCCCcEEEEEeCCeEEEEEEEeCCC-CCCCCceeeEeeccccccccCCCCCccccc
Q 002054 55 VLETFKEEFEIGSRLITLETGKIARFANGAVVLGMDETKVLSTVTSSKG-DSVRDFLPLTVDYQEKQFAQGVIPNTYMRR 133 (974)
Q Consensus 55 ~~~~~~~~~~~~~r~i~~etg~~a~~A~GSa~v~~G~T~Vl~tv~~~~~-~~~~~f~pL~v~y~e~~~a~g~ip~~~~~R 133 (974)
||+.+++++++|||+++||||++|+||+|||++++|+|+|||||+++.+ +++.+|+||+|+|+||+||+|||||||+||
T Consensus 15 ~~~~~~~~~~~~~R~i~ietg~~ak~A~GSvlv~~GdT~VL~tv~~~~~~~~g~df~pltveY~ek~~a~G~iPg~~~~R 94 (726)
T 4aid_A 15 MFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAVFAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKR 94 (726)
T ss_dssp CCCEEECCCEETTEEEEEEESSSCTTSSEEEEEEETTEEEEEEEEECSSCCTTCCSCCEEEEEEECGGGGTCCCCSTTCS
T ss_pred ccCcEEEEEEECCeeEEEEECCccCCCCeeEEEEECCeEEEEEEEecCCCCCCCCCcCceeeeeeehhhcccCCCcccCC
Confidence 7999999999999999999999999999999999999999999999988 678999999999999999999999999999
Q ss_pred cCCCCchhhhHHHhhcCCccccccCCCCCceEEEEEEEeccCCCChhhHHHHHHHHHhhcCCCCCCCCeEEEEEEEECCE
Q 002054 134 EGAPKERELLVGRIIDRPIRPLFPAGFYHEVQVMASVLSSDGKQDPDIMAANATSAALMLSDIPWGGPIGMIRIGRICGQ 213 (974)
Q Consensus 134 eg~p~~~eil~~RlidR~lrplfp~~~~~~~~i~~~vl~~dg~~~~~~~ai~aAs~AL~~s~iP~~~~v~av~vg~i~g~ 213 (974)
||+|+++++|++|||||+|||+||++|++++||+|+||++||+++|+++||||||+||++|+|||++||+|||||++||+
T Consensus 95 EGrps~~~~li~RlIdR~lRplf~~~~~~evqI~~~Vls~Dg~~~~d~~ai~gAs~AL~~s~iP~~~~vaaV~Vg~i~g~ 174 (726)
T 4aid_A 95 EGRPSEKETLVSRLIDRPIRPLFVKGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGA 174 (726)
T ss_dssp CCSCCHHHHHHHHHHHHHHGGGBCTTCCSCEEEEEEEEECCSSSCHHHHHHHHHHHHHHHHTCSBCCCCEEEEEEEETTE
T ss_pred CCCCCchhhhHHHHhCCccccccccCCccceEEEEEEEecCCCCChhHHHHHHHHHHHHhcCCCcCCCeEEEEEEEECCE
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEcCCHHHHhcCccceeEeeeCCeEEEEEecCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCccccccccCCCH
Q 002054 214 FIVNPTMDELSLSDLNLVYACTREKTLMIDVQAREISEKDLEAGLRLAHPEAVKYLEPQIRLAEKAGKQKKEYKLSMISE 293 (974)
Q Consensus 214 ~vldPt~~e~~~s~~~l~v~~t~~~i~mie~~~~~~~e~~~~~al~~a~~~~~~i~~~~~~~~~~~g~~k~~~~~~~~~~ 293 (974)
+|+|||++|++.|++||+|+||+++++|+|+++++||+++|.+||++||+++++++++|+++++++||+|++|... .++
T Consensus 175 ~vldPt~~E~~~s~~dl~va~t~~~i~mve~~~~~~se~~~~~al~~a~~~i~~l~~~q~~~~~~~g~~k~~~~~~-~~~ 253 (726)
T 4aid_A 175 YVLNPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDLAEHAAKEPFAFEPE-DTD 253 (726)
T ss_dssp EEESCCHHHHHTCSEEEEEEECSSCEEEEEEEESSBCHHHHHHHHHHHHHHTHHHHHHHHHHHHHHCCCCCCCCCC-TTH
T ss_pred EEECCCHHHHhhCceeEEEEEeCCeEEEEEccCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCcccCCCC-CCH
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999887 899
Q ss_pred HHHHHHHHHHHHHHHhhhcCCCCChhHHHHHHHHHHHHHHHHhhhccc-h--hhhchHHHHHHHHHHHHHHHHHHhcCCc
Q 002054 294 QTLEKVSNLAEAHIEAVFTDPSYSKFERGEALDKIGQDVKKALEEECD-E--ESLQVLPKAVDTVRKRVIRKRIIAEGVR 370 (974)
Q Consensus 294 ~~~~~~~~~~~~~~~~~~~~~~~~k~~r~~~~~~~~~~~~~~~~~~~~-~--~~~~~~~~~~~~~~~~~~r~~il~~~~R 370 (974)
++.+++++++.++|++++.+ ++|++|+++++++++++.+.|.++.. + ....++..+|++++++.+|++|+++|+|
T Consensus 254 ~~~~~~~~~~~~~~~~~~~~--~~k~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~il~~g~R 331 (726)
T 4aid_A 254 AIKAKMKDLVGADIAAAYKI--QKKQDRYEAVGAAKKKAIAALGLSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLR 331 (726)
T ss_dssp HHHHHHHHHHHHHHHHHHHC--CSHHHHHHHHHHHHHHHHTTTTCCTTSSCCCCSSSHHHHHHHHHHHHHHHHHHSSSBC
T ss_pred HHHHHHHHHHHHHHHHHHhc--cchHHHHHHHHHHHHHHHHHhhhhccccccccHHHHHHHHHHHHHHHHHHHHhcCCCC
Confidence 99999999999999999987 59999999999999999999965431 1 2456899999999999999999999999
Q ss_pred CCCCCCCCccCeEEEeCCCCCCCcceEEEeCCeEEEEEEEeCCCchhhhccccCCCCceeEEEEEecCCCCccccccccC
Q 002054 371 VDGRQLDEVRPIYCESGNLPILHGSSLFSRGDTQVLCTVTLGAPAEAQRLESLVGPPTKRFMLHYSFPPFCINEVGKRVG 450 (974)
Q Consensus 371 ~DGR~~~e~R~I~ie~g~l~~a~GSal~~~G~T~Vl~~Vtl~~p~~~~~~d~~~~~~~~~~~v~~~f~p~s~~e~~~~~~ 450 (974)
+|||.++|+|||+|++|+++++||||+|++|+|||||+|++|...+.++.|.+.+++.++|++||+|||||++++++.++
T Consensus 332 ~DGR~~~elRpI~ie~gvl~~a~GSAl~~~G~TkVl~~Vt~Gp~~~~~~~d~l~~~~~g~~~~~y~~~P~st~er~~~g~ 411 (726)
T 4aid_A 332 IDGRDVKTVRPILGEVGILPRTHGSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGS 411 (726)
T ss_dssp TTSCBTTCCCCEEEEECSSTTSSEEEEEEETTEEEEEEEEEECGGGSEEEEETTEEEEECEEEEEECCGGGGTCCCCCSS
T ss_pred CCCCCCCCccceEEEECCCCCCCceEEEEeCCeEEEEEEEeCCCCcccccccccCCCceEEEEEEEeCCCcccccccCCC
Confidence 99999999999999999999999999999999999999988754455666667667889999999999999999999999
Q ss_pred CCchhhhHHHHHHHHhhhcCCCCCCCCeEEEEEEEEEcCCCChhhHHHHHHHHHHHHcCCCccccccceeeeeeccCCCC
Q 002054 451 LNRREVGHGTLAEKALLAVLPPENDFPYTVRVNSEVMASDGSTSMATVCGGSMALMDAGIPLQEHVAGVSVGLVSEVDPS 530 (974)
Q Consensus 451 ~~rre~~~~~l~eral~~vi~~~~~~p~tI~V~v~VLesdGs~~~A~v~aa~lAL~dagvPi~~~vagvs~gli~~~d~~ 530 (974)
+++||++|++|++|+|++++|..+.|||+|+|+++||++|||++|||+||+++||+||||||+++|+||+||++++++
T Consensus 412 ~~~Reie~~~li~raL~~vI~~~~~~P~tI~V~~~VLesDGs~~~AsI~aa~lAL~DAGIPm~~~VaavsvGli~~g~-- 489 (726)
T 4aid_A 412 PGRREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVPLVRPVSGIAMGLILEQD-- 489 (726)
T ss_dssp CCHHHHHHHHHHHHHHGGGSCCTTTCCCEEEEEEEEEECSSCHHHHHHHHHHHHHHHTTCCCSSCCEEEEEEEEECSS--
T ss_pred cchhhHHHHHHHHHHHHHhcCccccCCeEEEEEEEEEEcCCcHHHHHHHHHHHHHHhcCCccccCeeEEEEEEEcCCC--
Confidence 999999999999999999999668999999999999999999999999999999999999999999999999998643
Q ss_pred CCcccceEEEecCCccccccCCccEEEEeeCCceEEEEeeccCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCCC
Q 002054 531 TGEIKDYRILTDILGLEDHLGDMDFKIAGTRIGVTAIQLDIKPAGIPLDIICECLEHAHKGRLQILDHMEREISAPRTQD 610 (974)
Q Consensus 531 ~~~~~~~~iL~Dp~~~Ee~~~d~d~~Va~t~~gI~alq~~~k~~~i~~e~l~~al~~A~~~~~~I~~~m~~~i~~~~~~~ 610 (974)
++.+|+||++.||++++|||+|++|.+|||++|++++.++++.++|.+||++|+++|.+|++.|+++|.++|.++
T Consensus 490 -----~~~iLlD~~~~Ed~~gd~d~~Va~t~~gIt~lQ~d~k~~~~s~e~l~~aL~~A~~g~~~I~~~m~~al~~~r~~~ 564 (726)
T 4aid_A 490 -----GFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGITPAIMEQALAQAKEGRAHILGEMNKAMDAPRADV 564 (726)
T ss_dssp -----CEEEEESCCTTGGGGSSEEEEEEEETTEEEEEEEEECSSCCCHHHHHHHHHHHHHHHHHHHHHHHTTCSSCCSSC
T ss_pred -----ceEEEecCChhHHhcCCceEEEEecCCceEEEEecCCcCCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhh
Confidence 678999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCcceeeeeccchhhhhcCCCccchhhhhhhhCceEEee-CCEEEEEecCHHHHHHHHHHHHHHhhcccccCcEEEE
Q 002054 611 DRNSPRLATLKYDNDTLRRLIGPLGALKRKIEEETGGRISVS-DGTLTVVAKNRSVMEKVLEKVDFIIGREIEVGGIYKG 689 (974)
Q Consensus 611 ~~~~p~~~~~~i~~~ki~~vIg~gGk~i~~i~~~~g~~Idi~-dg~v~i~~~~~~~~~~a~~~i~~l~~~~~~~G~i~~G 689 (974)
++|||++.+++|||+||+++||||||+||+|+++||++|||+ +|+|+|++.+++.+++|+++++.++ .++++|++|+|
T Consensus 565 ~~~ap~~~~~~i~~~ki~~vig~gg~~i~~i~~~tg~~idi~ddG~v~I~~~~~~~~~~A~~~i~~i~-~~~~vG~v~~G 643 (726)
T 4aid_A 565 GDFAPKIETINIPTDKIREVIGSGGKVIREIVATTGAKVDINDDGVVKVSASDGAKIKAAIDWIKSIT-DEAEVGKIYDG 643 (726)
T ss_dssp CSSCCC-------------------------------------------CCSCHHHHHHHHHC-----------------
T ss_pred cccCCeEEEEeCCHHHHHhhcCCCchhHHHHHHHHCCceeEECCceEEEEeCCHHHHHHHHHHHHHHh-hhhcCCcEEEE
Confidence 999999999999999999999999999999999999999997 8999999999999999999999988 68999999999
Q ss_pred EEEEEeeceEEEEEcCCeEEEEecccCCCccccccccccccCCEEEEEEEEEccCCceEEEEeccCCCccccc
Q 002054 690 VVTSVKEYGAFVEFNGGQQGLLHVSELSHEPVSRVSDVVSVGQQLSLRCIGQDVRGNIKLSLKAVSPRPEADV 762 (974)
Q Consensus 690 ~V~~i~~~G~fV~l~~g~~Glvhisels~~~v~~~~~~~~vGd~V~vkVl~id~~gri~LS~K~~~~~~~~~~ 762 (974)
+|++|.+||+||+|.++.+||||+||++++++.++.++|++||.|+|||+++|.+|||.||+|++.++||...
T Consensus 644 ~V~~I~~fGaFVel~~g~eGLvHiSels~~rv~~~~d~~kvGD~V~VkVi~iD~~grI~LS~K~~~~~~G~~~ 716 (726)
T 4aid_A 644 KVVKVVDFGAFVNFFGAKDGLVHVSQISNERVAKPSDVLKEGQMVKVKLLGFDDRGKTKLSMKVVDQETGEDL 716 (726)
T ss_dssp -------------------------------------------------------------------------
T ss_pred EEEEEeccEEEEEECCCcEEEEEHHHcCcccccCccccCCCCCEEEEEEEEECCCCcEEEEEeecccCcchhh
Confidence 9999999999999999999999999999999999999999999999999999999999999999999888764
|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3gme_A Polyribonucleotide nucleotidyltransferase; protein-RNA complex, cytoplasm, nucleotidyltransferase, RNA- binding, transferase, hydrolase; 2.40A {Escherichia coli E24377A} PDB: 3gll_A 3gcm_A 3h1c_A 3cdj_A | Back alignment and structure |
|---|
| >2nn6_B Exosome complex exonuclease RRP41; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 | Back alignment and structure |
|---|
| >2wnr_B Probable exosome complex exonuclease 1; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >3m7n_D Probable exosome complex exonuclease 1; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 3m85_D 2ba0_F 2ba1_E | Back alignment and structure |
|---|
| >2po1_A Probable exosome complex exonuclease 1; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_A* 2pnz_A 2po2_A* | Back alignment and structure |
|---|
| >2je6_B RRP41, exosome complex exonuclease 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_B* 2jeb_B* 2br2_B 2c37_B* 2c38_B* 2c39_B* 3l7z_B | Back alignment and structure |
|---|
| >3hkm_A OS03G0854200 protein; RNAse PH domain, phosphorylase, hydrolase; 1.98A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3b4t_A Ribonuclease PH; RNAse, tRNA nucleotidyltransferase, RPHA, STRU genomics, TBSGC; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2wp8_B Exosome complex component SKI6; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2po1_B Probable exosome complex exonuclease 2; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_B* 2pnz_B 2po2_B* | Back alignment and structure |
|---|
| >3dd6_A Ribonuclease PH; exoribonuclease, tRNA maturation, RNAse PH., transferase; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3m7n_G Probable exosome complex exonuclease 2; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_H 2ba0_I 3m85_G | Back alignment and structure |
|---|
| >2wnr_A Probable exosome complex exonuclease 2; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >1oys_A Ribonuclease PH; transferase, tRNA processing; 2.40A {Bacillus subtilis} SCOP: d.14.1.4 d.101.1.1 PDB: 1oyp_A 1oyr_A | Back alignment and structure |
|---|
| >2nn6_C Exosome complex exonuclease RRP43; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 | Back alignment and structure |
|---|
| >2nn6_F MTR3, exosome component 6; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 | Back alignment and structure |
|---|
| >1udn_A Ribonuclease PH, RNAse PH; transferase, riken structural genomics/proteomics initiative structural genomics; 2.30A {Aquifex aeolicus} SCOP: d.14.1.4 d.101.1.1 PDB: 1udq_A 1uds_A 1udo_A | Back alignment and structure |
|---|
| >2je6_A RRP42, exosome complex exonuclease 2; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_A* 2jeb_A* 2br2_A 2c37_A* 2c38_A* 2c39_A* 3l7z_A | Back alignment and structure |
|---|
| >1r6l_A Ribonuclease PH; beta-alpha-beta-alpha fold, hexamer, phosphate bound, transf; HET: NHE; 1.90A {Pseudomonas aeruginosa} SCOP: d.14.1.4 d.101.1.1 PDB: 1r6m_A | Back alignment and structure |
|---|
| >2wp8_A Exosome complex component RRP45; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2nn6_E Exosome complex exonuclease RRP42; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 | Back alignment and structure |
|---|
| >2nn6_A Polymyositis/scleroderma autoantigen 1; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 | Back alignment and structure |
|---|
| >3dd6_A Ribonuclease PH; exoribonuclease, tRNA maturation, RNAse PH., transferase; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2je6_B RRP41, exosome complex exonuclease 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_B* 2jeb_B* 2br2_B 2c37_B* 2c38_B* 2c39_B* 3l7z_B | Back alignment and structure |
|---|
| >2nn6_D Exosome complex exonuclease RRP46; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 | Back alignment and structure |
|---|
| >3b4t_A Ribonuclease PH; RNAse, tRNA nucleotidyltransferase, RPHA, STRU genomics, TBSGC; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2wp8_B Exosome complex component SKI6; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2nn6_F MTR3, exosome component 6; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 | Back alignment and structure |
|---|
| >1r6l_A Ribonuclease PH; beta-alpha-beta-alpha fold, hexamer, phosphate bound, transf; HET: NHE; 1.90A {Pseudomonas aeruginosa} SCOP: d.14.1.4 d.101.1.1 PDB: 1r6m_A | Back alignment and structure |
|---|
| >2wnr_A Probable exosome complex exonuclease 2; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >3m7n_G Probable exosome complex exonuclease 2; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_H 2ba0_I 3m85_G | Back alignment and structure |
|---|
| >3m7n_D Probable exosome complex exonuclease 1; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 3m85_D 2ba0_F 2ba1_E | Back alignment and structure |
|---|
| >3krn_A Protein C14A4.5, confirmed by transcript evidence; RNAse PH domain, homodimer, exosome, cell-death-related DNAS hydrolase; 3.92A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1udn_A Ribonuclease PH, RNAse PH; transferase, riken structural genomics/proteomics initiative structural genomics; 2.30A {Aquifex aeolicus} SCOP: d.14.1.4 d.101.1.1 PDB: 1udq_A 1uds_A 1udo_A | Back alignment and structure |
|---|
| >2je6_A RRP42, exosome complex exonuclease 2; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: d.14.1.4 d.101.1.1 PDB: 2jea_A* 2jeb_A* 2br2_A 2c37_A* 2c38_A* 2c39_A* 3l7z_A | Back alignment and structure |
|---|
| >1oys_A Ribonuclease PH; transferase, tRNA processing; 2.40A {Bacillus subtilis} SCOP: d.14.1.4 d.101.1.1 PDB: 1oyp_A 1oyr_A | Back alignment and structure |
|---|
| >3hkm_A OS03G0854200 protein; RNAse PH domain, phosphorylase, hydrolase; 1.98A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2nn6_C Exosome complex exonuclease RRP43; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 | Back alignment and structure |
|---|
| >2po1_A Probable exosome complex exonuclease 1; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_A* 2pnz_A 2po2_A* | Back alignment and structure |
|---|
| >4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A | Back alignment and structure |
|---|
| >3krn_A Protein C14A4.5, confirmed by transcript evidence; RNAse PH domain, homodimer, exosome, cell-death-related DNAS hydrolase; 3.92A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A | Back alignment and structure |
|---|
| >2nn6_B Exosome complex exonuclease RRP41; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 | Back alignment and structure |
|---|
| >2nn6_E Exosome complex exonuclease RRP42; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 | Back alignment and structure |
|---|
| >2wnr_B Probable exosome complex exonuclease 1; phosphate binding, 3'-5' exoribonuclease, hydrolase; 2.65A {Methanothermobacter thermautotrophicusorganism_taxid} | Back alignment and structure |
|---|
| >2nn6_D Exosome complex exonuclease RRP46; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 | Back alignment and structure |
|---|
| >2nn6_A Polymyositis/scleroderma autoantigen 1; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: d.14.1.4 d.101.1.1 | Back alignment and structure |
|---|
| >2po1_B Probable exosome complex exonuclease 2; RNAse PH, hydrolase/hydrolase/RNA complex; 1.94A {Pyrococcus abyssi} PDB: 2po0_B* 2pnz_B 2po2_B* | Back alignment and structure |
|---|
| >3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >2wp8_A Exosome complex component RRP45; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gme_A Polyribonucleotide nucleotidyltransferase; protein-RNA complex, cytoplasm, nucleotidyltransferase, RNA- binding, transferase, hydrolase; 2.40A {Escherichia coli E24377A} PDB: 3gll_A 3gcm_A 3h1c_A 3cdj_A | Back alignment and structure |
|---|
| >1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 | Back alignment and structure |
|---|
| >1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... | Back alignment and structure |
|---|
| >1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1luz_A Protein K3, protein K2; stranded anti-parallel beta barrel, viral protein; 1.80A {Vaccinia virus} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3go5_A Multidomain protein with S1 RNA-binding domains; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A | Back alignment and structure |
|---|
| >1whu_A Polynucleotide phosphorylase; 3'-5' RNA exonuclease; pnpase, alpha-helical domain, structural genomics; NMR {Mus musculus} SCOP: a.4.9.1 | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2c35_B Human RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 | Back alignment and structure |
|---|
| >2khj_A 30S ribosomal protein S1; OB fold, acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A | Back alignment and structure |
|---|
| >2khi_A 30S ribosomal protein S1; acetylation, phosphoprotein, ribonucleoprotein, RNA-binding; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* | Back alignment and structure |
|---|
| >2k52_A Uncharacterized protein MJ1198; metal-binding, zinc, zinc-finger, structural genomics, PSI-2, protein structure initiative; NMR {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E | Back alignment and structure |
|---|
| >2eqs_A ATP-dependent RNA helicase DHX8; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k4k_A GSP13, general stress protein 13; cytoplasm, stress response, RNA binding protein; NMR {Bacillus subtilis} | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >3h36_A Polyribonucleotide nucleotidyltransferase; polyribonucleotide nucleotidyltransfer structural genomics, PSI-2, protein structure initiative; 1.80A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cqo_A Nucleolar protein of 40 kDa; S1 domain, OB-fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1luz_A Protein K3, protein K2; stranded anti-parallel beta barrel, viral protein; 1.80A {Vaccinia virus} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A | Back alignment and structure |
|---|
| >1kl9_A Eukaryotic translation initiation factor 2 subuni; OB fold, helical domain; 1.90A {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 | Back alignment and structure |
|---|
| >2a19_A EIF-2- alpha, eukaryotic translation initiation factor 2 alpha; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Saccharomyces cerevisiae} PDB: 2a1a_A* 1q46_A | Back alignment and structure |
|---|
| >2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A | Back alignment and structure |
|---|
| >2nn6_I 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wi5_A RRP5 protein homolog; S1 domain, OB-fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >3aev_A Translation initiation factor 2 subunit alpha; proteins-rRNA complex, 16S rRNA, RNA-binding; 2.80A {Pyrococcus horikoshii} PDB: 1yz6_A | Back alignment and structure |
|---|
| >2je6_I RRP4, exosome complex RNA-binding protein 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 PDB: 2jea_I* 2jeb_I* 3l7z_C | Back alignment and structure |
|---|
| >2ba0_A Archeal exosome RNA binding protein RRP4; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >1q8k_A Eukaryotic translation initiation factor 2 subunit 1; NMR {Homo sapiens} SCOP: a.60.14.1 b.40.4.5 d.58.51.1 | Back alignment and structure |
|---|
| >1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A | Back alignment and structure |
|---|
| >2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3cw2_C Translation initiation factor 2 subunit alpha; AIF2, intact AIF2, initiation factor 2 alpha subunit, initiation factor 2 beta subunit; 2.80A {Sulfolobus solfataricus} PDB: 2aho_B 3v11_B* | Back alignment and structure |
|---|
| >2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... | Back alignment and structure |
|---|
| >2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3bzc_A TEX; helix-turn-helix, helix-hairpin-helix, S1 domain, YQGF domain, transcription, RNA binding protein; 2.27A {Pseudomonas aeruginosa} SCOP: a.60.2.6 a.60.2.6 a.294.1.1 b.40.4.5 c.55.3.13 PDB: 3bzk_A 2oce_A | Back alignment and structure |
|---|
| >3psf_A Transcription elongation factor SPT6; nucleus; 2.59A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* | Back alignment and structure |
|---|
| >2b8k_G B16, DNA-directed RNA polymerase II 19 kDa polypeptide; DNA-dependent RNA polymerase, cellular RNA polymerase; 4.15A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A | Back alignment and structure |
|---|
| >4ayb_E DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2y0s_E 4b1o_E 4b1p_T 2waq_E 2wb1_E 2pmz_E 3hkz_E | Back alignment and structure |
|---|
| >2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c35_B Human RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transcription, nucleotidyltransferase; 2.70A {Homo sapiens} SCOP: b.40.4.5 d.230.1.1 | Back alignment and structure |
|---|
| >2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A | Back alignment and structure |
|---|
| >3ayh_B DNA-directed RNA polymerase III subunit RPC8; transcription; 2.19A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ba0_A Archeal exosome RNA binding protein RRP4; RNAse PH, RNA degradation, exoribonuclease, S1domain, KH domain, archaeal; 2.70A {Archaeoglobus fulgidus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >2nn6_I 3'-5' exoribonuclease CSL4 homolog; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 | Back alignment and structure |
|---|
| >1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >3m7n_A Putative uncharacterized protein AF_0206; exosome, RNA, exonuclease, hydrolase, nuclease, hydrolase-RN; 2.40A {Archaeoglobus fulgidus} PDB: 2ba1_A 3m85_A | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A | Back alignment and structure |
|---|
| >2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckz_B C25, DNA-directed RNA polymerase III 25 KD polypeptide; multiprotein complex, nucleotidyltransferase, nuclear protein, hypothetical protein; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2je6_I RRP4, exosome complex RNA-binding protein 1; nuclease, hydrolase, exonuclease, phosphorolytic, exoribonuclease, RNA degradation; HET: 1PE; 1.6A {Sulfolobus solfataricus} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 PDB: 2jea_I* 2jeb_I* 3l7z_C | Back alignment and structure |
|---|
| >1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A | Back alignment and structure |
|---|
| >2ja9_A Exosome complex exonuclease RRP40; RNA-binding protein, RNA, S1 domain, KH domain, hydrolase, RNA-binding, nuclear protein; 2.20A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2nn6_H Exosome complex exonuclease RRP4; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >3h0g_G DNA-directed RNA polymerase II subunit RPB7; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} | Back alignment and structure |
|---|
| >1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A | Back alignment and structure |
|---|
| >2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 | Back alignment and structure |
|---|
| >2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A | Back alignment and structure |
|---|
| >2bh8_A 1B11; transcription, molecular evolution, unique architecture, transcription regulation, phosphorylation; 1.9A {Escherichia coli} | Back alignment and structure |
|---|
| >1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2id0_A Exoribonuclease 2; RNAse, exonuclease, hydrolyase, mRNA decay, RNR family, hydrolase; 2.35A {Escherichia coli} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 PDB: 2ix0_A* 2ix1_A | Back alignment and structure |
|---|
| >1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 | Back alignment and structure |
|---|
| >2ckz_B C25, DNA-directed RNA polymerase III 25 KD polypeptide; multiprotein complex, nucleotidyltransferase, nuclear protein, hypothetical protein; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ja9_A Exosome complex exonuclease RRP40; RNA-binding protein, RNA, S1 domain, KH domain, hydrolase, RNA-binding, nuclear protein; 2.20A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.51.1.1 | Back alignment and structure |
|---|
| >3ayh_B DNA-directed RNA polymerase III subunit RPC8; transcription; 2.19A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2bx2_L Ribonuclease E, RNAse E; RNA-binding, RNA turnover, RNA processing, hydrolase, endonu nuclease; 2.85A {Escherichia coli} PDB: 2c0b_L 2c4r_L 2vmk_A 2vrt_A 1slj_A 1smx_A 1sn8_A | Back alignment and structure |
|---|
| >2nn6_G Exosome complex exonuclease RRP40; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2nn6_H Exosome complex exonuclease RRP4; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >2vnu_D Exosome complex exonuclease RRP44; hydrolase-RNA complex, RNA degradation, RNA-binding, RNA Pro; HET: 1PE; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 b.40.4.5 b.40.4.5 b.40.4.16 | Back alignment and structure |
|---|
| >2wp8_J Exosome complex exonuclease DIS3; nucleus, hydrolase, RNA-binding, exonucle binding, mitochondrion, rRNA processing; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* | Back alignment and structure |
|---|
| >2nn6_G Exosome complex exonuclease RRP40; RNA, exosome, PM/SCL, phosphorolytic, hydrolase/transferase complex; 3.35A {Homo sapiens} SCOP: b.40.4.5 b.84.4.2 d.51.1.1 | Back alignment and structure |
|---|
| >2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2r7d_A Ribonuclease II family protein; structural genomics, PSI-2, structure initiative, northeast structural genomics consort NESG; 1.80A {Deinococcus radiodurans R1} SCOP: b.40.4.5 b.40.4.16 PDB: 2r7f_A | Back alignment and structure |
|---|
| >1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 | Back alignment and structure |
|---|
| >3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3d0f_A Penicillin-binding 1 transmembrane protein MRCA; BIG_1156.2, STR genomics, PSI-2, protein structure initiative; 1.64A {Nitrosomonas europaea atcc 19718} | Back alignment and structure |
|---|
| >1wfq_A UNR protein; beta-barrel, translational regulation, RNA chaperone, RNA/DN binding, QB fold, greek-KEY topology, structur genomics; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
| >2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A | Back alignment and structure |
|---|
| >3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} | Back alignment and structure |
|---|
| >2rf4_A DNA-directed RNA polymerase I subunit RPA4; transferase DNA/RNA, DNA-binding, phosphorylation, POL I, POLI, rpoli, nuclear protein; 3.10A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2k5n_A Putative cold-shock protein; GFT protein structure, PSI, nesgc, OB fold, cold shock structural genomics; NMR {Pectobacterium atrosepticum} | Back alignment and structure |
|---|
| >1h95_A CSD, Y-box binding protein; translation factor, transcription factor, OB-fold, 5- stranded anti-parallel beta-barrel, single stranded DNA binding; NMR {Homo sapiens} SCOP: b.40.4.5 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 974 | ||||
| d1e3ha6 | 96 | d.101.1.1 (A:483-578) Polynucleotide phosphorylase | 6e-38 | |
| d2je6a1 | 191 | d.14.1.4 (A:1-191) Exosome complex exonuclease 2,E | 2e-37 | |
| d2ba0g1 | 176 | d.14.1.4 (G:3-178) Exosome complex exonuclease 2,E | 4e-36 | |
| d2ba0g1 | 176 | d.14.1.4 (G:3-178) Exosome complex exonuclease 2,E | 5e-05 | |
| d2je6b1 | 148 | d.14.1.4 (B:8-155) Exosome complex exonuclease 1, | 2e-35 | |
| d1e3ha3 | 137 | d.14.1.4 (A:346-482) Polynucleotide phosphorylase/ | 4e-35 | |
| d1e3ha3 | 137 | d.14.1.4 (A:346-482) Polynucleotide phosphorylase/ | 8e-18 | |
| d2ba0d1 | 144 | d.14.1.4 (D:10-153) Exosome complex exonuclease 1, | 3e-34 | |
| d2nn6c1 | 181 | d.14.1.4 (C:7-187) Exosome complex exonuclease RRP | 5e-33 | |
| d2nn6c1 | 181 | d.14.1.4 (C:7-187) Exosome complex exonuclease RRP | 1e-14 | |
| d2nn6b1 | 145 | d.14.1.4 (B:6-150) Exosome complex exonuclease RRP | 7e-33 | |
| d2nn6a1 | 184 | d.14.1.4 (A:1-184) Exosome complex exonuclease RRP | 1e-32 | |
| d1r6la1 | 151 | d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseu | 2e-32 | |
| d1r6la1 | 151 | d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseu | 2e-05 | |
| d2nn6e1 | 187 | d.14.1.4 (E:5-191) Exosome complex exonuclease RRP | 1e-31 | |
| d2nn6e1 | 187 | d.14.1.4 (E:5-191) Exosome complex exonuclease RRP | 6e-04 | |
| d1oysa1 | 151 | d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Baci | 4e-31 | |
| d1oysa1 | 151 | d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Baci | 1e-05 | |
| d1e3ha2 | 149 | d.14.1.4 (A:3-151) Polynucleotide phosphorylase/gu | 1e-30 | |
| d1e3ha2 | 149 | d.14.1.4 (A:3-151) Polynucleotide phosphorylase/gu | 3e-25 | |
| d1udsa1 | 149 | d.14.1.4 (A:2-150) Ribonuclease PH, domain 1 {Aqui | 4e-29 | |
| d1udsa1 | 149 | d.14.1.4 (A:2-150) Ribonuclease PH, domain 1 {Aqui | 2e-06 | |
| d2nn6f1 | 147 | d.14.1.4 (F:29-175) Exosome complex exonuclease MT | 5e-28 | |
| d2nn6f1 | 147 | d.14.1.4 (F:29-175) Exosome complex exonuclease MT | 5e-17 | |
| d2nn6d1 | 122 | d.14.1.4 (D:25-146) Exosome complex exonuclease RR | 1e-25 | |
| d2nn6d1 | 122 | d.14.1.4 (D:25-146) Exosome complex exonuclease RR | 1e-18 | |
| d1e3ha5 | 111 | d.101.1.1 (A:152-262) Polynucleotide phosphorylase | 2e-20 | |
| d1whua_ | 104 | a.4.9.1 (A:) Polynucleotide phosphorylase/guanosin | 5e-18 | |
| d1sroa_ | 76 | b.40.4.5 (A:) S1 RNA-binding domain of polyribonuc | 9e-18 | |
| d1e3ha1 | 83 | a.4.9.1 (A:263-345) Polynucleotide phosphorylase/g | 2e-14 | |
| d1oysa2 | 86 | d.101.1.1 (A:152-237) Ribonuclease PH, domain 2 {B | 7e-14 | |
| d1oysa2 | 86 | d.101.1.1 (A:152-237) Ribonuclease PH, domain 2 {B | 3e-04 | |
| d3bzka4 | 94 | b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas ae | 1e-13 | |
| d2nn6h1 | 95 | b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-pro | 2e-13 | |
| d2z0sa1 | 88 | b.40.4.5 (A:60-147) S1-domain of exosome complex R | 5e-13 | |
| d1r6la2 | 88 | d.101.1.1 (A:152-239) Ribonuclease PH, domain 2 {P | 1e-12 | |
| d1r6la2 | 88 | d.101.1.1 (A:152-239) Ribonuclease PH, domain 2 {P | 2e-08 | |
| d1e3pa2 | 62 | b.40.4.5 (A:656-717) S1 RNA-binding domain of poly | 2e-12 | |
| d2ba0a1 | 83 | b.40.4.5 (A:53-135) S1-domain of exosome complex R | 3e-12 | |
| d1udsa2 | 105 | d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {A | 7e-12 | |
| d1udsa2 | 105 | d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {A | 1e-09 | |
| d2je6b2 | 86 | d.101.1.1 (B:156-241) Exosome complex exonuclease | 9e-12 | |
| d2je6b2 | 86 | d.101.1.1 (B:156-241) Exosome complex exonuclease | 2e-06 | |
| d2je6i1 | 87 | b.40.4.5 (I:66-152) S1-domain of exosome complex R | 2e-11 | |
| d2z0sa2 | 87 | d.51.1.1 (A:148-234) Exosome complex RNA-binding p | 3e-11 | |
| d2nn6b2 | 90 | d.101.1.1 (B:151-240) Exosome complex exonuclease | 3e-11 | |
| d2nn6b2 | 90 | d.101.1.1 (B:151-240) Exosome complex exonuclease | 3e-04 | |
| d2ba0d2 | 99 | d.101.1.1 (D:154-252) Exosome complex exonuclease | 4e-11 | |
| d2ba0d2 | 99 | d.101.1.1 (D:154-252) Exosome complex exonuclease | 4e-11 | |
| d2je6a2 | 84 | d.101.1.1 (A:192-275) Exosome complex exonuclease | 6e-11 | |
| d2je6a2 | 84 | d.101.1.1 (A:192-275) Exosome complex exonuclease | 3e-05 | |
| d2ahob2 | 84 | b.40.4.5 (B:1-84) Eukaryotic initiation factor 2al | 2e-10 | |
| d1kl9a2 | 86 | b.40.4.5 (A:3-88) Eukaryotic initiation factor 2al | 2e-09 | |
| d2nn6d2 | 89 | d.101.1.1 (D:147-235) Exosome complex exonuclease | 1e-08 | |
| d1go3e1 | 106 | b.40.4.5 (E:79-184) C-terminal domain of RNA polym | 2e-08 | |
| d2nn6g1 | 88 | b.40.4.5 (G:107-194) S1-domain of exosome componen | 5e-08 | |
| d1e3ha4 | 54 | d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ | 5e-08 | |
| d1tuaa2 | 104 | d.51.1.1 (A:85-188) Hypothetical protein APE0754 { | 9e-08 | |
| d1wi5a_ | 119 | b.40.4.5 (A:) S1-domain of RRP5 protein homolog (P | 9e-07 | |
| d2ja9a1 | 90 | b.40.4.5 (A:62-151) S1-domain of exosome component | 1e-06 | |
| d1tuaa1 | 84 | d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae | 2e-06 | |
| d2je6i3 | 69 | d.51.1.1 (I:153-221) Exosome complex RNA-binding p | 4e-06 | |
| d2nn6f2 | 95 | d.101.1.1 (F:176-270) Exosome complex exonuclease | 7e-06 | |
| d1y14b1 | 91 | b.40.4.5 (B:81-171) C-terminal domain of RNA polym | 1e-05 | |
| d2ba0a3 | 84 | d.51.1.1 (A:136-219) Exosome complex RNA-binding p | 1e-05 | |
| d2cpqa1 | 78 | d.51.1.1 (A:212-289) Fragile X mental retardation | 3e-04 | |
| d4ubpa_ | 100 | d.8.1.1 (A:) Urease, gamma-subunit {Bacillus paste | 8e-04 | |
| d1e9ya2 | 105 | d.8.1.1 (A:1-105) Urease, gamma-subunit {Helicobac | 0.001 | |
| d2ctka1 | 91 | d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T | 0.003 | |
| d1we8a_ | 104 | d.51.1.1 (A:) Tudor and KH domain containing prote | 0.004 |
| >d1e3ha6 d.101.1.1 (A:483-578) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus [TaxId: 1890]} Length = 96 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ribonuclease PH domain 2-like superfamily: Ribonuclease PH domain 2-like family: Ribonuclease PH domain 2-like domain: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 species: Streptomyces antibioticus [TaxId: 1890]
Score = 134 bits (340), Expect = 6e-38
Identities = 44/92 (47%), Positives = 55/92 (59%), Gaps = 3/92 (3%)
Query: 516 VAGVSVGLVSEVDPSTGEIKDYRILTDILGLEDHLGDMDFKIAGTRIGVTAIQLDIKPAG 575
VAG+++GL+S+ Y LTDILG ED GDMDFK+AGT+ VTA+QLD K G
Sbjct: 3 VAGIAMGLISQEI---NGETHYVALTDILGAEDAFGDMDFKVAGTKEFVTALQLDTKLDG 59
Query: 576 IPLDIICECLEHAHKGRLQILDHMEREISAPR 607
IP ++ L+ A RL ILD M I P
Sbjct: 60 IPASVLAAALKQARDARLHILDVMMEAIDTPD 91
|
| >d2je6a1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]} Length = 191 | Back information, alignment and structure |
|---|
| >d2ba0g1 d.14.1.4 (G:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 176 | Back information, alignment and structure |
|---|
| >d2ba0g1 d.14.1.4 (G:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 176 | Back information, alignment and structure |
|---|
| >d2je6b1 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 148 | Back information, alignment and structure |
|---|
| >d1e3ha3 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} Length = 137 | Back information, alignment and structure |
|---|
| >d1e3ha3 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} Length = 137 | Back information, alignment and structure |
|---|
| >d2ba0d1 d.14.1.4 (D:10-153) Exosome complex exonuclease 1, ECX1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 144 | Back information, alignment and structure |
|---|
| >d2nn6c1 d.14.1.4 (C:7-187) Exosome complex exonuclease RRP43 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 | Back information, alignment and structure |
|---|
| >d2nn6c1 d.14.1.4 (C:7-187) Exosome complex exonuclease RRP43 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 | Back information, alignment and structure |
|---|
| >d2nn6b1 d.14.1.4 (B:6-150) Exosome complex exonuclease RRP41 {Human (Homo sapiens) [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d2nn6a1 d.14.1.4 (A:1-184) Exosome complex exonuclease RRP45 {Human (Homo sapiens) [TaxId: 9606]} Length = 184 | Back information, alignment and structure |
|---|
| >d1r6la1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomonas aeruginosa [TaxId: 287]} Length = 151 | Back information, alignment and structure |
|---|
| >d1r6la1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomonas aeruginosa [TaxId: 287]} Length = 151 | Back information, alignment and structure |
|---|
| >d2nn6e1 d.14.1.4 (E:5-191) Exosome complex exonuclease RRP42 {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d2nn6e1 d.14.1.4 (E:5-191) Exosome complex exonuclease RRP42 {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d1oysa1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]} Length = 151 | Back information, alignment and structure |
|---|
| >d1oysa1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]} Length = 151 | Back information, alignment and structure |
|---|
| >d1e3ha2 d.14.1.4 (A:3-151) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} Length = 149 | Back information, alignment and structure |
|---|
| >d1e3ha2 d.14.1.4 (A:3-151) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} Length = 149 | Back information, alignment and structure |
|---|
| >d1udsa1 d.14.1.4 (A:2-150) Ribonuclease PH, domain 1 {Aquifex aeolicus [TaxId: 63363]} Length = 149 | Back information, alignment and structure |
|---|
| >d1udsa1 d.14.1.4 (A:2-150) Ribonuclease PH, domain 1 {Aquifex aeolicus [TaxId: 63363]} Length = 149 | Back information, alignment and structure |
|---|
| >d2nn6f1 d.14.1.4 (F:29-175) Exosome complex exonuclease MTR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 | Back information, alignment and structure |
|---|
| >d2nn6f1 d.14.1.4 (F:29-175) Exosome complex exonuclease MTR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 147 | Back information, alignment and structure |
|---|
| >d2nn6d1 d.14.1.4 (D:25-146) Exosome complex exonuclease RRP46 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
| >d2nn6d1 d.14.1.4 (D:25-146) Exosome complex exonuclease RRP46 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 | Back information, alignment and structure |
|---|
| >d1e3ha5 d.101.1.1 (A:152-262) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus [TaxId: 1890]} Length = 111 | Back information, alignment and structure |
|---|
| >d1whua_ a.4.9.1 (A:) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1e3ha1 a.4.9.1 (A:263-345) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 {Streptomyces antibioticus [TaxId: 1890]} Length = 83 | Back information, alignment and structure |
|---|
| >d1oysa2 d.101.1.1 (A:152-237) Ribonuclease PH, domain 2 {Bacillus subtilis [TaxId: 1423]} Length = 86 | Back information, alignment and structure |
|---|
| >d1oysa2 d.101.1.1 (A:152-237) Ribonuclease PH, domain 2 {Bacillus subtilis [TaxId: 1423]} Length = 86 | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} Length = 94 | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 88 | Back information, alignment and structure |
|---|
| >d1r6la2 d.101.1.1 (A:152-239) Ribonuclease PH, domain 2 {Pseudomonas aeruginosa [TaxId: 287]} Length = 88 | Back information, alignment and structure |
|---|
| >d1r6la2 d.101.1.1 (A:152-239) Ribonuclease PH, domain 2 {Pseudomonas aeruginosa [TaxId: 287]} Length = 88 | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} Length = 62 | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 83 | Back information, alignment and structure |
|---|
| >d1udsa2 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquifex aeolicus [TaxId: 63363]} Length = 105 | Back information, alignment and structure |
|---|
| >d1udsa2 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquifex aeolicus [TaxId: 63363]} Length = 105 | Back information, alignment and structure |
|---|
| >d2je6b2 d.101.1.1 (B:156-241) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 86 | Back information, alignment and structure |
|---|
| >d2je6b2 d.101.1.1 (B:156-241) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 86 | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 87 | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 | Back information, alignment and structure |
|---|
| >d2nn6b2 d.101.1.1 (B:151-240) Exosome complex exonuclease RRP41 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2nn6b2 d.101.1.1 (B:151-240) Exosome complex exonuclease RRP41 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d2ba0d2 d.101.1.1 (D:154-252) Exosome complex exonuclease 1, ECX1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 99 | Back information, alignment and structure |
|---|
| >d2ba0d2 d.101.1.1 (D:154-252) Exosome complex exonuclease 1, ECX1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 99 | Back information, alignment and structure |
|---|
| >d2je6a2 d.101.1.1 (A:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2je6a2 d.101.1.1 (A:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} Length = 84 | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
| >d2nn6d2 d.101.1.1 (D:147-235) Exosome complex exonuclease RRP46 {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 106 | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 | Back information, alignment and structure |
|---|
| >d2nn6f2 d.101.1.1 (F:176-270) Exosome complex exonuclease MTR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 91 | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 974 | |||
| d1e3ha2 | 149 | Polynucleotide phosphorylase/guanosine pentaphosph | 100.0 | |
| d2nn6b1 | 145 | Exosome complex exonuclease RRP41 {Human (Homo sap | 99.96 | |
| d2je6b1 | 148 | Exosome complex exonuclease 1, ECX1 {Sulfolobus so | 99.96 | |
| d2ba0d1 | 144 | Exosome complex exonuclease 1, ECX1 {Archaeoglobus | 99.96 | |
| d2ba0g1 | 176 | Exosome complex exonuclease 2,ECX2 {Archaeoglobus | 99.94 | |
| d1e3ha3 | 137 | Polynucleotide phosphorylase/guanosine pentaphosph | 99.94 | |
| d1udsa1 | 149 | Ribonuclease PH, domain 1 {Aquifex aeolicus [TaxId | 99.93 | |
| d1r6la1 | 151 | Ribonuclease PH, domain 1 {Pseudomonas aeruginosa | 99.92 | |
| d2je6a1 | 191 | Exosome complex exonuclease 2,ECX2 {Sulfolobus sol | 99.92 | |
| d1oysa1 | 151 | Ribonuclease PH, domain 1 {Bacillus subtilis [TaxI | 99.91 | |
| d2nn6e1 | 187 | Exosome complex exonuclease RRP42 {Human (Homo sap | 99.9 | |
| d2nn6c1 | 181 | Exosome complex exonuclease RRP43 {Human (Homo sap | 99.89 | |
| d1e3ha6 | 96 | Polynucleotide phosphorylase/guanosine pentaphosph | 99.89 | |
| d1e3ha2 | 149 | Polynucleotide phosphorylase/guanosine pentaphosph | 99.88 | |
| d2nn6a1 | 184 | Exosome complex exonuclease RRP45 {Human (Homo sap | 99.88 | |
| d2nn6f1 | 147 | Exosome complex exonuclease MTR3 {Human (Homo sapi | 99.87 | |
| d2nn6d1 | 122 | Exosome complex exonuclease RRP46 {Human (Homo sap | 99.86 | |
| d1e3ha3 | 137 | Polynucleotide phosphorylase/guanosine pentaphosph | 99.86 | |
| d1e3ha5 | 111 | Polynucleotide phosphorylase/guanosine pentaphosph | 99.82 | |
| d1r6la2 | 88 | Ribonuclease PH, domain 2 {Pseudomonas aeruginosa | 99.78 | |
| d2nn6d1 | 122 | Exosome complex exonuclease RRP46 {Human (Homo sap | 99.78 | |
| d2je6b1 | 148 | Exosome complex exonuclease 1, ECX1 {Sulfolobus so | 99.76 | |
| d2ba0d1 | 144 | Exosome complex exonuclease 1, ECX1 {Archaeoglobus | 99.76 | |
| d2nn6b1 | 145 | Exosome complex exonuclease RRP41 {Human (Homo sap | 99.74 | |
| d1udsa1 | 149 | Ribonuclease PH, domain 1 {Aquifex aeolicus [TaxId | 99.74 | |
| d1r6la1 | 151 | Ribonuclease PH, domain 1 {Pseudomonas aeruginosa | 99.68 | |
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 99.68 | |
| d1udsa2 | 105 | Ribonuclease PH, domain 2 {Aquifex aeolicus [TaxId | 99.68 | |
| d1oysa2 | 86 | Ribonuclease PH, domain 2 {Bacillus subtilis [TaxI | 99.64 | |
| d2nn6f1 | 147 | Exosome complex exonuclease MTR3 {Human (Homo sapi | 99.64 | |
| d1oysa1 | 151 | Ribonuclease PH, domain 1 {Bacillus subtilis [TaxI | 99.63 | |
| d2je6b2 | 86 | Exosome complex exonuclease 1, ECX1 {Sulfolobus so | 99.57 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.56 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.53 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 99.52 | |
| d2je6a1 | 191 | Exosome complex exonuclease 2,ECX2 {Sulfolobus sol | 99.51 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 99.51 | |
| d2nn6b2 | 90 | Exosome complex exonuclease RRP41 {Human (Homo sap | 99.51 | |
| d2ba0g1 | 176 | Exosome complex exonuclease 2,ECX2 {Archaeoglobus | 99.5 | |
| d2nn6c1 | 181 | Exosome complex exonuclease RRP43 {Human (Homo sap | 99.47 | |
| d2ba0d2 | 99 | Exosome complex exonuclease 1, ECX1 {Archaeoglobus | 99.46 | |
| d1r6la2 | 88 | Ribonuclease PH, domain 2 {Pseudomonas aeruginosa | 99.46 | |
| d2nn6e1 | 187 | Exosome complex exonuclease RRP42 {Human (Homo sap | 99.46 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 99.42 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 99.42 | |
| d1whua_ | 104 | Polynucleotide phosphorylase/guanosine pentaphosph | 99.41 | |
| d1sroa_ | 76 | S1 RNA-binding domain of polyribonucleotide phosph | 99.4 | |
| d2je6a2 | 84 | Exosome complex exonuclease 2, ECX2 {Sulfolobus so | 99.4 | |
| d2z0sa1 | 88 | S1-domain of exosome complex RNA-binding protein 1 | 99.4 | |
| d2nn6d2 | 89 | Exosome complex exonuclease RRP46 {Human (Homo sap | 99.35 | |
| d1e3ha1 | 83 | Polynucleotide phosphorylase/guanosine pentaphosph | 99.32 | |
| d1oysa2 | 86 | Ribonuclease PH, domain 2 {Bacillus subtilis [TaxI | 99.31 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 99.27 | |
| d2nn6a1 | 184 | Exosome complex exonuclease RRP45 {Human (Homo sap | 99.26 | |
| d1e3pa2 | 62 | S1 RNA-binding domain of polyribonucleotide phosph | 99.25 | |
| d2nn6h1 | 95 | S1-domain of Ribosomal RNA-processing protein 4, R | 99.23 | |
| d2je6b2 | 86 | Exosome complex exonuclease 1, ECX1 {Sulfolobus so | 99.22 | |
| d2je6a2 | 84 | Exosome complex exonuclease 2, ECX2 {Sulfolobus so | 99.2 | |
| d1udsa2 | 105 | Ribonuclease PH, domain 2 {Aquifex aeolicus [TaxId | 99.2 | |
| d2ba0a1 | 83 | S1-domain of exosome complex RNA-binding protein 1 | 99.19 | |
| d1kl9a2 | 86 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.17 | |
| d2nn6b2 | 90 | Exosome complex exonuclease RRP41 {Human (Homo sap | 99.15 | |
| d3bzka4 | 94 | Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287] | 99.11 | |
| d2je6i1 | 87 | S1-domain of exosome complex RNA-binding protein 1 | 99.09 | |
| d2ahob2 | 84 | Eukaryotic initiation factor 2alpha, eIF2alpha, N- | 99.06 | |
| d2nn6d2 | 89 | Exosome complex exonuclease RRP46 {Human (Homo sap | 99.05 | |
| d2ba0d2 | 99 | Exosome complex exonuclease 1, ECX1 {Archaeoglobus | 99.02 | |
| d2z0sa1 | 88 | S1-domain of exosome complex RNA-binding protein 1 | 99.0 | |
| d1e3ha4 | 54 | Polynucleotide phosphorylase/guanosine pentaphosph | 99.0 | |
| d1wi5a_ | 119 | S1-domain of RRP5 protein homolog (PDCD11, KIAA018 | 98.99 | |
| d2nn6c2 | 89 | Exosome complex exonuclease RRP43 {Human (Homo sap | 98.98 | |
| d2nn6e2 | 94 | Exosome complex exonuclease RRP42 {Human (Homo sap | 98.97 | |
| d2ba0g2 | 79 | Exosome complex exonuclease 2, ECX2 {Archaeoglobus | 98.97 | |
| d2nn6a2 | 118 | Exosome complex exonuclease RRP45 {Human (Homo sap | 98.95 | |
| d2ix0a3 | 87 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 98.93 | |
| d1e3pa2 | 62 | S1 RNA-binding domain of polyribonucleotide phosph | 98.9 | |
| d2nn6f2 | 95 | Exosome complex exonuclease MTR3 {Human (Homo sapi | 98.87 | |
| d1go3e1 | 106 | C-terminal domain of RNA polymerase II subunit RBP | 98.87 | |
| d2ba0g2 | 79 | Exosome complex exonuclease 2, ECX2 {Archaeoglobus | 98.86 | |
| d2nn6g1 | 88 | S1-domain of exosome component 3 (RRP40) {Human (H | 98.86 | |
| d2z0sa2 | 87 | Exosome complex RNA-binding protein 1, ECR1 {Aerop | 98.81 | |
| d2nn6f2 | 95 | Exosome complex exonuclease MTR3 {Human (Homo sapi | 98.8 | |
| d2nn6e2 | 94 | Exosome complex exonuclease RRP42 {Human (Homo sap | 98.77 | |
| d1y14b1 | 91 | C-terminal domain of RNA polymerase II subunit RBP | 98.73 | |
| d2nn6c2 | 89 | Exosome complex exonuclease RRP43 {Human (Homo sap | 98.68 | |
| d2ja9a1 | 90 | S1-domain of exosome component 3 (RRP40) {Saccharo | 98.63 | |
| d2c35b1 | 94 | C-terminal domain of RNA polymerase II subunit RBP | 98.62 | |
| d2nn6h1 | 95 | S1-domain of Ribosomal RNA-processing protein 4, R | 98.62 | |
| d2nn6a2 | 118 | Exosome complex exonuclease RRP45 {Human (Homo sap | 98.6 | |
| d2cpqa1 | 78 | Fragile X mental retardation syndrome related prot | 98.58 | |
| d2ix0a3 | 87 | Exoribonuclease 2, RNB {Escherichia coli [TaxId: 5 | 98.57 | |
| d1tuaa1 | 84 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.56 | |
| d2nn6g1 | 88 | S1-domain of exosome component 3 (RRP40) {Human (H | 98.51 | |
| d1y14b1 | 91 | C-terminal domain of RNA polymerase II subunit RBP | 98.44 | |
| d2je6i3 | 69 | Exosome complex RNA-binding protein 1, ECR1 {Sulfo | 98.41 | |
| d2ba0a3 | 84 | Exosome complex RNA-binding protein 1, ECR1 {Archa | 98.35 | |
| d2c35b1 | 94 | C-terminal domain of RNA polymerase II subunit RBP | 98.19 | |
| d1hh2p1 | 72 | S1 domain of NusA {Thermotoga maritima [TaxId: 233 | 98.11 | |
| d2ja9a1 | 90 | S1-domain of exosome component 3 (RRP40) {Saccharo | 98.07 | |
| d1hh2p1 | 72 | S1 domain of NusA {Thermotoga maritima [TaxId: 233 | 98.01 | |
| d1tuaa2 | 104 | Hypothetical protein APE0754 {Aeropyrum pernix [Ta | 98.01 | |
| d1e3ha6 | 96 | Polynucleotide phosphorylase/guanosine pentaphosph | 97.91 | |
| d2nn6i1 | 125 | Exosome component 1, EXOSC1 {Human (Homo sapiens) | 97.9 | |
| d1e3ha5 | 111 | Polynucleotide phosphorylase/guanosine pentaphosph | 97.83 | |
| d2asba1 | 76 | S1 domain of NusA {Mycobacterium tuberculosis [Tax | 97.74 | |
| d2ctka1 | 91 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 97.71 | |
| d1we8a_ | 104 | Tudor and KH domain containing protein, Tdrkh {Mou | 97.6 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 97.44 | |
| d2asba1 | 76 | S1 domain of NusA {Mycobacterium tuberculosis [Tax | 97.41 | |
| d1j4wa1 | 74 | Far upstream binding element, FBP {Human (Homo sap | 97.27 | |
| d1j4wa2 | 71 | Far upstream binding element, FBP {Human (Homo sap | 97.16 | |
| d1viga_ | 71 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 97.14 | |
| d2axya1 | 71 | Poly(RC)-binding protein 2 {Human (Homo sapiens) [ | 97.11 | |
| d1zzka1 | 75 | HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | 97.1 | |
| d2ctfa1 | 90 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 97.08 | |
| d2ctma1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 97.04 | |
| d1dtja_ | 74 | Neuro-oncological ventral antigen 2, nova-2, KH3 { | 97.02 | |
| d1wvna1 | 70 | Poly(RC)-binding protein 1 {Human (Homo sapiens) [ | 96.95 | |
| d1x4ma1 | 81 | Far upstream binding element, FBP {Mouse (Mus musc | 96.9 | |
| d2ctea1 | 81 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 96.87 | |
| d2nn6i1 | 125 | Exosome component 1, EXOSC1 {Human (Homo sapiens) | 96.86 | |
| d1x4na1 | 79 | Far upstream binding element, FBP {Mouse (Mus musc | 96.78 | |
| d2ctla1 | 84 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 96.71 | |
| d2ctja1 | 82 | Vigilin {Human (Homo sapiens) [TaxId: 9606]} | 96.62 | |
| d1k1ga_ | 122 | RNA splicing factor 1 {Human (Homo sapiens) [TaxId | 94.84 | |
| d1smxa_ | 87 | S1-domain of Ribonuclease E {Escherichia coli [Tax | 94.3 | |
| d1luza_ | 85 | Viral structural mimic of eIF2alpha {Vaccinia viru | 92.26 | |
| d1wfqa_ | 89 | Cold shock domain protein E1 (UNR) {Human (Homo sa | 88.26 | |
| d2bl5a1 | 134 | Quaking protein A (Xqua) {African clawed frog (Xen | 87.86 | |
| d1jjga_ | 102 | Viral structural mimic of eIF2alpha {Myxoma virus, | 86.72 | |
| d1c9oa_ | 66 | Major cold shock protein {Bacillus caldolyticus [T | 86.5 | |
| d1h95a_ | 79 | Y-box protein 1 cold shock domain (YB1-CSD) {Human | 83.69 | |
| d1mjca_ | 69 | Major cold shock protein {Escherichia coli [TaxId: | 82.8 | |
| d1k3ra1 | 71 | Hypothetical protein MTH1 (MT0001), insert domain | 81.57 |
| >d1e3ha2 d.14.1.4 (A:3-151) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ribosomal protein S5 domain 2-like superfamily: Ribosomal protein S5 domain 2-like family: Ribonuclease PH domain 1-like domain: Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 species: Streptomyces antibioticus [TaxId: 1890]
Probab=100.00 E-value=1.1e-38 Score=314.41 Aligned_cols=141 Identities=38% Similarity=0.672 Sum_probs=131.7
Q ss_pred eeeeeeEEECCeEEEEEeCccCcCCCcEEEEEeCCeEEEEEEEeCCC--CCCCCceeeEeeccccccccCCCCCcccccc
Q 002054 57 ETFKEEFEIGSRLITLETGKIARFANGAVVLGMDETKVLSTVTSSKG--DSVRDFLPLTVDYQEKQFAQGVIPNTYMRRE 134 (974)
Q Consensus 57 ~~~~~~~~~~~r~i~~etg~~a~~A~GSa~v~~G~T~Vl~tv~~~~~--~~~~~f~pL~v~y~e~~~a~g~ip~~~~~Re 134 (974)
+......++|+|+|++|||++|+||||||++++|+|+|||+|+.+.+ +...+|+|++++|+|++|++|++|++|.|||
T Consensus 7 ~~~~~~~~~~~R~i~ie~G~lakqA~GSalv~~G~T~vl~ta~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~rre 86 (149)
T d1e3ha2 7 EAVIDNGAFGTRTIRFETGRLARQAAGSAVAYLDDDTMVLSATTASKNPKDQLDFFPLTVDVEERMYAAGKIPGSFFRRE 86 (149)
T ss_dssp EEEEECGGGCEEEEEEEESSSCTTSSEEEEEEETTTEEEEEEEEECSSCCTTCSSCCEEEEEEECGGGGTCCCCSTTSSC
T ss_pred EEEEeCCcCCCcEEEEEeCcccccCCceEEEEECCcEEEEEeeecccccccccccCCceeEEEEeccccccccccccccc
Confidence 33333334688999999999999999999999999999999998766 4467899999999999999999999999999
Q ss_pred CCCCchhhhHHHhhcCCccccccCCCCCceEEEEEEEeccCCCChhhHHHHHHHHHhhcCCCC
Q 002054 135 GAPKERELLVGRIIDRPIRPLFPAGFYHEVQVMASVLSSDGKQDPDIMAANATSAALMLSDIP 197 (974)
Q Consensus 135 g~p~~~eil~~RlidR~lrplfp~~~~~~~~i~~~vl~~dg~~~~~~~ai~aAs~AL~~s~iP 197 (974)
|+|+++|+|++|||||+|||+||++|++++||+|+|+++|++++++++||||||+||++||||
T Consensus 87 ~~~~~reil~~rlidR~Lrpl~p~~~~~~~qI~~~vl~~d~d~~~~~aai~aAs~AL~~agIP 149 (149)
T d1e3ha2 87 GRPSEDAILTCRLIDRPLRPSFKKGLRNEIQVVATIMALNPDHLYDVVAINAASASTQLAGLP 149 (149)
T ss_dssp CSCCHHHHHHHHHHHHHHHHHBCTTBCSCEEEEEEEEECCTTSCCHHHHHHHHHHHHHHTTCS
T ss_pred cccchHHHHHHHHHHHHHHhhccccCCCceEEEEEEEEeCCCCChHHHHHHHHHHHHHhcCCC
Confidence 999999999999999999999999999999999999999999999999999999999999999
|
| >d2nn6b1 d.14.1.4 (B:6-150) Exosome complex exonuclease RRP41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je6b1 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ba0d1 d.14.1.4 (D:10-153) Exosome complex exonuclease 1, ECX1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ba0g1 d.14.1.4 (G:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1e3ha3 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1udsa1 d.14.1.4 (A:2-150) Ribonuclease PH, domain 1 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r6la1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2je6a1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1oysa1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2nn6e1 d.14.1.4 (E:5-191) Exosome complex exonuclease RRP42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6c1 d.14.1.4 (C:7-187) Exosome complex exonuclease RRP43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ha6 d.101.1.1 (A:483-578) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1e3ha2 d.14.1.4 (A:3-151) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2nn6a1 d.14.1.4 (A:1-184) Exosome complex exonuclease RRP45 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6f1 d.14.1.4 (F:29-175) Exosome complex exonuclease MTR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6d1 d.14.1.4 (D:25-146) Exosome complex exonuclease RRP46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ha3 d.14.1.4 (A:346-482) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 1 and 4 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1e3ha5 d.101.1.1 (A:152-262) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1r6la2 d.101.1.1 (A:152-239) Ribonuclease PH, domain 2 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2nn6d1 d.14.1.4 (D:25-146) Exosome complex exonuclease RRP46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je6b1 d.14.1.4 (B:8-155) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ba0d1 d.14.1.4 (D:10-153) Exosome complex exonuclease 1, ECX1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2nn6b1 d.14.1.4 (B:6-150) Exosome complex exonuclease RRP41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1udsa1 d.14.1.4 (A:2-150) Ribonuclease PH, domain 1 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1r6la1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1udsa2 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1oysa2 d.101.1.1 (A:152-237) Ribonuclease PH, domain 2 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2nn6f1 d.14.1.4 (F:29-175) Exosome complex exonuclease MTR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oysa1 d.14.1.4 (A:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2je6b2 d.101.1.1 (B:156-241) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2je6a1 d.14.1.4 (A:1-191) Exosome complex exonuclease 2,ECX2 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2nn6b2 d.101.1.1 (B:151-240) Exosome complex exonuclease RRP41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0g1 d.14.1.4 (G:3-178) Exosome complex exonuclease 2,ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2nn6c1 d.14.1.4 (C:7-187) Exosome complex exonuclease RRP43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0d2 d.101.1.1 (D:154-252) Exosome complex exonuclease 1, ECX1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1r6la2 d.101.1.1 (A:152-239) Ribonuclease PH, domain 2 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2nn6e1 d.14.1.4 (E:5-191) Exosome complex exonuclease RRP42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1whua_ a.4.9.1 (A:) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2je6a2 d.101.1.1 (A:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2nn6d2 d.101.1.1 (D:147-235) Exosome complex exonuclease RRP46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ha1 a.4.9.1 (A:263-345) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1oysa2 d.101.1.1 (A:152-237) Ribonuclease PH, domain 2 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6a1 d.14.1.4 (A:1-184) Exosome complex exonuclease RRP45 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je6b2 d.101.1.1 (B:156-241) Exosome complex exonuclease 1, ECX1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2je6a2 d.101.1.1 (A:192-275) Exosome complex exonuclease 2, ECX2 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1udsa2 d.101.1.1 (A:151-255) Ribonuclease PH, domain 2 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2ba0a1 b.40.4.5 (A:53-135) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1kl9a2 b.40.4.5 (A:3-88) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6b2 d.101.1.1 (B:151-240) Exosome complex exonuclease RRP41 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bzka4 b.40.4.5 (A:637-730) Tex S1-domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2je6i1 b.40.4.5 (I:66-152) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ahob2 b.40.4.5 (B:1-84) Eukaryotic initiation factor 2alpha, eIF2alpha, N-terminal domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2nn6d2 d.101.1.1 (D:147-235) Exosome complex exonuclease RRP46 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0d2 d.101.1.1 (D:154-252) Exosome complex exonuclease 1, ECX1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2z0sa1 b.40.4.5 (A:60-147) S1-domain of exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d1wi5a_ b.40.4.5 (A:) S1-domain of RRP5 protein homolog (PDCD11, KIAA0185) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6c2 d.101.1.1 (C:188-276) Exosome complex exonuclease RRP43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6e2 d.101.1.1 (E:192-285) Exosome complex exonuclease RRP42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ba0g2 d.101.1.1 (G:179-257) Exosome complex exonuclease 2, ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2nn6a2 d.101.1.1 (A:185-302) Exosome complex exonuclease RRP45 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e3pa2 b.40.4.5 (A:656-717) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2nn6f2 d.101.1.1 (F:176-270) Exosome complex exonuclease MTR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1go3e1 b.40.4.5 (E:79-184) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2ba0g2 d.101.1.1 (G:179-257) Exosome complex exonuclease 2, ECX2 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2nn6f2 d.101.1.1 (F:176-270) Exosome complex exonuclease MTR3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6e2 d.101.1.1 (E:192-285) Exosome complex exonuclease RRP42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2nn6c2 d.101.1.1 (C:188-276) Exosome complex exonuclease RRP43 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6h1 b.40.4.5 (H:73-167) S1-domain of Ribosomal RNA-processing protein 4, RRP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6a2 d.101.1.1 (A:185-302) Exosome complex exonuclease RRP45 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ix0a3 b.40.4.5 (A:558-644) Exoribonuclease 2, RNB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2nn6g1 b.40.4.5 (G:107-194) S1-domain of exosome component 3 (RRP40) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y14b1 b.40.4.5 (B:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2c35b1 b.40.4.5 (B:78-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ja9a1 b.40.4.5 (A:62-151) S1-domain of exosome component 3 (RRP40) {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hh2p1 b.40.4.5 (P:127-198) S1 domain of NusA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1e3ha6 d.101.1.1 (A:483-578) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e3ha5 d.101.1.1 (A:152-262) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus [TaxId: 1890]} | Back information, alignment and structure |
|---|
| >d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2asba1 b.40.4.5 (A:108-183) S1 domain of NusA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nn6i1 b.40.4.5 (I:61-185) Exosome component 1, EXOSC1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1smxa_ b.40.4.5 (A:) S1-domain of Ribonuclease E {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1luza_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Vaccinia virus [TaxId: 10245]} | Back information, alignment and structure |
|---|
| >d1wfqa_ b.40.4.5 (A:) Cold shock domain protein E1 (UNR) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1jjga_ b.40.4.5 (A:) Viral structural mimic of eIF2alpha {Myxoma virus, m156r [TaxId: 10273]} | Back information, alignment and structure |
|---|
| >d1c9oa_ b.40.4.5 (A:) Major cold shock protein {Bacillus caldolyticus [TaxId: 1394]} | Back information, alignment and structure |
|---|
| >d1h95a_ b.40.4.5 (A:) Y-box protein 1 cold shock domain (YB1-CSD) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1k3ra1 b.40.4.10 (A:93-163) Hypothetical protein MTH1 (MT0001), insert domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|