Citrus Sinensis ID: 002345
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 933 | 2.2.26 [Sep-21-2011] | |||||||
| Q9C5Q8 | 942 | Small RNA 2'-O-methyltran | yes | no | 0.946 | 0.937 | 0.502 | 0.0 | |
| Q5T8I9 | 393 | Small RNA 2'-O-methyltran | yes | no | 0.242 | 0.575 | 0.332 | 1e-33 | |
| Q32PY6 | 394 | Small RNA 2'-O-methyltran | yes | no | 0.241 | 0.571 | 0.334 | 1e-33 | |
| C0IN03 | 369 | Small RNA 2'-O-methyltran | yes | no | 0.247 | 0.626 | 0.334 | 5e-33 | |
| Q8CAE2 | 395 | Small RNA 2'-O-methyltran | yes | no | 0.214 | 0.506 | 0.353 | 5e-33 | |
| E1BVR9 | 376 | Small RNA 2'-O-methyltran | yes | no | 0.244 | 0.606 | 0.314 | 6e-33 | |
| Q4R3W5 | 393 | Small RNA 2'-O-methyltran | N/A | no | 0.242 | 0.575 | 0.32 | 1e-32 | |
| Q568P9 | 402 | Small RNA 2'-O-methyltran | yes | no | 0.224 | 0.519 | 0.354 | 3e-28 | |
| Q9UST9 | 378 | Small RNA 2'-O-methyltran | yes | no | 0.248 | 0.613 | 0.293 | 5e-19 | |
| P34283 | 450 | Uncharacterized protein C | yes | no | 0.232 | 0.482 | 0.303 | 5e-16 |
| >sp|Q9C5Q8|HEN1_ARATH Small RNA 2'-O-methyltransferase OS=Arabidopsis thaliana GN=HEN1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 855 bits (2209), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 475/945 (50%), Positives = 620/945 (65%), Gaps = 62/945 (6%)
Query: 17 TPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVSETFKK 76
TPKAII QKFG A +TV+EV D Q+GC GLAIPQKGPCLYRC LQLPEFSVVS FKK
Sbjct: 10 TPKAIIHQKFGAKASYTVEEVHDSSQSGCLGLAIPQKGPCLYRCHLQLPEFSVVSNVFKK 69
Query: 77 KKDAEQSAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAA 136
KKD+EQSAAE AL+KLGI P + + +EA D+++ +K++FS+EFLS++ PL H AA
Sbjct: 70 KKDSEQSAAELALDKLGIRPQNDDLTVDEARDEIVGRIKYIFSDEFLSAEHPLGAHLRAA 129
Query: 137 LRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTSE 196
LRRDG+ GSVP SVIA D+K+ + CK+INP VES L ++Y+M+AA +L++++V S
Sbjct: 130 LRRDGERCGSVPVSVIATVDAKINSRCKIINPSVESDPFLAISYVMKAAAKLADYIVASP 189
Query: 197 GQLSIWRKDPYPPEIKESSIIQQSESPDSICIEAIHIPSSLEMAVHPVTLNVSSTGYYLD 256
L RK+ YP EI E+ S+S S + A++IP E V TL +SS +YLD
Sbjct: 190 HGLR--RKNAYPSEIVEALATHVSDSLHSREVAAVYIPCIDEEVVELDTLYISSNRHYLD 247
Query: 257 VIARNLDQTDGNKILVSRTIGKAS--SEMRLYFAAPKSYLLDLSSDLPNV--EEVVDFEG 312
IA L DGN++++SR GKAS SE RLY PK Y LD SSD E+
Sbjct: 248 SIAERLGLKDGNQVMISRMFGKASCGSECRLYSEIPKKY-LDNSSDASGTSNEDSSHIVK 306
Query: 313 SLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSRE 372
S N RASY+ GQDI+GDAILAS+GY KS+ L ++D+T+ S+YR+ ++P+G+YK+SR+
Sbjct: 307 SRNARASYICGQDIHGDAILASVGYRWKSDDLDYDDVTVNSFYRICCGMSPNGIYKISRQ 366
Query: 373 AILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTCSNSLKESSESSRFYEK- 431
A++ A+LP AFTT++NWRG PRE+L +FC QH L+EP+ S+ + +K S+ R ++K
Sbjct: 367 AVIAAQLPFAFTTKSNWRGPLPREILGLFCHQHRLAEPILSSSTAPVKSLSDIFRSHKKL 426
Query: 432 -----SAALESAETGKECTSGGGTAASDNVRCEVKIFSKSRDPILECSPKEFYKKQNESI 486
A E+ KE T G G RCEVKIF+KS+D +LECSP++FY+K+N++I
Sbjct: 427 KVSGVDDANENLSRQKEDTPGLGHG----FRCEVKIFTKSQDLVLECSPRKFYEKENDAI 482
Query: 487 ENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKM- 545
+NASLK L W + +F D D+ E+ + D + N F + H+ + +
Sbjct: 483 QNASLKALLWFSKFFADLDVDGEQSCDTDDDQDTKSSSPNVFAAPPILQKEHSSESKNTN 542
Query: 546 ---GEKLLQANSINTLNAIPEHGIYCLSIG-GPD---SGIYPSNGCLSFISYSVSLVIEG 598
EK +Q+ + ++ +I Y LS+ P+ G P S
Sbjct: 543 VLSAEKRVQSITNGSVVSI----CYSLSLAVDPEYSSDGESPREDNESNEEMESEYSANC 598
Query: 599 ETMKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELPP---QELILAAADD 655
E+ EL+ES EE EFE+GTG++ P +E QM+VG+ A F + PP + LILA D
Sbjct: 599 ESSVELIESNEEIEFEVGTGSMNPHIESEVTQMTVGEYASF-RMTPPDAAEALILAVGSD 657
Query: 656 SARTFSLLS-----------------SKDRMEQALFSPPLSKQRVEYALQHIKESCATTL 698
+ R SLLS S++RME A F PPLSKQRVEYAL+HI+ES A+TL
Sbjct: 658 TVRIRSLLSERPCLNYNILLLGVKGPSEERMEAAFFKPPLSKQRVEYALKHIRESSASTL 717
Query: 699 VDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDVKS 758
VDFGCGSGSLLDSLLDYPT+L+ I+GVDIS K L+RAAK++H KL+K+ +VKS
Sbjct: 718 VDFGCGSGSLLDSLLDYPTSLQTIIGVDISPKGLARAAKMLHVKLNKE------ACNVKS 771
Query: 759 AVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYEY 818
A L+DGSI FDSRLH DIGTCLEVIEHMEED+A +FG VLS F P++LIVSTPNYE+
Sbjct: 772 ATLYDGSILEFDSRLHDVDIGTCLEVIEHMEEDQACEFGEKVLSLFHPKLLIVSTPNYEF 831
Query: 819 NAILQKSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFSG 878
N ILQ+S+ QE++ E Q KFRNHDHKFEWTR+QFN WA++L RHNYSVEFSG
Sbjct: 832 NTILQRSTPETQEENNSEP---QLPKFRNHDHKFEWTREQFNQWASKLGKRHNYSVEFSG 888
Query: 879 VGGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIWEW 923
VGGSG+ EPGFASQIA+FR E+ S YKVIWEW
Sbjct: 889 VGGSGEVEPGFASQIAIFRREASSVEN---VAESSMQPYKVIWEW 930
|
Methyltransferase that adds a methyl group to the ribose of the last nucleotide of small RNAs (sRNAs). This protects the 3'-end of sRNAs from uridylation activity and subsequent degradation. Can methylates 3'-end of microRNAs (miRNAs), small interfering RNAs (siRNas) and trans-acting small interfering RNAs (ta-siRNAs). Involved in plant development through its role in small RNAs processing. Required for the specification of reproductive organ identities and the probable repression of A class genes. May control floral determinacy possibly by regulating the expression of the C class floral homeotic gene AGAMOUS (AG). Arabidopsis thaliana (taxid: 3702) EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: nEC: 8 |
| >sp|Q5T8I9|HENMT_HUMAN Small RNA 2'-O-methyltransferase OS=Homo sapiens GN=HENMT1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q32PY6|HENMT_RAT Small RNA 2'-O-methyltransferase OS=Rattus norvegicus GN=Henmt1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|C0IN03|HENMT_XENTR Small RNA 2'-O-methyltransferase OS=Xenopus tropicalis GN=henmt1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8CAE2|HENMT_MOUSE Small RNA 2'-O-methyltransferase OS=Mus musculus GN=Henmt1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|E1BVR9|HENMT_CHICK Small RNA 2'-O-methyltransferase OS=Gallus gallus GN=HENMT1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q4R3W5|HENMT_MACFA Small RNA 2'-O-methyltransferase OS=Macaca fascicularis GN=HENMT1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q568P9|HENMT_DANRE Small RNA 2'-O-methyltransferase OS=Danio rerio GN=henmt1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9UST9|HENMT_SCHPO Small RNA 2'-O-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC336.05c PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P34283|YKK6_CAEEL Uncharacterized protein C02F5.6 OS=Caenorhabditis elegans GN=C02F5.6 PE=4 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 933 | ||||||
| 359483694 | 948 | PREDICTED: small RNA 2'-O-methyltransfer | 0.980 | 0.965 | 0.626 | 0.0 | |
| 297740849 | 931 | unnamed protein product [Vitis vinifera] | 0.954 | 0.957 | 0.621 | 0.0 | |
| 255564369 | 970 | conserved hypothetical protein [Ricinus | 0.978 | 0.941 | 0.598 | 0.0 | |
| 224122146 | 916 | hypothetical protein POPTRDRAFT_270173 [ | 0.951 | 0.969 | 0.589 | 0.0 | |
| 224061609 | 926 | hypothetical protein POPTRDRAFT_177484 [ | 0.951 | 0.958 | 0.580 | 0.0 | |
| 356510770 | 945 | PREDICTED: small RNA 2'-O-methyltransfer | 0.971 | 0.958 | 0.561 | 0.0 | |
| 449435894 | 948 | PREDICTED: small RNA 2'-O-methyltransfer | 0.982 | 0.967 | 0.556 | 0.0 | |
| 356528106 | 945 | PREDICTED: small RNA 2'-O-methyltransfer | 0.969 | 0.957 | 0.558 | 0.0 | |
| 15638615 | 942 | HEN1 [Arabidopsis thaliana] | 0.946 | 0.937 | 0.503 | 0.0 | |
| 260099980 | 950 | Chain A, Crystal Structure Of Small Rna | 0.946 | 0.929 | 0.503 | 0.0 |
| >gi|359483694|ref|XP_002264328.2| PREDICTED: small RNA 2'-O-methyltransferase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1152 bits (2979), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 595/949 (62%), Positives = 707/949 (74%), Gaps = 34/949 (3%)
Query: 4 GGLSVVAVRKMKLTPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQ 63
GG V +K TPKAII QKFG A + V+EVQ QNGCPGLAIPQKGPCL+RCSLQ
Sbjct: 2 GGAPPVVAKKTTHTPKAIIHQKFGDKACYKVEEVQGDTQNGCPGLAIPQKGPCLFRCSLQ 61
Query: 64 LPEFSVVSETFKKKKDAEQSAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFL 123
LPEFSVVSE FK+KKDAEQSAAEKAL KLG+DP+ + E WD+LI+ + +LF++EFL
Sbjct: 62 LPEFSVVSEYFKRKKDAEQSAAEKALRKLGVDPAASNSIVREPWDELISRLSYLFADEFL 121
Query: 124 SSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMR 183
SS PL GHF AAL+RDGDLYG +P SV AVCD+KL N+CK INP VES+ LV+ +++
Sbjct: 122 SSLHPLSGHFRAALQRDGDLYGLIPVSVFAVCDTKLGNICKSINPGVESNPFLVIPLVLK 181
Query: 184 AATRLSEFVVTSEGQLSIWRKDPYPPEIKESSIIQQSESPDSICIEAIHIPSSLEMAVHP 243
AA S TSEGQL + R++PYPPEI +SSI Q SP+SI IEA++IP SLE V
Sbjct: 182 AAASGS--FATSEGQLWMRRQNPYPPEIIQSSISSQLSSPESIWIEAVYIPYSLEKNVES 239
Query: 244 VTLNVSSTGYYLDVIARNLDQTDGNKILVSRTIGKASSEMRLYFAAPKSYLLDLSSDLPN 303
+TLNVSSTGYYLD IAR L D +KILVSRT+GKASSEMRLYF+AP+ YL+DL SDL N
Sbjct: 240 LTLNVSSTGYYLDAIARKLSLADTSKILVSRTVGKASSEMRLYFSAPEWYLVDLLSDL-N 298
Query: 304 VEEVVDFEGSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTP 363
VEEV EGS N RASY G IYG+AILASIGYT +S LFHED++LQSYYR+LI P
Sbjct: 299 VEEVNSEEGSFNARASYFSGHAIYGNAILASIGYTWRSMDLFHEDVSLQSYYRLLISKIP 358
Query: 364 SGVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTCSNSLKESS 423
SGVYKLSREAILTAELPMAFTTR NW+GSFPR++L FCRQH LSEPVFS S LK+SS
Sbjct: 359 SGVYKLSREAILTAELPMAFTTRANWKGSFPRDLLCSFCRQHRLSEPVFSMLSTPLKQSS 418
Query: 424 ESSRFYEKSAALESAETGKECTSGGGTAA--------SDNVRCEVKIFSKSRDPILECSP 475
E S ++ ES+ E +G G D CE+KI+SK +D I+E SP
Sbjct: 419 EVSGSCKRLKVAESSAEETEYRNGAGVVPHGNESVGLGDTFMCEIKIYSKLQDLIIEYSP 478
Query: 476 KEFYKKQNESIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYR 535
K+ Y+K +++++N+SL+VL LN YFK+ D+PLEKL A DI YP+ F K F+S
Sbjct: 479 KDSYRKHSDALQNSSLRVLLCLNTYFKELDMPLEKL---ASAADIHIYPEKFAKTFASCP 535
Query: 536 FIHNVQQRK--MGEKLLQANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVS 593
IHN++QR E+LL +NSIN +P H +Y +I GPDSG PSNG L+ I+Y
Sbjct: 536 SIHNLRQRNETQRERLLDSNSINQPYIMPGHELYSFNIKGPDSGTSPSNGSLACINYVAF 595
Query: 594 LVIEGETMKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELPPQELILAAA 653
LV EGE MKE +ES +EFEFE+G GAVIP +EVV QMSVGQSACF +LPPQELILAA
Sbjct: 596 LVAEGEHMKERVESNDEFEFEIGVGAVIPHLEVVVTQMSVGQSACFNMDLPPQELILAAT 655
Query: 654 DDSARTFSLLSSK------------------DRMEQALFSPPLSKQRVEYALQHIKESCA 695
D +T SLLSSK DRMEQALFSPPLSKQRV +ALQHIKES A
Sbjct: 656 GDPVKTISLLSSKVCFLEYSIVLLRVTEPLEDRMEQALFSPPLSKQRVGFALQHIKESSA 715
Query: 696 TTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTD 755
TL+DFGCGSGSLLDSLLD+PT+LEKIVGVDIS+KSLSRAAK++HSKLS+ DA P
Sbjct: 716 ATLIDFGCGSGSLLDSLLDFPTSLEKIVGVDISKKSLSRAAKLLHSKLSRNSDAGEPSGG 775
Query: 756 VKSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPN 815
+KSA+L++GSIT FD RL+GFDIGTCLEVIEHMEED+A FG++VLS F P++LIVSTPN
Sbjct: 776 IKSAILYEGSITFFDPRLYGFDIGTCLEVIEHMEEDQACLFGDVVLSYFCPKVLIVSTPN 835
Query: 816 YEYNAILQKSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVE 875
YEYNAILQ+S+ + QE+DPDE +Q Q+C+FRNHDHKFEWTR QFN WA+ LA +HNYSVE
Sbjct: 836 YEYNAILQRSNPSNQEEDPDETSQSQACRFRNHDHKFEWTRKQFNHWASNLARKHNYSVE 895
Query: 876 FSGVGGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIWEWD 924
FSGVGGS D EPGFAS +AVFR P E D+ D Y+V+WEWD
Sbjct: 896 FSGVGGSADVEPGFASHMAVFRRSVPLETDNHPNPVDLIRQYEVVWEWD 944
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297740849|emb|CBI31031.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255564369|ref|XP_002523181.1| conserved hypothetical protein [Ricinus communis] gi|223537588|gb|EEF39212.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224122146|ref|XP_002330552.1| hypothetical protein POPTRDRAFT_270173 [Populus trichocarpa] gi|222872110|gb|EEF09241.1| hypothetical protein POPTRDRAFT_270173 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224061609|ref|XP_002300565.1| hypothetical protein POPTRDRAFT_177484 [Populus trichocarpa] gi|222847823|gb|EEE85370.1| hypothetical protein POPTRDRAFT_177484 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356510770|ref|XP_003524107.1| PREDICTED: small RNA 2'-O-methyltransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449435894|ref|XP_004135729.1| PREDICTED: small RNA 2'-O-methyltransferase-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356528106|ref|XP_003532646.1| PREDICTED: small RNA 2'-O-methyltransferase-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15638615|gb|AAL05056.1|AF411383_1 HEN1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|260099980|pdb|3HTX|A Chain A, Crystal Structure Of Small Rna Methyltransferase Hen1 gi|260099983|pdb|3HTX|D Chain D, Crystal Structure Of Small Rna Methyltransferase Hen1 | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 933 | ||||||
| TAIR|locus:2133114 | 942 | HEN1 "HUA ENHANCER 1" [Arabido | 0.683 | 0.677 | 0.426 | 1.2e-210 | |
| TAIR|locus:2133124 | 743 | AT4G20920 [Arabidopsis thalian | 0.498 | 0.625 | 0.427 | 5.7e-121 | |
| ZFIN|ZDB-GENE-050417-387 | 402 | henmt1 "HEN1 methyltransferase | 0.156 | 0.363 | 0.295 | 1.7e-23 | |
| RGD|1306230 | 394 | Henmt1 "HEN1 methyltransferase | 0.243 | 0.576 | 0.269 | 7.2e-16 | |
| MGI|MGI:1913965 | 395 | Henmt1 "HEN1 methyltransferase | 0.243 | 0.574 | 0.265 | 4.6e-15 | |
| POMBASE|SPBC336.05c | 378 | SPBC336.05c "small RNA 2'-O-me | 0.200 | 0.494 | 0.312 | 1.4e-14 | |
| UNIPROTKB|C0IN03 | 369 | henmt1 "Small RNA 2'-O-methylt | 0.249 | 0.631 | 0.253 | 3.6e-14 | |
| UNIPROTKB|E1BVR9 | 376 | HENMT1 "Small RNA 2'-O-methylt | 0.246 | 0.611 | 0.244 | 1.9e-13 | |
| UNIPROTKB|J9NUC0 | 387 | HENMT1 "Uncharacterized protei | 0.217 | 0.524 | 0.296 | 4.5e-13 | |
| UNIPROTKB|H9GWJ3 | 389 | HENMT1 "Uncharacterized protei | 0.217 | 0.521 | 0.296 | 4.6e-13 |
| TAIR|locus:2133114 HEN1 "HUA ENHANCER 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1240 (441.6 bits), Expect = 1.2e-210, Sum P(2) = 1.2e-210
Identities = 286/671 (42%), Positives = 395/671 (58%)
Query: 17 TPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVSETFKK 76
TPKAII QKFG A +TV+EV D Q+GC GLAIPQKGPCLYRC LQLPEFSVVS FKK
Sbjct: 10 TPKAIIHQKFGAKASYTVEEVHDSSQSGCLGLAIPQKGPCLYRCHLQLPEFSVVSNVFKK 69
Query: 77 KKDAEQSAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAA 136
KKD+EQSAAE AL+KLGI P + + +EA D+++ +K++FS+EFLS++ PL H AA
Sbjct: 70 KKDSEQSAAELALDKLGIRPQNDDLTVDEARDEIVGRIKYIFSDEFLSAEHPLGAHLRAA 129
Query: 137 LRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTSE 196
LRRDG+ GSVP SVIA D+K+ + CK+INP VES L ++Y+M+AA +L++++V S
Sbjct: 130 LRRDGERCGSVPVSVIATVDAKINSRCKIINPSVESDPFLAISYVMKAAAKLADYIVASP 189
Query: 197 GQLSIWRKDPYPXXXXXXXXXXXXXXXXXXCIEAIHIPSSLEMAVHPVTLNVSSTGYYLD 256
L RK+ YP + A++IP E V TL +SS +YLD
Sbjct: 190 HGLR--RKNAYPSEIVEALATHVSDSLHSREVAAVYIPCIDEEVVELDTLYISSNRHYLD 247
Query: 257 VIARNLDQTDGNKILVSRTIGKAS--SEMRLYFAAPKSYLLDLSSDLPNV--EEVVDFEG 312
IA L DGN++++SR GKAS SE RLY PK YL D SSD E+
Sbjct: 248 SIAERLGLKDGNQVMISRMFGKASCGSECRLYSEIPKKYL-DNSSDASGTSNEDSSHIVK 306
Query: 313 SLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSRE 372
S N RASY+ GQDI+GDAILAS+GY KS+ L ++D+T+ S+YR+ ++P+G+YK+SR+
Sbjct: 307 SRNARASYICGQDIHGDAILASVGYRWKSDDLDYDDVTVNSFYRICCGMSPNGIYKISRQ 366
Query: 373 AILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFXXXXXXXXXXXXXXRFYEK- 431
A++ A+LP AFTT++NWRG PRE+L +FC QH L+EP+ R ++K
Sbjct: 367 AVIAAQLPFAFTTKSNWRGPLPREILGLFCHQHRLAEPILSSSTAPVKSLSDIFRSHKKL 426
Query: 432 -----SAALESAETGKECTSGGGTAASDNVRCEVKIFSKSRDPILECSPKEFYKKQNESI 486
A E+ KE T G G RCEVKIF+KS+D +LECSP++FY+K+N++I
Sbjct: 427 KVSGVDDANENLSRQKEDTPGLG----HGFRCEVKIFTKSQDLVLECSPRKFYEKENDAI 482
Query: 487 ENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKMG 546
+NASLK L W + +F D D+ E+ + D + N F + H+ + +
Sbjct: 483 QNASLKALLWFSKFFADLDVDGEQSCDTDDDQDTKSSSPNVFAAPPILQKEHSSESKNTN 542
Query: 547 ----EKLLQANSINTLNAIPEHGIYCLSIG-GPD---SGIYPSNGCLSFISYSVSLVIEG 598
EK +Q+ + ++ +I Y LS+ P+ G P S
Sbjct: 543 VLSAEKRVQSITNGSVVSI----CYSLSLAVDPEYSSDGESPREDNESNEEMESEYSANC 598
Query: 599 ETMKXXXXXXXXXXXXMGTGAVIPQVEVVTAQMSVGQSACFCKELPP---QELILAAADD 655
E+ +GTG++ P +E QM+VG+ A F + PP + LILA D
Sbjct: 599 ESSVELIESNEEIEFEVGTGSMNPHIESEVTQMTVGEYASF-RMTPPDAAEALILAVGSD 657
Query: 656 SARTFSLLSSK 666
+ R SLLS +
Sbjct: 658 TVRIRSLLSER 668
|
|
| TAIR|locus:2133124 AT4G20920 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050417-387 henmt1 "HEN1 methyltransferase homolog 1 (Arabidopsis)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1306230 Henmt1 "HEN1 methyltransferase homolog 1 (Arabidopsis)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913965 Henmt1 "HEN1 methyltransferase homolog 1 (Arabidopsis)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC336.05c SPBC336.05c "small RNA 2'-O-methyltransferase activity (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C0IN03 henmt1 "Small RNA 2'-O-methyltransferase" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BVR9 HENMT1 "Small RNA 2'-O-methyltransferase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NUC0 HENMT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H9GWJ3 HENMT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9C5Q8 | HEN1_ARATH | 2, ., 1, ., 1, ., n, 8 | 0.5026 | 0.9464 | 0.9373 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | GSVIVG00029765001 | SubName- Full=Chromosome chr10 scaffold_50, whole genome shotgun sequence; (964 aa) | ||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 933 | |||
| TIGR04074 | 462 | TIGR04074, bacter_Hen1, 3' terminal RNA ribose 2'- | 5e-47 | |
| pfam08242 | 98 | pfam08242, Methyltransf_12, Methyltransferase doma | 1e-07 | |
| TIGR01983 | 224 | TIGR01983, UbiG, ubiquinone biosynthesis O-methylt | 1e-06 | |
| pfam12847 | 104 | pfam12847, Methyltransf_18, Methyltransferase doma | 3e-06 | |
| pfam00035 | 66 | pfam00035, dsrm, Double-stranded RNA binding motif | 4e-05 | |
| COG2227 | 243 | COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-m | 5e-05 | |
| pfam08241 | 92 | pfam08241, Methyltransf_11, Methyltransferase doma | 5e-05 | |
| PRK05134 | 233 | PRK05134, PRK05134, bifunctional 3-demethylubiquin | 8e-05 | |
| pfam13489 | 154 | pfam13489, Methyltransf_23, Methyltransferase doma | 3e-04 | |
| cd00048 | 68 | cd00048, DSRM, Double-stranded RNA binding motif | 4e-04 | |
| pfam13847 | 151 | pfam13847, Methyltransf_31, Methyltransferase doma | 0.001 | |
| smart00358 | 67 | smart00358, DSRM, Double-stranded RNA binding moti | 0.001 | |
| PRK09328 | 275 | PRK09328, PRK09328, N5-glutamine S-adenosyl-L-meth | 0.002 | |
| TIGR03534 | 251 | TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) met | 0.002 |
| >gnl|CDD|234456 TIGR04074, bacter_Hen1, 3' terminal RNA ribose 2'-O-methyltransferase Hen1 | Back alignment and domain information |
|---|
Score = 174 bits (444), Expect = 5e-47
Identities = 84/222 (37%), Positives = 117/222 (52%), Gaps = 24/222 (10%)
Query: 676 PPLSKQRVEYALQHIKESCATTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRA 735
P L++QR+E + ++ES A +++D GCG G LL LL E+I GVD+S + L A
Sbjct: 264 PSLNRQRLEAVVAALRESGARSVLDLGCGEGKLLRLLLAEK-QFERIAGVDVSARELEIA 322
Query: 736 AKIIHSKLSKKLDAAVPCTDVKSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQ 795
A+ +L KLD P + LF GS+T D RL GFD +EVIEH++
Sbjct: 323 AR----RL--KLDRM-PERQRERIQLFQGSLTYRDKRLKGFDAAVLVEVIEHLDPPRLPA 375
Query: 796 FGNIVLSSFRPRILIVSTPNYEYNAILQKSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWT 855
+V RP +IV+TPN EYN + + L + R+ DH+FEWT
Sbjct: 376 LERVVFEFARPGTVIVTTPNAEYNVLFE---------------SLPAGGLRHRDHRFEWT 420
Query: 856 RDQFNCWATELAARHNYSVEFSGVGGSGDREPGFASQIAVFR 897
R +F WA +A R Y+VEF + G D E G +Q+AVF
Sbjct: 421 RAEFAAWAEGVAERFGYTVEFLPI-GDEDPEVGAPTQMAVFT 461
|
Members of this protein family are bacterial Hen1, a 3' terminal RNA ribose 2'-O-methyltransferase that acts in bacterial RNA repair. All members of the seed alignment belong to a cassette with the RNA repair enzyme polynucleotide kinase-phosphatase (Pnkp). Chemically similar Hen1 in eukaryotes acts instead on small regulatory RNAs [Transcription, RNA processing, Protein synthesis, tRNA and rRNA base modification]. Length = 462 |
| >gnl|CDD|219760 pfam08242, Methyltransf_12, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|233668 TIGR01983, UbiG, ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|215670 pfam00035, dsrm, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|225137 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|235350 PRK05134, PRK05134, bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222171 pfam13489, Methyltransf_23, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|238007 cd00048, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|214634 smart00358, DSRM, Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|236467 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234248 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 933 | |||
| KOG1045 | 404 | consensus Uncharacterized conserved protein HEN1/C | 100.0 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 99.74 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 99.71 | |
| KOG1270 | 282 | consensus Methyltransferases [Coenzyme transport a | 99.61 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 99.6 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 99.58 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 99.58 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 99.57 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 99.56 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 99.53 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 99.53 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 99.52 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 99.51 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 99.51 | |
| KOG1045 | 404 | consensus Uncharacterized conserved protein HEN1/C | 99.5 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 99.5 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 99.49 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 99.49 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 99.48 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 99.48 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 99.46 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 99.46 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 99.44 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 99.43 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 99.42 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 99.42 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 99.41 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 99.41 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 99.41 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 99.4 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 99.4 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 99.4 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 99.39 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 99.39 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 99.38 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 99.38 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 99.38 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 99.37 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 99.37 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 99.35 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 99.34 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 99.33 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 99.33 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 99.3 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 99.28 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 99.28 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 99.28 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 99.27 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 99.27 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 99.27 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 99.26 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 99.24 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 99.23 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 99.22 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 99.21 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 99.21 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 99.21 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 99.2 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 99.2 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 99.19 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 99.19 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 99.19 | |
| KOG1540 | 296 | consensus Ubiquinone biosynthesis methyltransferas | 99.18 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 99.14 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 99.14 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 99.13 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 99.11 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 99.1 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 99.09 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 99.09 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 99.08 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 99.07 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 99.05 | |
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 99.05 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 99.04 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 99.03 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 99.02 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 99.01 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 99.0 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 98.97 | |
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 98.96 | |
| KOG4300 | 252 | consensus Predicted methyltransferase [General fun | 98.95 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 98.95 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 98.95 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 98.93 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 98.93 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 98.93 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 98.93 | |
| KOG2899 | 288 | consensus Predicted methyltransferase [General fun | 98.92 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 98.92 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 98.92 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 98.91 | |
| KOG1541 | 270 | consensus Predicted protein carboxyl methylase [Ge | 98.91 | |
| PRK04266 | 226 | fibrillarin; Provisional | 98.91 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 98.9 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 98.9 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 98.89 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 98.88 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 98.87 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 98.86 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 98.84 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 98.83 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 98.83 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 98.82 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 98.81 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 98.78 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 98.77 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 98.76 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 98.73 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 98.73 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 98.73 | |
| KOG0544 | 108 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 98.7 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 98.7 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 98.69 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 98.68 | |
| KOG3010 | 261 | consensus Methyltransferase [General function pred | 98.64 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 98.63 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 98.63 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 98.62 | |
| PLN02232 | 160 | ubiquinone biosynthesis methyltransferase | 98.62 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 98.6 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 98.6 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 98.6 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 98.6 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 98.6 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 98.6 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 98.59 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 98.58 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 98.56 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 98.54 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 98.53 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 98.5 | |
| PLN02366 | 308 | spermidine synthase | 98.5 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 98.49 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 98.47 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 98.46 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 98.44 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 98.44 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 98.42 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 98.42 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 98.41 | |
| PF05891 | 218 | Methyltransf_PK: AdoMet dependent proline di-methy | 98.41 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 98.4 | |
| KOG1975 | 389 | consensus mRNA cap methyltransferase [RNA processi | 98.39 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 98.39 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 98.38 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 98.37 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 98.35 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 98.34 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 98.32 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 98.3 | |
| PRK10611 | 287 | chemotaxis methyltransferase CheR; Provisional | 98.3 | |
| PF05219 | 265 | DREV: DREV methyltransferase; InterPro: IPR007884 | 98.25 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 98.24 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 98.21 | |
| PLN02476 | 278 | O-methyltransferase | 98.21 | |
| KOG2361 | 264 | consensus Predicted methyltransferase [General fun | 98.21 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 98.18 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 98.17 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 98.16 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 98.14 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 98.13 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 98.11 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 98.1 | |
| KOG1499 | 346 | consensus Protein arginine N-methyltransferase PRM | 98.09 | |
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 98.09 | |
| PF06080 | 204 | DUF938: Protein of unknown function (DUF938); Inte | 98.09 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 98.06 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 98.0 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 97.98 | |
| COG0500 | 257 | SmtA SAM-dependent methyltransferases [Secondary m | 97.97 | |
| KOG3420 | 185 | consensus Predicted RNA methylase [Translation, ri | 97.97 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 97.96 | |
| PF01739 | 196 | CheR: CheR methyltransferase, SAM binding domain; | 97.96 | |
| KOG2940 | 325 | consensus Predicted methyltransferase [General fun | 97.94 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 97.93 | |
| COG1041 | 347 | Predicted DNA modification methylase [DNA replicat | 97.92 | |
| PF09243 | 274 | Rsm22: Mitochondrial small ribosomal subunit Rsm22 | 97.91 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 97.87 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 97.86 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 97.85 | |
| PLN02589 | 247 | caffeoyl-CoA O-methyltransferase | 97.85 | |
| PLN02823 | 336 | spermine synthase | 97.82 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 97.82 | |
| COG1352 | 268 | CheR Methylase of chemotaxis methyl-accepting prot | 97.81 | |
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 97.79 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 97.77 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 97.75 | |
| KOG1661 | 237 | consensus Protein-L-isoaspartate(D-aspartate) O-me | 97.7 | |
| COG0421 | 282 | SpeE Spermidine synthase [Amino acid transport and | 97.67 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 97.65 | |
| KOG1269 | 364 | consensus SAM-dependent methyltransferases [Lipid | 97.65 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 97.64 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 97.57 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 97.57 | |
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 97.56 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 97.55 | |
| PF00035 | 67 | dsrm: Double-stranded RNA binding motif; InterPro: | 97.52 | |
| KOG1500 | 517 | consensus Protein arginine N-methyltransferase CAR | 97.51 | |
| PF13679 | 141 | Methyltransf_32: Methyltransferase domain | 97.46 | |
| KOG1331 | 293 | consensus Predicted methyltransferase [General fun | 97.45 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 97.45 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 97.45 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 97.43 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 97.4 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 97.39 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 97.37 | |
| KOG0820 | 315 | consensus Ribosomal RNA adenine dimethylase [RNA p | 97.36 | |
| PF05148 | 219 | Methyltransf_8: Hypothetical methyltransferase; In | 97.34 | |
| PF07942 | 270 | N2227: N2227-like protein; InterPro: IPR012901 Thi | 97.31 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 97.29 | |
| PF04672 | 267 | Methyltransf_19: S-adenosyl methyltransferase; Int | 97.29 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 97.27 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 97.22 | |
| KOG3178 | 342 | consensus Hydroxyindole-O-methyltransferase and re | 97.2 | |
| COG4076 | 252 | Predicted RNA methylase [General function predicti | 97.19 | |
| KOG3045 | 325 | consensus Predicted RNA methylase involved in rRNA | 97.17 | |
| smart00358 | 67 | DSRM Double-stranded RNA binding motif. | 97.1 | |
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 97.1 | |
| PRK11760 | 357 | putative 23S rRNA C2498 ribose 2'-O-ribose methylt | 97.1 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 96.94 | |
| COG3897 | 218 | Predicted methyltransferase [General function pred | 96.75 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 96.74 | |
| PF01728 | 181 | FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 | 96.73 | |
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 96.73 | |
| COG0116 | 381 | Predicted N6-adenine-specific DNA methylase [DNA r | 96.7 | |
| PF11968 | 219 | DUF3321: Putative methyltransferase (DUF3321); Int | 96.67 | |
| TIGR01444 | 143 | fkbM_fam methyltransferase, FkbM family. Members o | 96.66 | |
| PF02527 | 184 | GidB: rRNA small subunit methyltransferase G; Inte | 96.62 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 96.6 | |
| cd00048 | 68 | DSRM Double-stranded RNA binding motif. Binding is | 96.56 | |
| KOG3191 | 209 | consensus Predicted N6-DNA-methyltransferase [Tran | 96.47 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 96.44 | |
| PF03059 | 276 | NAS: Nicotianamine synthase protein; InterPro: IPR | 96.44 | |
| KOG3987 | 288 | consensus Uncharacterized conserved protein DREV/C | 96.43 | |
| KOG2187 | 534 | consensus tRNA uracil-5-methyltransferase and rela | 96.37 | |
| KOG1663 | 237 | consensus O-methyltransferase [Secondary metabolit | 96.31 | |
| PF04816 | 205 | DUF633: Family of unknown function (DUF633) ; Inte | 96.16 | |
| COG4627 | 185 | Uncharacterized protein conserved in bacteria [Fun | 96.13 | |
| COG0144 | 355 | Sun tRNA and rRNA cytosine-C5-methylases [Translat | 96.12 | |
| KOG2915 | 314 | consensus tRNA(1-methyladenosine) methyltransferas | 96.12 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 95.99 | |
| KOG2352 | 482 | consensus Predicted spermine/spermidine synthase [ | 95.8 | |
| PF07091 | 251 | FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: | 95.69 | |
| PF01189 | 283 | Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR | 95.67 | |
| COG0293 | 205 | FtsJ 23S rRNA methylase [Translation, ribosomal st | 95.66 | |
| COG2384 | 226 | Predicted SAM-dependent methyltransferase [General | 95.6 | |
| COG0357 | 215 | GidB Predicted S-adenosylmethionine-dependent meth | 95.55 | |
| TIGR00006 | 305 | S-adenosyl-methyltransferase MraW. Genetics paper | 95.45 | |
| PF01234 | 256 | NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I | 95.4 | |
| PRK12371 | 235 | ribonuclease III; Reviewed | 95.36 | |
| PHA03103 | 183 | double-strand RNA-binding protein; Provisional | 95.32 | |
| COG1189 | 245 | Predicted rRNA methylase [Translation, ribosomal s | 95.29 | |
| PF00254 | 94 | FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer | 95.27 | |
| PHA02701 | 183 | ORF020 dsRNA-binding PKR inhibitor; Provisional | 95.21 | |
| COG4262 | 508 | Predicted spermidine synthase with an N-terminal m | 95.08 | |
| TIGR03516 | 177 | ppisom_GldI peptidyl-prolyl isomerase, gliding mot | 95.05 | |
| PF01269 | 229 | Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr | 94.16 | |
| PF05971 | 299 | Methyltransf_10: Protein of unknown function (DUF8 | 94.12 | |
| PF03514 | 374 | GRAS: GRAS domain family; InterPro: IPR005202 Sequ | 94.09 | |
| COG4301 | 321 | Uncharacterized conserved protein [Function unknow | 93.73 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 93.73 | |
| COG0545 | 205 | FkpA FKBP-type peptidyl-prolyl cis-trans isomerase | 93.43 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 93.34 | |
| PF13578 | 106 | Methyltransf_24: Methyltransferase domain; PDB: 3S | 93.25 | |
| KOG2730 | 263 | consensus Methylase [General function prediction o | 93.11 | |
| PRK00102 | 229 | rnc ribonuclease III; Reviewed | 93.05 | |
| PRK15095 | 156 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 93.04 | |
| PF14709 | 80 | DND1_DSRM: double strand RNA binding domain from D | 92.7 | |
| COG5459 | 484 | Predicted rRNA methylase [Translation, ribosomal s | 92.49 | |
| TIGR02191 | 220 | RNaseIII ribonuclease III, bacterial. This family | 92.37 | |
| KOG1709 | 271 | consensus Guanidinoacetate methyltransferase and r | 92.36 | |
| cd00048 | 68 | DSRM Double-stranded RNA binding motif. Binding is | 92.34 | |
| cd08031 | 75 | LARP_4_5_like La RNA-binding domain of proteins si | 92.13 | |
| cd08030 | 90 | LA_like_plant La-motif domain of plant proteins si | 91.91 | |
| KOG4058 | 199 | consensus Uncharacterized conserved protein [Funct | 91.6 | |
| PRK11570 | 206 | peptidyl-prolyl cis-trans isomerase; Provisional | 91.43 | |
| PF03368 | 90 | Dicer_dimer: Dicer dimerisation domain; InterPro: | 91.38 | |
| smart00358 | 67 | DSRM Double-stranded RNA binding motif. | 91.37 | |
| COG0571 | 235 | Rnc dsRNA-specific ribonuclease [Transcription] | 91.08 | |
| PF06859 | 110 | Bin3: Bicoid-interacting protein 3 (Bin3); InterPr | 90.89 | |
| PF04989 | 206 | CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 | 90.83 | |
| COG0275 | 314 | Predicted S-adenosylmethionine-dependent methyltra | 90.77 | |
| PF14709 | 80 | DND1_DSRM: double strand RNA binding domain from D | 90.74 | |
| PF01795 | 310 | Methyltransf_5: MraW methylase family; InterPro: I | 90.48 | |
| KOG0549 | 188 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 90.44 | |
| smart00715 | 80 | LA Domain in the RNA-binding Lupus La protein; unk | 89.24 | |
| PRK12372 | 413 | ribonuclease III; Reviewed | 89.18 | |
| KOG3115 | 249 | consensus Methyltransferase-like protein [General | 89.18 | |
| PF02636 | 252 | Methyltransf_28: Putative S-adenosyl-L-methionine- | 89.03 | |
| PF07757 | 112 | AdoMet_MTase: Predicted AdoMet-dependent methyltra | 88.9 | |
| KOG1501 | 636 | consensus Arginine N-methyltransferase [General fu | 88.6 | |
| PRK10737 | 196 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 87.7 | |
| KOG1562 | 337 | consensus Spermidine synthase [Amino acid transpor | 87.64 | |
| PF11599 | 246 | AviRa: RRNA methyltransferase AviRa; InterPro: IPR | 87.64 | |
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 87.54 | |
| cd07323 | 75 | LAM LA motif RNA-binding domain. This domain is fo | 87.15 | |
| KOG3201 | 201 | consensus Uncharacterized conserved protein [Funct | 86.71 | |
| COG1889 | 231 | NOP1 Fibrillarin-like rRNA methylase [Translation, | 85.85 | |
| PRK10902 | 269 | FKBP-type peptidyl-prolyl cis-trans isomerase; Pro | 85.63 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 85.4 | |
| PHA00738 | 108 | putative HTH transcription regulator | 84.94 | |
| PF04445 | 234 | SAM_MT: Putative SAM-dependent methyltransferase; | 84.74 | |
| COG4798 | 238 | Predicted methyltransferase [General function pred | 84.34 | |
| TIGR00027 | 260 | mthyl_TIGR00027 methyltransferase, putative, TIGR0 | 84.23 | |
| cd08029 | 76 | LA_like_fungal La-motif domain of fungal proteins | 83.82 | |
| cd08034 | 73 | LARP_1_2 La RNA-binding domain proteins similar to | 83.81 | |
| PF06962 | 140 | rRNA_methylase: Putative rRNA methylase; InterPro: | 83.63 | |
| KOG0552 | 226 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 83.61 | |
| KOG2793 | 248 | consensus Putative N2,N2-dimethylguanosine tRNA me | 82.87 | |
| cd08033 | 77 | LARP_6 La RNA-binding domain of La-related protein | 82.82 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 82.42 | |
| cd08038 | 73 | LARP_2 La RNA-binding domain of La-related protein | 81.77 | |
| COG0286 | 489 | HsdM Type I restriction-modification system methyl | 81.52 | |
| KOG2798 | 369 | consensus Putative trehalase [Carbohydrate transpo | 81.51 | |
| PF01555 | 231 | N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th | 81.06 | |
| COG3510 | 237 | CmcI Cephalosporin hydroxylase [Defense mechanisms | 80.85 | |
| PRK11524 | 284 | putative methyltransferase; Provisional | 80.67 | |
| KOG1122 | 460 | consensus tRNA and rRNA cytosine-C5-methylase (nuc | 80.62 |
| >KOG1045 consensus Uncharacterized conserved protein HEN1/CORYMBOSA2 [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.1e-39 Score=353.44 Aligned_cols=366 Identities=28% Similarity=0.330 Sum_probs=289.3
Q ss_pred cceEEeeecCccccccccCC--CCCccccccccCCCCCccccccccccccceeeeeccceeecCCccccccchhhhhhhh
Q 002345 281 SEMRLYFAAPKSYLLDLSSD--LPNVEEVVDFEGSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRML 358 (933)
Q Consensus 281 ~~~r~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~n~ras~~~~~~i~g~ai~a~~g~~~~~~~l~~~~~~~~~~~r~~ 358 (933)
.|| |...|+ +.+.. +.....-.|+..++ +||+|.|||+|+||+|+|+|||+||
T Consensus 6 ~~c--~~~~~~----n~~e~~~~~~~~~~~~l~~~r-~r~~fk~~qd~~~~~~~a~~g~~w~------------------ 60 (404)
T KOG1045|consen 6 DEC--YSDIPK----NSLEAALLTPIDFSPPLAKQR-ARASFKNLQDIHGDKILADVGCGWR------------------ 60 (404)
T ss_pred CcC--cccCCc----chhhhccccccccccHHHHHh-hhhhhhcccCCCcchhhhhcCCccc------------------
Confidence 367 888888 22222 23344447888899 9999999999999999999999996
Q ss_pred hccCCCcccccchhhhhhhcCCcceeeccccCCCChhhHHHhhhhhcccCcceeccccCCccccccchhhhhhhhhcccc
Q 002345 359 IHLTPSGVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTCSNSLKESSESSRFYEKSAALESA 438 (933)
Q Consensus 359 ~~~~p~g~yk~sr~~~~~a~lp~~~t~~~~w~g~~pr~~l~~fc~~~~l~ep~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 438 (933)
|.+|+|+||.||++++.|.||..+| +.+|||++||.+||+||||++|.+|++....++++.++++.++.+++++....
T Consensus 61 -~~s~n~~~k~s~~~~~~agl~f~~~-k~~~r~~~~~~~l~dF~r~r~l~l~I~~~~G~~v~s~s~i~~~d~v~~~e~ie 138 (404)
T KOG1045|consen 61 -GSSYNGIYKESRTIEILAGLDFNET-KSVWRGPSVRPILGDFLRSRQLPLPILLLSGNVVDSLSKILRSDAVLAIELIE 138 (404)
T ss_pred -ccccccccccchhhHHHcCCCchhh-hhhhcCcchhHHHHHHhhhhcCCcceeeecCCccccHHHHHhhhhhhhhhhhh
Confidence 9999999999999999999999998 99999999999999999999999999999999999999999999998776544
Q ss_pred cccccccCCCcccCCCc---eeEEEEEeeccCCcceecCchhhhhhhhhhHhhhhhHHHHHHHhhhCCCCCCcccccccc
Q 002345 439 ETGKECTSGGGTAASDN---VRCEVKIFSKSRDPILECSPKEFYKKQNESIENASLKVLSWLNAYFKDPDIPLEKLNNLV 515 (933)
Q Consensus 439 ~~~~~~~~~~~~~~~~~---f~c~v~~~s~~~~~~~~~~~~~~~~~~~dai~~a~l~~l~~~~~~~~~~~~~~~~~~~~~ 515 (933)
..+++. ...-.++ |+|+++|..+.+++.++|++.+||.+.++||||++++++.|..+-|++ +.+..+
T Consensus 139 h~ds~~----~~~ip~~vfG~~~p~~iv~stpn~~~N~~~~kf~~l~p~~~~~~s~h~feW~r~eFa~------w~~~vd 208 (404)
T KOG1045|consen 139 HVDSEP----LLSIPELVFGFLCPVKIVKSTPNLVFNCIFRKFNTLLPSAIRRHSDHKFEWPRKEFAD------WALYVD 208 (404)
T ss_pred cccchh----hhccchhhcccccceEEEEeCCCccccchhhhhcccCchhhhccccccccccHHHHHH------HHhhhh
Confidence 444221 1111222 999999999999999999999999999999999999999999999999 566666
Q ss_pred CcCCeeeccchhhhhhccccchhccccccccccccccccccccccCCCCceeEeecCCCCCCccCCCCcEEEEEEEEEEE
Q 002345 516 GALDIQCYPQNFFKKFSSYRFIHNVQQRKMGEKLLQANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVSLV 595 (933)
Q Consensus 516 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~d~~~~p~~gs~~~i~y~~~l~ 595 (933)
+..|.....-+-.-....... ... +...+++++| +||+.+.|+|+..+.
T Consensus 209 ~~y~~~~~~~~~vg~pp~~~e---------------~v~-------~~~qirIfs~---------t~g~~~qi~~~~~~~ 257 (404)
T KOG1045|consen 209 DRYDMYVVEHTGVGNPPKLVE---------------NVG-------LMPQIRIFSI---------TNGSYTQICYSEQSK 257 (404)
T ss_pred hcCcceEEeecccCCchhhhc---------------ccc-------ccceeEEEEe---------cCCcEEEEeeccccc
Confidence 666554443332222211111 111 5567899999 999999999999998
Q ss_pred Ee-Cchh--hHHhhcccceeEeecccccchhhHHhhhhccccCCccccccCCchh-hHhhhccccccccccccc------
Q 002345 596 IE-GETM--KELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELPPQE-LILAAADDSARTFSLLSS------ 665 (933)
Q Consensus 596 ~~-g~~~--~~~~e~~~~fef~~g~~~~shhLkvlVtq~reGqsiff~r~lP~~d-lilAAa~Ds~~dl~~Ls~------ 665 (933)
.. |+|. +...|+++++||.++.+-|+.|++..|+||.+|.-++|.+..++.+ ++++.........+.+..
T Consensus 258 ~~~~~~~f~~s~~es~e~~e~~v~~~~~~q~~~~~v~q~~~g~k~~f~~s~~~~~~l~~~~~~~~~~~~s~l~~v~~~~~ 337 (404)
T KOG1045|consen 258 VNADKHKFGKSRKESNEEIEKLVGRFEMNQHLEPEVQQMLVGYKAQFGASQPAAERLQVTLNTPTPCELSVLEEVGHLKE 337 (404)
T ss_pred CCcchhccccCchHHhhhhhhhhccccccccccHHHHHHHHHHHHHhhcCcccccceeeeccCCcccccchhhhhccchh
Confidence 76 3332 3355699999999999999999999999999999999998888543 333322222222221111
Q ss_pred -----------hhhhhhcccCCchHHHHHHHHHHHhhcCCCCEEEEEcCCcChHHHHHhc
Q 002345 666 -----------KDRMEQALFSPPLSKQRVEYALQHIKESCATTLVDFGCGSGSLLDSLLD 714 (933)
Q Consensus 666 -----------eer~e~~~F~PPLy~qRve~Ild~L~~~~g~rVLDIGCGtG~fL~~LAr 714 (933)
+.+++-..+.++...+|..+...+.......++|+.|||.|........
T Consensus 338 ~i~ll~~~~~~~~~~el~~~~~~~~~~~~~~~~k~s~~ssa~~~l~~~~~s~v~~d~~~d 397 (404)
T KOG1045|consen 338 RIGLLLVAGNLEKEIELDFLKPSLKKQRLEYALKHSRSSSADTLLLFSCGSGVLFDLTLD 397 (404)
T ss_pred ccccceeccCcceeeehhhccchhhhhchhhHhhhhHHhhhhhhhhhccccceehhhccC
Confidence 1455666688899999999999998877889999999999988765443
|
|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1045 consensus Uncharacterized conserved protein HEN1/CORYMBOSA2 [Function unknown] | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG4300 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >KOG2899 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >KOG3010 consensus Methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PLN02232 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK10611 chemotaxis methyltransferase CheR; Provisional | Back alignment and domain information |
|---|
| >PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >KOG2361 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
| >PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >KOG2940 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >PLN02589 caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >PF00035 dsrm: Double-stranded RNA binding motif; InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions [] | Back alignment and domain information |
|---|
| >KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] | Back alignment and domain information |
|---|
| >PF13679 Methyltransf_32: Methyltransferase domain | Back alignment and domain information |
|---|
| >KOG1331 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases | Back alignment and domain information |
|---|
| >PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3178 consensus Hydroxyindole-O-methyltransferase and related SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >COG4076 Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00358 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >COG3897 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein | Back alignment and domain information |
|---|
| >TIGR01444 fkbM_fam methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >cd00048 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 | Back alignment and domain information |
|---|
| >KOG3987 consensus Uncharacterized conserved protein DREV/CGI-81 [Function unknown] | Back alignment and domain information |
|---|
| >KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >COG4627 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A | Back alignment and domain information |
|---|
| >PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins | Back alignment and domain information |
|---|
| >COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR00006 S-adenosyl-methyltransferase MraW | Back alignment and domain information |
|---|
| >PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK12371 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >PHA03103 double-strand RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 | Back alignment and domain information |
|---|
| >PHA02701 ORF020 dsRNA-binding PKR inhibitor; Provisional | Back alignment and domain information |
|---|
| >COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated | Back alignment and domain information |
|---|
| >PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] | Back alignment and domain information |
|---|
| >PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PF03514 GRAS: GRAS domain family; InterPro: IPR005202 Sequence analysis of the products of the GRAS (GAI, RGA, SCR) gene family indicates that they share a variable N terminus and a highly conserved C terminus that contains five recognizable motifs [] | Back alignment and domain information |
|---|
| >COG4301 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D | Back alignment and domain information |
|---|
| >KOG2730 consensus Methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00102 rnc ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 | Back alignment and domain information |
|---|
| >COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02191 RNaseIII ribonuclease III, bacterial | Back alignment and domain information |
|---|
| >KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00048 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >cd08031 LARP_4_5_like La RNA-binding domain of proteins similar to La-related proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd08030 LA_like_plant La-motif domain of plant proteins similar to the La autoantigen | Back alignment and domain information |
|---|
| >KOG4058 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >PF03368 Dicer_dimer: Dicer dimerisation domain; InterPro: IPR005034 This domain is found in members of the Dicer protein family of dsRNA nucleases | Back alignment and domain information |
|---|
| >smart00358 DSRM Double-stranded RNA binding motif | Back alignment and domain information |
|---|
| >COG0571 Rnc dsRNA-specific ribonuclease [Transcription] | Back alignment and domain information |
|---|
| >PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) | Back alignment and domain information |
|---|
| >PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] | Back alignment and domain information |
|---|
| >COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF14709 DND1_DSRM: double strand RNA binding domain from DEAD END PROTEIN 1 | Back alignment and domain information |
|---|
| >PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria | Back alignment and domain information |
|---|
| >KOG0549 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00715 LA Domain in the RNA-binding Lupus La protein; unknown function | Back alignment and domain information |
|---|
| >PRK12372 ribonuclease III; Reviewed | Back alignment and domain information |
|---|
| >KOG3115 consensus Methyltransferase-like protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] | Back alignment and domain information |
|---|
| >KOG1501 consensus Arginine N-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >KOG1562 consensus Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >cd07323 LAM LA motif RNA-binding domain | Back alignment and domain information |
|---|
| >KOG3201 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >PHA00738 putative HTH transcription regulator | Back alignment and domain information |
|---|
| >PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >COG4798 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00027 mthyl_TIGR00027 methyltransferase, putative, TIGR00027 family | Back alignment and domain information |
|---|
| >cd08029 LA_like_fungal La-motif domain of fungal proteins similar to the La autoantigen | Back alignment and domain information |
|---|
| >cd08034 LARP_1_2 La RNA-binding domain proteins similar to La-related proteins 1 and 2 | Back alignment and domain information |
|---|
| >PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases | Back alignment and domain information |
|---|
| >KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2793 consensus Putative N2,N2-dimethylguanosine tRNA methyltransferase [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd08033 LARP_6 La RNA-binding domain of La-related protein 6 | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd08038 LARP_2 La RNA-binding domain of La-related protein 2 | Back alignment and domain information |
|---|
| >COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG2798 consensus Putative trehalase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases | Back alignment and domain information |
|---|
| >COG3510 CmcI Cephalosporin hydroxylase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK11524 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 933 | ||||
| 3htx_A | 950 | Crystal Structure Of Small Rna Methyltransferase He | 0.0 | ||
| 3jwh_A | 217 | Crystal Structure Analysis Of The Methyltransferase | 8e-25 | ||
| 3jwj_A | 202 | Crystal Structure Analysis Of The Methyltransferase | 1e-24 | ||
| 3jwi_A | 207 | Crystal Structure Analysis Of The Methyltransferase | 1e-23 | ||
| 3jwg_A | 219 | Crystal Structure Analysis Of The Methyltransferase | 6e-23 |
| >pdb|3HTX|A Chain A, Crystal Structure Of Small Rna Methyltransferase Hen1 Length = 950 | Back alignment and structure |
|
| >pdb|3JWH|A Chain A, Crystal Structure Analysis Of The Methyltransferase Domain Of Bacterial-Avhen1-C Length = 217 | Back alignment and structure |
| >pdb|3JWJ|A Chain A, Crystal Structure Analysis Of The Methyltransferase Domain Of Bacterial-Avhen1-Cn Length = 202 | Back alignment and structure |
| >pdb|3JWI|A Chain A, Crystal Structure Analysis Of The Methyltransferase Domain Of Bacterial-Cthen1-Cn Length = 207 | Back alignment and structure |
| >pdb|3JWG|A Chain A, Crystal Structure Analysis Of The Methyltransferase Domain Of Bacterial-Cthen1-C Length = 219 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 | Back alignment and structure |
|---|
Score = 957 bits (2475), Expect = 0.0
Identities = 457/945 (48%), Positives = 606/945 (64%), Gaps = 42/945 (4%)
Query: 8 VVAVRKMKLTPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEF 67
+ K TPKAII QKFG A +TV+EV D Q+GCPGLAIPQKGPCLYRC LQLPEF
Sbjct: 9 MAGGGKHTPTPKAIIHQKFGAKASYTVEEVHDSSQSGCPGLAIPQKGPCLYRCHLQLPEF 68
Query: 68 SVVSETFKKKKDAEQSAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQS 127
SVVS FKKKKD+EQSAAE AL+KLGI P + + +EA D+++ +K++FS+EFLS++
Sbjct: 69 SVVSNVFKKKKDSEQSAAELALDKLGIRPQNDDLTVDEARDEIVGRIKYIFSDEFLSAEH 128
Query: 128 PLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANLCKLINPKVESSHLLVLTYIMRAATR 187
PL H AALRRDG+ GSVP SVIA D+K+ + CK+INP VES L ++Y+M+AA +
Sbjct: 129 PLGAHLRAALRRDGERCGSVPVSVIATVDAKINSRCKIINPSVESDPFLAISYVMKAAAK 188
Query: 188 LSEFVVTSEGQLSIWRKDPYPPEIKESSIIQQSESPDSICIEAIHIPSSLEMAVHPVTLN 247
L++++V S + RK+ YP EI E+ S+S S + A++IP E V TL
Sbjct: 189 LADYIVAS--PHGLRRKNAYPSEIVEALATHVSDSLHSREVAAVYIPCIDEEVVELDTLY 246
Query: 248 VSSTGYYLDVIARNLDQTDGNKILVSRTIGKAS--SEMRLYFAAPKSYLLDLSSDLP-NV 304
+SS +YLD IA L DGN++++SR GKAS SE RLY PK YL + S +
Sbjct: 247 ISSNRHYLDSIAERLGLKDGNQVMISRMFGKASCGSECRLYSEIPKKYLDNSSDASGTSN 306
Query: 305 EEVVDFEGSLNPRASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPS 364
E+ S N RASY+ GQDI+GDAILAS+GY KS+ L ++D+T+ S+YR+ ++P+
Sbjct: 307 EDSSHIVKSRNARASYICGQDIHGDAILASVGYRWKSDDLDYDDVTVNSFYRICCGMSPN 366
Query: 365 GVYKLSREAILTAELPMAFTTRTNWRGSFPREMLFMFCRQHWLSEPVFSTCSNSLKESSE 424
G+YK+SR+A++ A+LP AFTT++NWRG PRE+L +FC QH L+EP+ S+ + +K S+
Sbjct: 367 GIYKISRQAVIAAQLPFAFTTKSNWRGPLPREILGLFCHQHRLAEPILSSSTAPVKSLSD 426
Query: 425 SSRFYEK--SAALESAETGKECTSGGGTAASDNVRCEVKIFSKSRDPILECSPKEFYKKQ 482
R ++K + ++ A RCEVKIF+KS+D +LECSP++FY+K+
Sbjct: 427 IFRSHKKLKVSGVDDANENLSRQKEDTPGLGHGFRCEVKIFTKSQDLVLECSPRKFYEKE 486
Query: 483 NESIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQ 542
N++I+NASLK L W + +F D D+ E+ + D + N F + H+ +
Sbjct: 487 NDAIQNASLKALLWFSKFFADLDVDGEQSCDTDDDQDTKSSSPNVFAAPPILQKEHSSES 546
Query: 543 RKMG----EKLLQANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVSLVIEG 598
+ EK +Q+ + ++ +I + G P S
Sbjct: 547 KNTNVLSAEKRVQSITNGSVVSICYSLSLAVDPEYSSDGESPREDNESNEEMESEYSANC 606
Query: 599 ETMKELLESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELP--PQELILAAADDS 656
E+ E +ES EE EFE+GTG++ P +E QM+VG+ A F P + LILA D+
Sbjct: 607 ESSVEPIESNEEIEFEVGTGSMNPHIESEVTQMTVGEYASFKMTPPDAAEALILAVGSDT 666
Query: 657 ARTFSLLSSK-----------------DRMEQALFSPPLSKQRVEYALQHIKESCATTLV 699
R SLLS + +RME A F PPLSKQRVEYAL+HI+ES A+TLV
Sbjct: 667 VRIRSLLSERPCLNYNILLLGVKGPSEERMEAAFFKPPLSKQRVEYALKHIRESSASTLV 726
Query: 700 DFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDVKSA 759
DFGCGSGSLLDSLLDYPT+L+ I+GVDIS K L+RAAK++H KL+K +VKSA
Sbjct: 727 DFGCGSGSLLDSLLDYPTSLQTIIGVDISPKGLARAAKMLHVKLNK------EACNVKSA 780
Query: 760 VLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYEYN 819
L+DGSI FDSRLH DIGTCLEVIEHMEED+A +FG VLS F P++LIVSTPNYE+N
Sbjct: 781 TLYDGSILEFDSRLHDVDIGTCLEVIEHMEEDQACEFGEKVLSLFHPKLLIVSTPNYEFN 840
Query: 820 AILQKSSSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFSGV 879
ILQ+S+ E + ++ Q KFRNHDHKFEWTR+QFN WA++L RHNYSVEFSGV
Sbjct: 841 TILQRSTP---ETQEENNSEPQLPKFRNHDHKFEWTREQFNQWASKLGKRHNYSVEFSGV 897
Query: 880 GGSGDREPGFASQIAVFRSRTPPEEDDLLKDGDSAHHYKVIWEWD 924
GGSG+ EPGFASQIA+FR E+ YKVIWEW
Sbjct: 898 GGSGEVEPGFASQIAIFRREASSVENVAESSM---QPYKVIWEWK 939
|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Length = 284 | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Length = 293 | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 Length = 89 | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Length = 276 | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} Length = 103 | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 Length = 97 | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A Length = 73 | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Length = 216 | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Length = 215 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A Length = 73 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 933 | |||
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 100.0 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 99.95 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 99.95 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 99.68 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 99.68 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 99.65 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 99.64 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 99.64 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 99.63 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 99.63 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 99.63 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 99.63 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 99.63 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 99.62 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 99.62 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 99.62 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 99.61 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 99.61 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 99.6 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 99.6 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 99.6 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 99.59 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 99.59 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 99.58 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 99.58 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 99.58 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 99.57 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 99.57 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 99.57 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 99.57 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 99.56 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 99.56 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 99.56 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 99.56 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 99.55 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 99.55 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 99.55 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 99.54 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 99.54 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 99.54 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 99.54 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 99.54 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 99.54 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 99.54 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 99.53 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 99.53 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 99.52 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 99.52 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 99.52 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 99.52 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 99.51 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 99.51 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 99.51 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 99.51 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 99.51 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 99.49 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 99.49 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 99.48 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 99.47 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 99.47 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 99.46 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 99.46 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 99.45 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 99.45 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 99.45 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 99.45 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 99.45 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 99.45 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 99.44 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 99.44 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 99.43 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 99.42 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 99.42 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 99.41 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 99.41 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 99.41 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 99.4 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 99.4 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 99.4 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 99.4 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 99.39 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 99.38 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 99.37 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 99.37 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 99.37 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 99.36 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 99.35 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 99.34 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 99.34 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 99.33 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 99.33 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 99.33 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 99.32 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 99.32 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 99.31 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 99.31 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 99.3 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 99.3 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 99.29 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 99.29 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 99.28 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 99.27 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 99.27 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 99.27 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 99.26 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 99.26 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 99.26 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 99.25 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 99.25 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 99.24 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 99.24 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 99.24 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 99.24 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 99.23 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 99.23 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 99.23 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 99.22 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 99.22 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 99.21 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 99.21 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 99.21 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 99.21 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 99.21 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 99.21 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 99.2 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 99.19 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 99.19 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 99.19 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 99.19 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 99.18 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 99.18 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 99.18 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 99.18 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 99.18 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 99.17 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 99.16 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 99.16 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 99.16 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 99.16 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 99.16 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 99.15 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 99.15 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 99.15 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 99.15 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 99.15 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 99.14 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 99.14 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 99.14 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 99.13 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 99.13 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 99.13 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 99.13 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 99.12 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 99.12 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 99.12 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 99.12 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 99.12 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 99.11 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 99.11 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 99.11 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 99.11 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 99.1 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 99.1 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 99.09 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 99.09 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 99.08 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 99.08 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 99.07 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 99.07 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 99.07 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 99.06 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 99.05 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 99.05 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 99.04 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 99.04 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 99.04 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 99.04 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 99.04 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 99.04 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 99.03 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 99.03 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 99.02 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 99.02 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 99.02 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 99.02 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 99.02 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 99.01 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 99.01 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 99.01 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 99.0 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 98.99 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 98.99 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 98.98 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 98.98 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 98.98 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 98.97 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 98.96 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 98.95 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 98.95 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 98.95 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 98.94 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 98.93 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 98.93 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 98.93 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 98.91 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 98.91 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 98.9 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 98.9 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 98.9 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 98.89 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 98.89 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 98.88 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 98.88 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 98.87 | |
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 98.87 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 98.86 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 98.85 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 98.84 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 98.84 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 98.84 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 98.84 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 98.84 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 98.83 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 98.82 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 98.81 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 98.8 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 98.8 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 98.79 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 98.79 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 98.79 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 98.77 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 98.76 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 98.76 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 98.75 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 98.74 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 98.73 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 98.7 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 98.68 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 98.68 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 98.68 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 98.67 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 98.66 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 98.66 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 98.66 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 98.65 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 98.64 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 98.64 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 98.64 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 98.63 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 98.63 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 98.6 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 98.59 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 98.59 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 98.58 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 98.57 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 98.55 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 98.48 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 98.47 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 98.46 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 98.44 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 98.41 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 98.35 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 98.34 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 98.28 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 98.27 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 98.24 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 98.18 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 98.16 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 98.13 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 98.03 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 98.03 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 97.84 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 97.8 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 97.79 | |
| 3cvo_A | 202 | Methyltransferase-like protein of unknown functio; | 97.61 | |
| 3ua3_A | 745 | Protein arginine N-methyltransferase 5; TIM-barrel | 97.59 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 97.59 | |
| 4gqb_A | 637 | Protein arginine N-methyltransferase 5; TIM barrel | 97.55 | |
| 4auk_A | 375 | Ribosomal RNA large subunit methyltransferase M; Y | 97.51 | |
| 3evf_A | 277 | RNA-directed RNA polymerase NS5; NS5 methyltransfe | 97.5 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 97.49 | |
| 3s1s_A | 878 | Restriction endonuclease bpusi; PD--(D/E)XK cataly | 97.46 | |
| 2b7v_A | 71 | Double-stranded RNA-specific editase 1; RNA editin | 97.39 | |
| 3p1x_A | 75 | Interleukin enhancer-binding factor 3; structural | 97.36 | |
| 1x49_A | 97 | Interferon-induced, double-stranded RNA- activated | 97.25 | |
| 2lkn_A | 165 | AH receptor-interacting protein; FKBP-type domain, | 97.19 | |
| 3gcz_A | 282 | Polyprotein; flavivirus, RNA capping, methyltransf | 97.18 | |
| 2k4m_A | 153 | TR8_protein, UPF0146 protein MTH_1000; alpha+beta, | 97.12 | |
| 3llh_A | 90 | RISC-loading complex subunit tarbp2; DSRBD, DSRM, | 97.07 | |
| 1ekz_A | 76 | DSRBDIII, maternal effect protein (staufen); struc | 97.06 | |
| 2l33_A | 91 | Interleukin enhancer-binding factor 3; structural | 97.02 | |
| 3b5i_A | 374 | S-adenosyl-L-methionine:salicylic acid carboxyl me | 97.01 | |
| 2ppn_A | 107 | FK506-binding protein 1A; high resolution protein | 97.0 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 96.97 | |
| 3c6k_A | 381 | Spermine synthase; spermidine aminopropyltransfera | 96.96 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 96.92 | |
| 2dix_A | 84 | Interferon-inducible double stranded RNA- dependen | 96.9 | |
| 1uhz_A | 89 | Staufen (RNA binding protein) homolog 2; DSRM, sta | 96.89 | |
| 2y78_A | 133 | Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, | 96.87 | |
| 1yat_A | 113 | FK506 binding protein; HET: FK5; 2.50A {Saccharomy | 96.87 | |
| 2efj_A | 384 | 3,7-dimethylxanthine methyltransferase; SAM-depend | 96.84 | |
| 1di2_A | 69 | XLRBPA, double stranded RNA binding protein A; pro | 96.84 | |
| 2lgo_A | 130 | FKBP; infectious disease, isomerase, giardiasis, s | 96.8 | |
| 3adj_A | 76 | F21M12.9 protein; HYL1, miRNA processing, RNA bind | 96.79 | |
| 2cpn_A | 89 | TAR RNA-binding protein 2; double-stranded RNA bin | 96.75 | |
| 3o5q_A | 128 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 96.72 | |
| 1s29_A | 92 | LA protein; winged helix-turn-helix, autoantigen, | 96.7 | |
| 3adl_A | 88 | RISC-loading complex subunit tarbp2; TRBP2, miRNA | 96.68 | |
| 2ljh_A | 114 | Double-stranded RNA-specific editase ADAR; DSRBD, | 96.67 | |
| 1x48_A | 88 | Interferon-induced, double-stranded RNA- activated | 96.65 | |
| 4dip_A | 125 | Peptidyl-prolyl CIS-trans isomerase FKBP14; struct | 96.64 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 96.64 | |
| 3adg_A | 73 | F21M12.9 protein; HYL1, miRNA processing mechanism | 96.56 | |
| 1r9h_A | 135 | FKB-6, FK506 binding protein family; structural ge | 96.54 | |
| 2b7t_A | 73 | Double-stranded RNA-specific editase 1; RNA editin | 96.54 | |
| 3kz7_A | 119 | FK506-binding protein 3; FKPB ppiase rapamycin, is | 96.51 | |
| 1m6e_X | 359 | S-adenosyl-L-methionnine:salicylic acid carboxyl m | 96.48 | |
| 2dmy_A | 97 | Spermatid perinuclear RNA-binding protein; DSRM do | 96.48 | |
| 3o5e_A | 144 | Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 | 96.47 | |
| 2f4e_A | 180 | ATFKBP42; FKBP-like, alpha-beta, signaling protein | 96.45 | |
| 2vn1_A | 129 | 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR | 96.43 | |
| 3b7x_A | 134 | FK506-binding protein 6; isomerase, repeat, rotama | 96.39 | |
| 2l2n_A | 103 | Hyponastic leave 1; DSRBD, miRNA, RNA binding prot | 96.35 | |
| 3eld_A | 300 | Methyltransferase; flavivirus, RNA capping, guanyl | 96.33 | |
| 1uil_A | 113 | Double-stranded RNA-binding motif; structural geno | 96.26 | |
| 1whn_A | 128 | Hypothetical protein riken cDNA 2310016K04; double | 96.2 | |
| 3ufb_A | 530 | Type I restriction-modification system methyltran | 96.2 | |
| 2khx_A | 85 | Ribonuclease 3; drosha, RNA binding domain, hydrol | 96.19 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 96.12 | |
| 2wk1_A | 282 | NOVP; transferase, O-methyltransferase, novobiocin | 96.09 | |
| 1whq_A | 99 | RNA helicase A; double-stranded RNA binding domain | 96.07 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 96.03 | |
| 3lkz_A | 321 | Non-structural protein 5; flavivirus, methyltransf | 96.01 | |
| 2pbc_A | 102 | FK506-binding protein 2; endoplasmic reticulum, is | 95.93 | |
| 1x47_A | 98 | DGCR8 protein; structural genomics, DSRM domain, N | 95.92 | |
| 2awg_A | 118 | 38 kDa FK-506 binding protein; FKBP-type, ppiase, | 95.84 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 95.75 | |
| 1u79_A | 129 | FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T | 95.72 | |
| 3tka_A | 347 | Ribosomal RNA small subunit methyltransferase H; H | 95.64 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 95.63 | |
| 3p8z_A | 267 | Mtase, non-structural protein 5; methyltransferase | 95.48 | |
| 1i4w_A | 353 | Mitochondrial replication protein MTF1; mitochondr | 95.48 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 95.46 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 95.39 | |
| 2d9f_A | 135 | FK506-binding protein 8 variant; FKBP, rapamycin, | 95.27 | |
| 1t4n_A | 94 | Ribonuclease III; DSRBD, RNA-binding, hydrolase; N | 95.26 | |
| 2jwx_A | 157 | FKBP38NTD, FK506-binding protein 8 variant; apopto | 94.93 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 94.79 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 94.71 | |
| 1jvw_A | 167 | Macrophage infectivity potentiator; chagas disease | 94.64 | |
| 2nug_A | 221 | Ribonuclease III, RNAse III; dsRNA, RNA interferen | 94.63 | |
| 1rjd_A | 334 | PPM1P, carboxy methyl transferase for protein phos | 94.63 | |
| 2uyo_A | 310 | Hypothetical protein ML2640; putative methyltransf | 94.58 | |
| 1o0w_A | 252 | Ribonuclease III, RNAse III; TM1102, structural ge | 94.5 | |
| 2px2_A | 269 | Genome polyprotein [contains: capsid protein C (co | 94.45 | |
| 1t4o_A | 117 | Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydro | 94.38 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 93.97 | |
| 1hxv_A | 113 | Trigger factor; FKBP fold, ppiase, chaperone; NMR | 93.87 | |
| 4dt4_A | 169 | FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; | 93.39 | |
| 2cqk_A | 101 | C-MPL binding protein; LA domain, structural genom | 93.25 | |
| 2l3j_A | 236 | Double-stranded RNA-specific editase 1; editing, d | 93.17 | |
| 1qu6_A | 179 | Protein kinase PKR; dsRNA-binding domain, solution | 92.8 | |
| 1fd9_A | 213 | Protein (macrophage infectivity potentiator prote; | 92.73 | |
| 3jxv_A | 356 | 70 kDa peptidyl-prolyl isomerase; FKBP- binding do | 92.5 | |
| 1q6h_A | 224 | FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; | 92.36 | |
| 3pr9_A | 157 | FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB | 92.29 | |
| 3r24_A | 344 | NSP16, 2'-O-methyl transferase; methyltransferase, | 92.17 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 91.73 | |
| 2a11_A | 242 | Ribonuclease III, RNAse III; nuclease domain, stru | 91.58 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 91.28 | |
| 2kr7_A | 151 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; | 91.07 | |
| 3n3w_A | 248 | Ribonuclease III; nuclease domain, ribonuclase III | 90.91 | |
| 3c4b_A | 265 | Endoribonuclease dicer; RNAse, dsRNA binding prote | 90.88 | |
| 3oe2_A | 219 | Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, | 90.78 | |
| 3prb_A | 231 | FKBP-type peptidyl-prolyl CIS-trans isomerase; cha | 89.9 | |
| 1ix5_A | 151 | FKBP; ppiase, isomerase; NMR {Methanothermococcust | 89.24 | |
| 2kfw_A | 196 | FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD | 88.64 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 88.61 | |
| 1q1c_A | 280 | FK506-binding protein 4; rotamase, TPR repeat, nuc | 87.84 | |
| 2py6_A | 409 | Methyltransferase FKBM; YP_546752.1, structural ge | 87.65 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 87.33 | |
| 2kou_A | 102 | Dicer-like protein 4; ATP-binding, endonuclease, h | 87.19 | |
| 3rv0_A | 341 | K. polysporus DCR1; RNAse III enzyme, RNA binding | 86.85 | |
| 2yt4_A | 232 | Protein DGCR8; DSRBD, RNA binding domain, RNA bind | 86.41 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 86.39 | |
| 2k8i_A | 171 | SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, | 86.25 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 86.05 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 85.6 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 83.48 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 81.48 | |
| 3cgm_A | 158 | SLYD, peptidyl-prolyl CIS-trans isomerase; chapero | 81.02 |
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-275 Score=2393.43 Aligned_cols=878 Identities=52% Similarity=0.835 Sum_probs=713.3
Q ss_pred CCCCcccccccCCCChHhHHHHhccCceeEEEeeeeccccCCCCccccCCCCCceEEEeeecCCceeeeccccccchHHH
Q 002345 3 NGGLSVVAVRKMKLTPKAIIVQKFGRNAQFTVDEVQDVVQNGCPGLAIPQKGPCLYRCSLQLPEFSVVSETFKKKKDAEQ 82 (933)
Q Consensus 3 ~~~~~~~~~~~~~~tpka~~~q~~g~~~~~~~~ev~~~~~~~~~~~~~~q~~~~~~~c~l~lp~~~v~~~~~~~kkdaeq 82 (933)
|+|+ +|+|+|||||||||||+|||||||||||++|+|||||||||||||||||+||||||+||||+|||||||||
T Consensus 9 ~~~~-----~~~~~~pk~~~~q~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~lp~~~~~~~~~~~kkd~eq 83 (950)
T 3htx_A 9 MAGG-----GKHTPTPKAIIHQKFGAKASYTVEEVHDSSQSGCPGLAIPQKGPCLYRCHLQLPEFSVVSNVFKKKKDSEQ 83 (950)
T ss_dssp -----------CCCCCHHHHHHTTGGGSEEEEEEECCSCSCCCTTCCSCCCCCCEEEEEEECSSCEEECCCBSCHHHHHH
T ss_pred ccCC-----CCCCCCHHHHHHHHhCcceeeeehhhhcccCCCCCccccCCCCCeeEEEEeeCCCceEecchhhccccHHH
Confidence 5666 69999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHcCCCCCCCCCChHHHHHHHHHHHhhhhcccccccCCCchhhhHHhhhhcCcccccccceEEEeeccccccc
Q 002345 83 SAAEKALEKLGIDPSPNVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSKLANL 162 (933)
Q Consensus 83 ~aa~~al~k~g~~~~~~~~~~~e~~~~l~~~~~~~f~~~~~~~~~pl~~h~~~~~~r~g~~~g~~p~~~~~~~d~k~~~~ 162 (933)
+||++||+||||+|+|++||++|+||+||+||+|+|+|||++++|||+|||||||||+|||||+||+||||+||+||+|+
T Consensus 84 ~aa~~al~~~g~~~~~~~~~~~~~~~~~~~~~~~~f~~e~~~~~~pl~~h~~~~~~r~~~~~~~~p~~~~~~~d~k~~~~ 163 (950)
T 3htx_A 84 SAAELALDKLGIRPQNDDLTVDEARDEIVGRIKYIFSDEFLSAEHPLGAHLRAALRRDGERCGSVPVSVIATVDAKINSR 163 (950)
T ss_dssp HHHHHHHTTTTSTTTSCCCCHHHHHHHHHHHHHHHTSTGGGGCSSTHHHHHHHHHTSCGGGTTEECHHHHHHTCHHHHHH
T ss_pred HHHHHHHHHhCCCccccCcchhhHHHHHHHHHHHHhhhhhhhccCchHHHHHHHHhhcCccccccchhhheehhhhhhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccCcccccchHHHHHHHHHHhhccCCcEEeecCceeeeecCCCChhhhhhhhhhccCCCCcEEEEEEEecccccccee
Q 002345 163 CKLINPKVESSHLLVLTYIMRAATRLSEFVVTSEGQLSIWRKDPYPPEIKESSIIQQSESPDSICIEAIHIPSSLEMAVH 242 (933)
Q Consensus 163 ck~~~~~~e~~p~~~~~~~~~a~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~p~~~~~~~~ 242 (933)
||+|||+||+|||||+|||||||++|||++ ||++| |||||+|||||||++++++||+++|+|+||||||||++|++|+
T Consensus 164 ck~~~~~~e~~p~~~~~~~~~a~~~~~~~~-~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 241 (950)
T 3htx_A 164 CKIINPSVESDPFLAISYVMKAAAKLADYI-VASPH-GLRRKNAYPSEIVEALATHVSDSLHSREVAAVYIPCIDEEVVE 241 (950)
T ss_dssp HHHHCTHHHHCTHHHHHHHHHHHHHCCSSE-EEETT-EEEESSCCCHHHHHHHHHTCCCC---EEEEEEEECSSTTSCCE
T ss_pred hhhcCcccccChHHHHHHHHHHhhcCCCcE-EeCCc-ccccCCCCCHHHHHHHHHHhcCCCcceEEEEEEeeccccccee
Confidence 999999999999999999999999999966 89999 9999999999999999999999999999999999999999999
Q ss_pred eEEEEecCCcchHHHHHHhcCCCCCCeEEEEeeccCCCc--ceEEeeecCccccccccCC---CCCccccccccCCCCCc
Q 002345 243 PVTLNVSSTGYYLDVIARNLDQTDGNKILVSRTIGKASS--EMRLYFAAPKSYLLDLSSD---LPNVEEVVDFEGSLNPR 317 (933)
Q Consensus 243 ~~~l~~~~~~~y~~~ia~~l~~~d~~~v~~sr~~~k~~~--~~r~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~n~r 317 (933)
+|||||||++||||+||++||++|+|||||||||||||| ||||||+||| +++|++|+ ++|++| +|+||++|+|
T Consensus 242 ~~~~~~~~~~~y~~~~a~~l~~~d~~~~~~sr~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~-~~~~~~~n~r 319 (950)
T 3htx_A 242 LDTLYISSNRHYLDSIAERLGLKDGNQVMISRMFGKASCGSECRLYSEIPK-KYLDNSSDASGTSNEDS-SHIVKSRNAR 319 (950)
T ss_dssp EEEEEECTTSCHHHHHHHHHTCSCSSSEEECCCBCHHHHSSCBEEEEECCH-HHHCCC-------------CCCCCBCHH
T ss_pred eeEEEecCCcchHHHHHHHhCCCccceEEEEeeccCCCCCcceeEEEecch-hhhhhhhcccccccccc-cccccccccc
Confidence 999999999999999999999999999999999999999 9999999999 66777777 999999 9999999999
Q ss_pred cccccccccccceeeeeccceeecCCccccccchhhhhhhhhccCCCcccccchhhhhhhcCCcceeeccccCCCChhhH
Q 002345 318 ASYLYGQDIYGDAILASIGYTRKSEGLFHEDITLQSYYRMLIHLTPSGVYKLSREAILTAELPMAFTTRTNWRGSFPREM 397 (933)
Q Consensus 318 as~~~~~~i~g~ai~a~~g~~~~~~~l~~~~~~~~~~~r~~~~~~p~g~yk~sr~~~~~a~lp~~~t~~~~w~g~~pr~~ 397 (933)
|||||||+||||||||+|||||||++||||||||+|||||||||+|||||||||+||||||||++||||+||||+|||||
T Consensus 320 a~~~~~~~i~~~~~~a~~~~~~~~~~~~~~~~~~~~~~r~~~~~~p~g~~k~sr~~~~~a~lp~~~t~~~~w~g~~pr~~ 399 (950)
T 3htx_A 320 ASYICGQDIHGDAILASVGYRWKSDDLDYDDVTVNSFYRICCGMSPNGIYKISRQAVIAAQLPFAFTTKSNWRGPLPREI 399 (950)
T ss_dssp HHHHHTSCCBSCEEEEEEEECSSCSSEEEECCCHHHHHHHHHTTSHHHHHHHHHTCTTTBCCCSCCCCTTTCCSSCHHHH
T ss_pred ceeeecccccchhhhhhcCccccccccccccchhhhhHHHHhccCCCcceecchhhhhhhcCCcceecccccCCCChHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhhhhhcccCcceeccccCCccccccchhhhhhhhhcccccccccccCCCcccCCCc------eeEEEEEeeccCCcce
Q 002345 398 LFMFCRQHWLSEPVFSTCSNSLKESSESSRFYEKSAALESAETGKECTSGGGTAASDN------VRCEVKIFSKSRDPIL 471 (933)
Q Consensus 398 l~~fc~~~~l~ep~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------f~c~v~~~s~~~~~~~ 471 (933)
||+|||||||+||+|+++++|+|++|+++||++++ ++++++++| ||+|+++++| |||||||+||+|||||
T Consensus 400 l~~fc~~~~l~~~~~~~~~~~~k~~~~~~~~~~~~---~~~~~~~~~-~~~~~~~~~~~~~~~~f~c~~~~~~~~~~~~~ 475 (950)
T 3htx_A 400 LGLFCHQHRLAEPILSSSTAPVKSLSDIFRSHKKL---KVSGVDDAN-ENLSRQKEDTPGLGHGFRCEVKIFTKSQDLVL 475 (950)
T ss_dssp HHHHHHTTTCCCCEEECCC------------------------------------------------CEEEEEETTEEEE
T ss_pred HHHHHHHhhcCcceeeeccCccccccccccccccc---cccccchhh-hcCCcccCCCCCcccceEEEEEEEecccchhh
Confidence 99999999999999999999999999999999999 778888888 9999999988 9999999999999999
Q ss_pred ecCchhhhhhhhhhHhhhhhHHHHHHHhhhCCCCCCccccccccCcCCeeeccchhhhhhccccchhccccccccccccc
Q 002345 472 ECSPKEFYKKQNESIENASLKVLSWLNAYFKDPDIPLEKLNNLVGALDIQCYPQNFFKKFSSYRFIHNVQQRKMGEKLLQ 551 (933)
Q Consensus 472 ~~~~~~~~~~~~dai~~a~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 551 (933)
||||+++|+||||||||||||||+|||+|||+||||+||||+++|++||+|+|+||+|||+|||| |
T Consensus 476 ~~~~~~~~~~~~~a~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------------~ 541 (950)
T 3htx_A 476 ECSPRKFYEKENDAIQNASLKALLWFSKFFADLDVDGEQSCDTDDDQDTKSSSPNVFAAPPILQK--------------E 541 (950)
T ss_dssp EECCSCCCSSHHHHHHHHHHHHHHHHHTSSCCC-----------------------------------------------
T ss_pred ccChhhhhhhccHHHHHHHHHHHHHHHHHHhccCCchhhcccccccccccccchhhhhhhhcccc--------------c
Confidence 99999999999999999999999999999999999999999999999999999999999999999 9
Q ss_pred cccccccccCCCCceeEeecCCCCCCccCCCCcEEEEEEEEEEEEeCchhhH---------------------------H
Q 002345 552 ANSINTLNAIPEHGIYCLSIGGPDSGIYPSNGCLSFISYSVSLVIEGETMKE---------------------------L 604 (933)
Q Consensus 552 ~~~~~~~~~~~~~~~~~~~i~~~d~~~~p~~gs~~~i~y~~~l~~~g~~~~~---------------------------~ 604 (933)
++|+|++|+++|+++++++| +||||+||||+|+|++|||++|| +
T Consensus 542 ~~~~~~~~~~~~~~~~~~~i---------~~gs~~~~~y~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 612 (950)
T 3htx_A 542 HSSESKNTNVLSAEKRVQSI---------TNGSVVSICYSLSLAVDPEYSSDGESPREDNESNEEMESEYSANCESSVEP 612 (950)
T ss_dssp -CCCEECC----------CC---------CTTEEEEEEEEEEEEECC----------------------------CCCEE
T ss_pred cccccccccccccceeeecc---------CCCcEEEEEEEEEEEecCcccccccccccccccccccccccccchhhhhhc
Confidence 99999999999999999999 99999999999999999999999 9
Q ss_pred hhcccceeEeecccccchhhHHhhhhccccCCccccccCC--chhhHhhhccccccccccc-----------------cc
Q 002345 605 LESREEFEFEMGTGAVIPQVEVVTAQMSVGQSACFCKELP--PQELILAAADDSARTFSLL-----------------SS 665 (933)
Q Consensus 605 ~e~~~~fef~~g~~~~shhLkvlVtq~reGqsiff~r~lP--~~dlilAAa~Ds~~dl~~L-----------------s~ 665 (933)
||||+||||+||+++|+.||+.+|+||++||+.+|++.+| +++++++|..+..+....+ ..
T Consensus 613 ies~~e~~fe~g~g~~~~~le~vV~qms~gqT~~F~~~~Pd~p~eLLLaAa~ep~R~~slLsre~~fEyals~lay~dea 692 (950)
T 3htx_A 613 IESNEEIEFEVGTGSMNPHIESEVTQMTVGEYASFKMTPPDAAEALILAVGSDTVRIRSLLSERPCLNYNILLLGVKGPS 692 (950)
T ss_dssp EEEEEEEEEEETTTCBCHHHHHHHTTCCTTCEEEEEESSCCSCHHHHHHHCSCHHHHHHHTTSCEEEEEEEEEEEEECSC
T ss_pred ccccHHHHHHHhcCCccchhhheeeeccccceeEEeccCcchHHHHHHHHhhcchhhhhhcchhhhhhHHhhhhccccch
Confidence 9999999999999999999999999999999999999999 8889998887766542211 11
Q ss_pred hhhhhhcccCCchHHHHHHHHHHHhhcCCCCEEEEEcCCcChHHHHHhcCCCCCceEEEEeCChHHHHHHHHHHhhhhhc
Q 002345 666 KDRMEQALFSPPLSKQRVEYALQHIKESCATTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSK 745 (933)
Q Consensus 666 eer~e~~~F~PPLy~qRve~Ild~L~~~~g~rVLDIGCGtG~fL~~LAr~g~~f~~VtGVDIS~emLe~ArkrL~a~ls~ 745 (933)
.++++...|.||++.+|++++++.+...++.+|||||||+|.++..|++.+++..+|+|||+|+.|++.|++++......
T Consensus 693 ~p~me~gtFsPPL~eqRle~LLelL~~~~g~rVLDVGCGTG~lai~LAr~g~p~a~VtGVDIS~emLe~AReRLa~~lnA 772 (950)
T 3htx_A 693 EERMEAAFFKPPLSKQRVEYALKHIRESSASTLVDFGCGSGSLLDSLLDYPTSLQTIIGVDISPKGLARAAKMLHVKLNK 772 (950)
T ss_dssp CCCCCCCCSSSCHHHHHHHHHHHHHHHSCCSEEEEETCSSSHHHHHHTSSCCCCCEEEEEESCHHHHHHHHHHHHHHTTT
T ss_pred hhHHhhCcCCchHHHHHHHHHHHHhcccCCCEEEEECCCCCHHHHHHHHhCCCCCeEEEEECCHHHHHHHHHHhhhccch
Confidence 24555667899999999999999998888999999999999999999998744569999999999999999877643211
Q ss_pred ccccCCCCCCCccEEEEEcCccccCCCCCCccEEEEccccccCChhHHHHHHHHHHHccCCCEEEEEecCCchhHHHHhh
Q 002345 746 KLDAAVPCTDVKSAVLFDGSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPRILIVSTPNYEYNAILQKS 825 (933)
Q Consensus 746 ~~~~~~Pr~~~~nVefi~GDaedLp~~~~sFDlVVc~eVLEHLpdD~l~aL~eeI~rlLKPG~LIITTPN~efNs~f~~l 825 (933)
.+.+..+++++++|+.++++.++.||+|+|.+++||++++....+.++++++||||.++|++||.+||..|..+
T Consensus 773 ------kr~gl~nVefiqGDa~dLp~~d~sFDlVV~~eVLeHL~dp~l~~~L~eI~RvLKPG~LIISTPN~eyN~lF~~L 846 (950)
T 3htx_A 773 ------EACNVKSATLYDGSILEFDSRLHDVDIGTCLEVIEHMEEDQACEFGEKVLSLFHPKLLIVSTPNYEFNTILQRS 846 (950)
T ss_dssp ------TCSSCSEEEEEESCTTSCCTTSCSCCEEEEESCGGGSCHHHHHHHHHHHHHTTCCSEEEEEECBGGGHHHHTCC
T ss_pred ------hhcCCCceEEEECchHhCCcccCCeeEEEEeCchhhCChHHHHHHHHHHHHHcCCCEEEEEecCchhhhhhhhc
Confidence 02345689999999999998889999999999999999777667777899999999999999999999998765
Q ss_pred ccCcCCCCCcchhhhccccccCCCcccccCHHHHHHHHHHHHHHcCcEEEEEeecCCCCCCCCccceeEEEecCCCCCCc
Q 002345 826 SSTIQEDDPDEKTQLQSCKFRNHDHKFEWTRDQFNCWATELAARHNYSVEFSGVGGSGDREPGFASQIAVFRSRTPPEED 905 (933)
Q Consensus 826 ~~~g~~eYpdEp~g~~~~~fRh~DHkFeWTreEF~~Was~LA~r~GYsVEF~GVG~~p~~~~Gf~TQIAVF~R~~~~~~~ 905 (933)
.+.....+++. .....+|+.+|+|+|++++|+.|++.++.++||.|+|.|+|..+.++.|+++||+||+| ..+..+
T Consensus 847 np~tr~~dPd~---~~~~~fRh~DHrFEWTReEFr~Wae~LAer~GYsVefvGVGDg~ep~vG~~TQiAVFtR-~~~g~d 922 (950)
T 3htx_A 847 TPETQEENNSE---PQLPKFRNHDHKFEWTREQFNQWASKLGKRHNYSVEFSGVGGSGEVEPGFASQIAIFRR-EASSVE 922 (950)
T ss_dssp ---------------CCSSCSCSSCSCCBCHHHHHHHHHHHHHHTTEEEEEEEESSCSSSTTCCSEEEEEEEE-SCC---
T ss_pred ccccccccccc---cccccccccCcceeecHHHHHHHHHHHHHhcCcEEEEEccCCCCCCCCCCccEEEEEEE-CCCchh
Confidence 33322233332 23567999999999999999999999999999999999999987778999999999999 656666
Q ss_pred ccccCCCCcCceeEEEEecCCCC
Q 002345 906 DLLKDGDSAHHYKVIWEWDGNGL 928 (933)
Q Consensus 906 ~~~~~~~~~~~Yk~v~~w~~~~~ 928 (933)
.+.+.. -.+||.+|||.++..
T Consensus 923 ~l~e~~--~~~~~~~W~w~~~~~ 943 (950)
T 3htx_A 923 NVAESS--MQPYKVIWEWKKEDV 943 (950)
T ss_dssp --CCCC--CCCSCEEEEEECC--
T ss_pred hcchhh--cchHHHhcccCCccc
Confidence 665555 489999999988764
|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* | Back alignment and structure |
|---|
| >4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* | Back alignment and structure |
|---|
| >3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} | Back alignment and structure |
|---|
| >2b7v_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l2k_B | Back alignment and structure |
|---|
| >3p1x_A Interleukin enhancer-binding factor 3; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1x49_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} | Back alignment and structure |
|---|
| >2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} | Back alignment and structure |
|---|
| >3llh_A RISC-loading complex subunit tarbp2; DSRBD, DSRM, microrna, RNA binding protein; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1ekz_A DSRBDIII, maternal effect protein (staufen); structure, protein/RNA, protein DSRBD, RNA hairpin; NMR {Drosophila melanogaster} SCOP: d.50.1.1 PDB: 1stu_A | Back alignment and structure |
|---|
| >2l33_A Interleukin enhancer-binding factor 3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, DRBM; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >2dix_A Interferon-inducible double stranded RNA- dependent protein kinase activator A; structure genomics, DSRM domain, hypothetical protein PRKRA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >1uhz_A Staufen (RNA binding protein) homolog 2; DSRM, staufen homolog 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* | Back alignment and structure |
|---|
| >1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* | Back alignment and structure |
|---|
| >1di2_A XLRBPA, double stranded RNA binding protein A; protein-RNA complex, protein-RNA interactions, RNA-bining protein; 1.90A {Xenopus laevis} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} | Back alignment and structure |
|---|
| >3adj_A F21M12.9 protein; HYL1, miRNA processing, RNA binding protein, gene regulation; 3.00A {Arabidopsis thaliana} PDB: 2l2m_A | Back alignment and structure |
|---|
| >2cpn_A TAR RNA-binding protein 2; double-stranded RNA binding domain, DSRBD, DSRM., structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A | Back alignment and structure |
|---|
| >1s29_A LA protein; winged helix-turn-helix, autoantigen, RNA-binding, RNA binding protein; 1.60A {Trypanosoma brucei} SCOP: a.4.5.46 | Back alignment and structure |
|---|
| >3adl_A RISC-loading complex subunit tarbp2; TRBP2, miRNA processing, gene regulation-RNA complex; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ljh_A Double-stranded RNA-specific editase ADAR; DSRBD, DSRBM, editing, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1x48_A Interferon-induced, double-stranded RNA- activated protein kinase; structure genomics, DSRM domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >3adg_A F21M12.9 protein; HYL1, miRNA processing mechanism, RNA binding protein, gene regulation; 1.70A {Arabidopsis thaliana} PDB: 3adi_A | Back alignment and structure |
|---|
| >1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2b7t_A Double-stranded RNA-specific editase 1; RNA editing, RNA-binding protein, hydrolase; NMR {Rattus norvegicus} SCOP: d.50.1.1 PDB: 2l3c_A | Back alignment and structure |
|---|
| >3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* | Back alignment and structure |
|---|
| >1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 | Back alignment and structure |
|---|
| >2dmy_A Spermatid perinuclear RNA-binding protein; DSRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A | Back alignment and structure |
|---|
| >2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A | Back alignment and structure |
|---|
| >3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2l2n_A Hyponastic leave 1; DSRBD, miRNA, RNA binding protein, plant protein; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* | Back alignment and structure |
|---|
| >1uil_A Double-stranded RNA-binding motif; structural genomics, DSRM, riken structural genomics/proteomics initiative, RSGI RNA binding protein; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs7_A | Back alignment and structure |
|---|
| >1whn_A Hypothetical protein riken cDNA 2310016K04; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2khx_A Ribonuclease 3; drosha, RNA binding domain, hydrolase, gene regulation, NUCL protein, gene regulation,nuclear protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} | Back alignment and structure |
|---|
| >1whq_A RNA helicase A; double-stranded RNA binding domain, DSRBD, DSRM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Mus musculus} SCOP: d.50.1.1 PDB: 2rs6_A | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} | Back alignment and structure |
|---|
| >2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1x47_A DGCR8 protein; structural genomics, DSRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A | Back alignment and structure |
|---|
| >3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* | Back alignment and structure |
|---|
| >1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t4n_A Ribonuclease III; DSRBD, RNA-binding, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.50.1.1 | Back alignment and structure |
|---|
| >2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2nug_A Ribonuclease III, RNAse III; dsRNA, RNA interference, endonucleolytic cleavage, hydrolase/RNA complex; 1.70A {Aquifex aeolicus} SCOP: a.149.1.1 d.50.1.1 PDB: 1yyw_A 2nue_A 2nuf_A 1yyk_A 1yz9_A 1yyo_A 2ez6_A 1rc7_A 1i4s_A 1jfz_A 1rc5_A | Back alignment and structure |
|---|
| >1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A | Back alignment and structure |
|---|
| >2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* | Back alignment and structure |
|---|
| >1o0w_A Ribonuclease III, RNAse III; TM1102, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.00A {Thermotoga maritima} SCOP: a.149.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* | Back alignment and structure |
|---|
| >1t4o_A Ribonuclease III; RNT1P, DSRBD, RNA-binding, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: d.50.1.1 PDB: 1t4l_B 2lbs_B | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} | Back alignment and structure |
|---|
| >2cqk_A C-MPL binding protein; LA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.5.46 | Back alignment and structure |
|---|
| >2l3j_A Double-stranded RNA-specific editase 1; editing, dsRNA recognition, DSRBM, hydrolase-RNA complex; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1qu6_A Protein kinase PKR; dsRNA-binding domain, solution structure, transferase; NMR {Homo sapiens} SCOP: d.50.1.1 d.50.1.1 | Back alignment and structure |
|---|
| >1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* | Back alignment and structure |
|---|
| >3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A | Back alignment and structure |
|---|
| >1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A | Back alignment and structure |
|---|
| >3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A | Back alignment and structure |
|---|
| >3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >2a11_A Ribonuclease III, RNAse III; nuclease domain, structural genomic protein structure initiative; 2.10A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3n3w_A Ribonuclease III; nuclease domain, ribonuclase III, IDP90862, csgid, structura genomics; 2.21A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3c4b_A Endoribonuclease dicer; RNAse, dsRNA binding protein, ATP-binding, endonuclease, HEL hydrolase, nucleotide-binding, phosphoprotein, RN binding; HET: MSE; 1.68A {Mus musculus} PDB: 3c4t_A 2eb1_A | Back alignment and structure |
|---|
| >3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 | Back alignment and structure |
|---|
| >3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A | Back alignment and structure |
|---|
| >1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 | Back alignment and structure |
|---|
| >2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A | Back alignment and structure |
|---|
| >2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >2kou_A Dicer-like protein 4; ATP-binding, endonuclease, helicase, hydrolase, nuclease, nucleotide-binding, nucleus, RNA- binding; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3rv0_A K. polysporus DCR1; RNAse III enzyme, RNA binding protein; 2.29A {Vanderwaltozyma polyspora} | Back alignment and structure |
|---|
| >2yt4_A Protein DGCR8; DSRBD, RNA binding domain, RNA binding protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 933 | ||||
| d1s29a_ | 92 | a.4.5.46 (A:) Lupus La autoantigen N-terminal doma | 4e-04 | |
| d2dmya1 | 84 | d.50.1.1 (A:8-91) Spermatid perinuclear RNA-bindin | 6e-04 | |
| d1uhza_ | 89 | d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus muscul | 6e-04 | |
| d1qu6a2 | 89 | d.50.1.1 (A:91-179) dsRNA-dependent protein kinase | 7e-04 | |
| d1x47a1 | 85 | d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapie | 7e-04 | |
| d1o0wa2 | 69 | d.50.1.1 (A:168-236) RNase III, C-terminal domain | 0.002 | |
| d1whna_ | 128 | d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, | 0.002 | |
| d2nuga2 | 68 | d.50.1.1 (A:151-218) RNase III, C-terminal domain | 0.003 | |
| d1di2a_ | 69 | d.50.1.1 (A:) Double-stranded RNA-binding protein | 0.004 |
| >d1s29a_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Length = 92 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: La domain domain: Lupus La autoantigen N-terminal domain species: Trypanosoma brucei [TaxId: 5691]
Score = 38.2 bits (89), Expect = 4e-04
Identities = 23/110 (20%), Positives = 43/110 (39%), Gaps = 20/110 (18%)
Query: 99 NVPSAEEAWDKLIASVKHLFSNEFLSSQSPLRGHFIAALRRDGDLYGSVPASVIAVCDSK 158
++P + E KL V+ FS+ + L+G + + + G V + +
Sbjct: 3 HMPLSSENKQKLQKQVEFYFSDVNVQRDIFLKGK----MAENAE--GFVSLETLLTFK-R 55
Query: 159 LANLCKLINPKVESSHLLVLTYIMRAATRLSEFVVTSEGQLSIWRKDPYP 208
+ ++ + + A R SE +V SE L + R+DP P
Sbjct: 56 VNSVTTDVK-------------EVVEAIRPSEKLVLSEDGLMVRRRDPLP 92
|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 69 | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 128 | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 68 | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} Length = 69 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 933 | |||
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 99.81 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 99.79 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 99.73 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 99.72 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 99.7 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 99.69 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 99.68 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 99.66 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 99.64 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 99.64 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 99.64 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 99.63 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 99.59 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 99.59 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 99.58 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 99.57 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 99.54 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 99.54 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 99.54 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 99.53 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 99.48 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 99.47 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 99.47 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 99.45 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 99.45 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 99.44 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 99.43 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 99.38 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 99.37 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 99.35 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 99.33 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 99.26 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 99.23 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 99.22 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 99.21 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 99.2 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 99.18 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 99.16 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 99.16 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 99.16 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 99.14 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 99.14 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 99.13 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 99.11 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 99.1 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 99.09 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 99.04 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 99.04 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 98.96 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 98.95 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 98.89 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 98.86 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 98.83 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 98.79 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 98.7 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 98.69 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 98.68 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 98.62 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 98.61 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 98.59 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 98.57 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 98.49 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 98.44 | |
| d1af7a2 | 193 | Chemotaxis receptor methyltransferase CheR, C-term | 98.4 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 98.35 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 98.29 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 98.28 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 98.27 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 98.27 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 98.26 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 98.21 | |
| d1yuba_ | 245 | rRNA adenine dimethylase {Streptococcus pneumoniae | 98.12 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 98.09 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 98.05 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 98.04 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 97.91 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 97.9 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 97.89 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 97.89 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 97.79 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 97.78 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 97.69 | |
| d1zq9a1 | 278 | Probable dimethyladenosine transferase {Human (Hom | 97.66 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 97.64 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 97.61 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 97.6 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 97.59 | |
| d1whna_ | 128 | tRNA-dihydrouridine synthase 2-like, Dus2l (231001 | 97.52 | |
| d2cpna1 | 76 | TAR RNA-binding protein 2 {Human (Homo sapiens) [T | 97.37 | |
| d1yata_ | 113 | Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc | 97.35 | |
| d2dmya1 | 84 | Spermatid perinuclear RNA-binding protein {Human ( | 97.32 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 97.31 | |
| d1whqa_ | 99 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 97.28 | |
| d1jsxa_ | 207 | Glucose-inhibited division protein B (GidB) {Esche | 97.28 | |
| d1wg8a2 | 182 | TM0872, methyltransferase domain {Thermus thermoph | 97.25 | |
| d1kt1a2 | 111 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 97.2 | |
| d2dixa1 | 73 | Interferon-inducible double stranded RNA-dependent | 97.16 | |
| d2b7va1 | 71 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 97.15 | |
| d1q1ca1 | 120 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 97.15 | |
| d1r9ha_ | 118 | FKB-6, N-terminal domain {Caenorhabditis elegans [ | 97.06 | |
| d2ppna1 | 107 | FK-506 binding protein (FKBP12), an immunophilin { | 96.98 | |
| d1ixka_ | 313 | Hypothetical methyltransferase PH1374 {Archaeon Py | 96.92 | |
| d1qu6a1 | 90 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 96.88 | |
| d1x48a1 | 76 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 96.88 | |
| d1x49a1 | 85 | dsRNA-dependent protein kinase pkr {Mouse (Mus mus | 96.85 | |
| d1o0wa2 | 69 | RNase III, C-terminal domain {Thermotoga maritima | 96.75 | |
| d1x47a1 | 85 | Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | 96.74 | |
| d2bm8a1 | 232 | Cephalosporin hydroxylase CmcI {Streptomyces clavu | 96.72 | |
| d2b7ta1 | 73 | dsRNA-specific editase 1 {Rat (Rattus norvegicus) | 96.7 | |
| d1pbka_ | 116 | FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | 96.68 | |
| d1t4oa_ | 81 | RNase III, C-terminal domain {Baker's yeast (Sacch | 96.62 | |
| d1uhza_ | 89 | staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10 | 96.59 | |
| d1di2a_ | 69 | Double-stranded RNA-binding protein A, second dsRB | 96.59 | |
| d1ekza_ | 76 | Staufen, domain III {Fruit fly (Drosophila melanog | 96.58 | |
| d1qu6a2 | 89 | dsRNA-dependent protein kinase pkr {Human (Homo sa | 96.55 | |
| d1xdza_ | 239 | Glucose-inhibited division protein B (GidB) {Bacil | 96.44 | |
| d2okca1 | 425 | Type I restriction enzyme StySJI M protein {Bacter | 96.42 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 96.37 | |
| d1uila_ | 113 | ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus mus | 96.33 | |
| d1ej0a_ | 180 | RNA methyltransferase FtsJ {Escherichia coli [TaxI | 96.33 | |
| d1s29a_ | 92 | Lupus La autoantigen N-terminal domain {Trypanosom | 96.23 | |
| d1sqga2 | 284 | Ribosomal RNA small subunit methyltransferase B, R | 96.11 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 96.06 | |
| d2nuga2 | 68 | RNase III, C-terminal domain {Aquifex aeolicus [Ta | 95.91 | |
| d2ar0a1 | 524 | M.EcoKI {Escherichia coli [TaxId: 562]} | 95.42 | |
| d1jvwa_ | 160 | Macrophage infectivity potentiator protein (MIP) { | 95.38 | |
| d1q6ha_ | 210 | Peptidyl-prolyl cis-trans isomerase FkpA {Escheric | 95.32 | |
| d1u79a_ | 125 | FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: | 95.25 | |
| d1i4wa_ | 322 | Transcription factor sc-mtTFB {Baker's yeast (Sacc | 94.69 | |
| d2cqka1 | 88 | La-related protein 4 LARP4 {Human (Homo sapiens) [ | 94.68 | |
| d1fd9a_ | 204 | Macrophage infectivity potentiator protein (MIP) { | 94.43 | |
| d2p41a1 | 257 | An RNA cap (nucleoside-2'-O-)-methyltransferase do | 94.17 | |
| d1ix5a_ | 151 | Archaeal FKBP {Archaeon Methanococcus thermolithot | 93.09 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 92.02 | |
| d2oyra1 | 250 | Hypothetical protein YhiQ {Shigella flexneri [TaxI | 91.72 | |
| d1kt1a3 | 115 | FKBP51, N-terminal domains {Monkey (Saimiri bolivi | 91.7 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 91.54 | |
| d1zh5a1 | 99 | Lupus La autoantigen N-terminal domain {Human (Hom | 90.83 | |
| d1hxva_ | 85 | Trigger factor PPIase domain {Mycoplasma genitaliu | 90.41 | |
| d1q1ca2 | 117 | FKBP52, N-terminal domains {Human (Homo sapiens) [ | 90.06 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 88.21 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 87.67 | |
| d1g60a_ | 256 | Methyltransferase mboII {Moraxella bovis [TaxId: 4 | 87.17 | |
| d2dixa1 | 73 | Interferon-inducible double stranded RNA-dependent | 86.8 | |
| d1booa_ | 320 | m.PvuII N4 cytosine-specific DNA methyltransferase | 85.99 | |
| d1zkda1 | 365 | Hypothetical protein RPA4359 {Rhodopseudomonas pal | 84.59 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 84.43 | |
| d1whna_ | 128 | tRNA-dihydrouridine synthase 2-like, Dus2l (231001 | 84.37 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 83.65 | |
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 83.25 | |
| d1r1ua_ | 94 | Metal-sensing transcriptional repressor CzrA {Stap | 81.34 | |
| d2uyoa1 | 297 | Putative methyltransferase ML2640 {Mycobacterium l | 81.3 | |
| d1eg2a_ | 279 | m.RsrI N6 adenosine-specific DNA methyltransferase | 80.61 |
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: UbiE/COQ5-like domain: Hypothetical protein BH2331 species: Bacillus halodurans [TaxId: 86665]
Probab=99.81 E-value=1.3e-19 Score=179.95 Aligned_cols=157 Identities=15% Similarity=0.228 Sum_probs=118.6
Q ss_pred HHHHHHhhcCCCCEEEEEcCCcChHHHHHhcCCCCCceEEEEeCChHHHHHHHHHHhhhhhcccccCCCCCCCccEEEEE
Q 002345 684 EYALQHIKESCATTLVDFGCGSGSLLDSLLDYPTALEKIVGVDISQKSLSRAAKIIHSKLSKKLDAAVPCTDVKSAVLFD 763 (933)
Q Consensus 684 e~Ild~L~~~~g~rVLDIGCGtG~fL~~LAr~g~~f~~VtGVDIS~emLe~ArkrL~a~ls~~~~~~~Pr~~~~nVefi~ 763 (933)
..+++.+...++.+|||||||+|.++..|++.+ .+|+|+|+|+.|++.|++++.. .+.+++++++
T Consensus 5 ~~ll~~~~l~~~~rVLDiGcG~G~~~~~l~~~~---~~v~gvD~s~~~i~~A~~~~~~------------~~~~~i~~~~ 69 (231)
T d1vl5a_ 5 AKLMQIAALKGNEEVLDVATGGGHVANAFAPFV---KKVVAFDLTEDILKVARAFIEG------------NGHQQVEYVQ 69 (231)
T ss_dssp HHHHHHHTCCSCCEEEEETCTTCHHHHHHGGGS---SEEEEEESCHHHHHHHHHHHHH------------TTCCSEEEEE
T ss_pred HHHHHhcCCCCcCEEEEecccCcHHHHHHHHhC---CEEEEEECCHHHHhhhhhcccc------------cccccccccc
Confidence 345677777788999999999999999999987 6899999999999999887652 3557899999
Q ss_pred cCccccCCCCCCccEEEEccccccCChhHHHHHHHHHHHccCCC-EEEEEecCCchhHHHHhhccCcCCCCCcchhhhcc
Q 002345 764 GSITVFDSRLHGFDIGTCLEVIEHMEEDEASQFGNIVLSSFRPR-ILIVSTPNYEYNAILQKSSSTIQEDDPDEKTQLQS 842 (933)
Q Consensus 764 GDaedLp~~~~sFDlVVc~eVLEHLpdD~l~aL~eeI~rlLKPG-~LIITTPN~efNs~f~~l~~~g~~eYpdEp~g~~~ 842 (933)
+|++++++++++||+|+|.+++||++ ++...+. ++.++|||| .++|.+++..-+..+.... + ..
T Consensus 70 ~d~~~l~~~~~~fD~v~~~~~l~~~~-d~~~~l~-~~~r~LkpgG~l~i~~~~~~~~~~~~~~~-----~--------~~ 134 (231)
T d1vl5a_ 70 GDAEQMPFTDERFHIVTCRIAAHHFP-NPASFVS-EAYRVLKKGGQLLLVDNSAPENDAFDVFY-----N--------YV 134 (231)
T ss_dssp CCC-CCCSCTTCEEEEEEESCGGGCS-CHHHHHH-HHHHHEEEEEEEEEEEEEBCSSHHHHHHH-----H--------HH
T ss_pred cccccccccccccccccccccccccC-CHHHHHH-HHHHhcCCCcEEEEEeCCCCCCHHHHHHH-----H--------HH
Confidence 99999998899999999999999998 5555655 599999999 6777665432233332211 0 01
Q ss_pred ccccCCCcccccCHHHHHHHHHHHHHHcCcEE
Q 002345 843 CKFRNHDHKFEWTRDQFNCWATELAARHNYSV 874 (933)
Q Consensus 843 ~~fRh~DHkFeWTreEF~~Was~LA~r~GYsV 874 (933)
.......|...|+.+++.+ +.++.||.+
T Consensus 135 ~~~~~~~~~~~~~~~~~~~----~l~~aGf~~ 162 (231)
T d1vl5a_ 135 EKERDYSHHRAWKKSDWLK----MLEEAGFEL 162 (231)
T ss_dssp HHHHCTTCCCCCBHHHHHH----HHHHHTCEE
T ss_pred HhhcccCcccCCCHHHHHH----HHHHCCCEE
Confidence 1122345556688888874 455678876
|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dmya1 d.50.1.1 (A:8-91) Spermatid perinuclear RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1whqa_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b7va1 d.50.1.1 (A:1-71) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1qu6a1 d.50.1.1 (A:1-90) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x48a1 d.50.1.1 (A:8-83) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x49a1 d.50.1.1 (A:8-92) dsRNA-dependent protein kinase pkr {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o0wa2 d.50.1.1 (A:168-236) RNase III, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1x47a1 d.50.1.1 (A:8-92) Dgcr8 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} | Back information, alignment and structure |
|---|
| >d2b7ta1 d.50.1.1 (A:1-73) dsRNA-specific editase 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4oa_ d.50.1.1 (A:) RNase III, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uhza_ d.50.1.1 (A:) staufen homolog 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1di2a_ d.50.1.1 (A:) Double-stranded RNA-binding protein A, second dsRBD {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ekza_ d.50.1.1 (A:) Staufen, domain III {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1qu6a2 d.50.1.1 (A:91-179) dsRNA-dependent protein kinase pkr {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1uila_ d.50.1.1 (A:) ATP-dependent RNA helicase A, Dhx9 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s29a_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nuga2 d.50.1.1 (A:151-218) RNase III, C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cqka1 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1zh5a1 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} | Back information, alignment and structure |
|---|
| >d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} | Back information, alignment and structure |
|---|
| >d2dixa1 d.50.1.1 (A:7-79) Interferon-inducible double stranded RNA-dependent protein kinase activator A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1whna_ d.50.1.1 (A:) tRNA-dihydrouridine synthase 2-like, Dus2l (2310016k04Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
| >d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|