Citrus Sinensis ID: 002880

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-

MSSNSNRIETYEDFVKVHGVLLAASGLPQSLHRQLFQKLTTETFDAGSYFKIEVCEDGRQRRLVLDSQSMPKESNVFLVDHAWTFRLSDAFSQLQEVPGLAQRMASLMCVDTDLDTDIEEVDAVKGVLHENGTKSNVEDILESEIHNATEKGDGTVKWLELEDADIGDDMLLSLNLSSKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEIYNSNFTINFGEWALGFCGEVYDKDNPSSLCLRDRPLQSVTSLDLSNRCIHNLVNKAFSPAEMPSLSHLNIRGNPLEQNSVRELLEVLKGFPCLQSLGVDIPGPLGESAIEILESLPTLCTLNGVTASKILEEGKHVIDSMLQPRLPEWSADQPLADRVLSAMWLYLMTYRLANEEKIDETSVWYVMDELGSAVRHSDEPNFRVAPFLFMPEGKLSSAVSFSILWPIQNVYKRDECTRDFLYGIGEDKQRSARLTAWFHTPQSYFINEYEKHCQKLQFKSLSYTPTKSSNTESLHRSDGCASRVYTDIPYVEEFLTRTEFVITTEPKDADIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVMKHHLAETVQKAHGSPEWLQPTYNLETHLPQLIGDYYVRKRDGLNNLWILKPWNMARTIDTSVTDDLSAVIRLMETGPKICQKYIEFPALFQGRKFDLRYIVLVRSMDPLEIFLSDVFWVRLANNPYSLDKHSFFEYETHFTVMNYGRRFNHMNTPDFVRGFEAEHQVKWLEIHQRVKNTIRSVFEAAAVAHPEMHSSKSRAMYGVDIMLDSSFQPKLLEVTYCPDCTRACKYDTEALVTGEVVKGADFFNYVFGCLFLNKTAHVTPL

cccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccEEEEEcccccEEEEEEccccccccccEEEEEEEEEEccHHHHHHHHHcHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccccHHHHHHHHccccccccccEEEEEEccccccccccccccccccccccEEEEccccccccHHHHHHHHHccccccEEEccccccccccHHHHHHHHHHcccccEEEcccccccccccHHHHccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccEEEEcccccccccccccEEEccccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccEEEcccccccccEEEEEEcccccccccccccccEEEEEEEEcccccccccEEEEEEEEcccccccccEEccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccEEEEEcHHHHHHHHHHcccEEEccccccEEEEcccccccHHHHHHccccccEEcccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHccccccEEEEccccccccccEEEEccHHHHHHHcccccEEEEEcccccccccccccEEEEEEEEccccccEEEEEcccEEEccccccccccccccccccHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcEEEEcccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccc

ccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccEEEEEEcccccEEEEEEEcccccccccEEEEEcccEEcHHHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHHHccccccHHHHHHcHHHHHHHcccccEEEEEHHHcccccHHHHccccccccccEEEEEccccccccHHHHHHHHHHccccHEEEEccccHHHcccHHHHHHHHHccccEEEEEccccccccHHHHHHcHHHccccccccccccccccccccEEcccccccccccccEEcHHHcccccEEEccccccccccHHHHHHHHHccccccEEEEcccccccHHHHHHHHHcccHHHHccccHHHHHHccccccHHHcccccccccccHHHHHHHHHHHHHHHHHcEcccccccccccEEEEEccccccccccccccEEEEEEEEccccccccEEEEEEEEEccccccccEEEHHHHcccccHHHHHHccccccccccHHHHHHccccccccccccccccccccccccccccccccEEEEEEcHHHHHHHHHccccEEEccccccEEEEEcccccccHHHHHHcccccEEcccccccEEEHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccEEEEccccHcccccEEEEccHHHHHcccccccEEEEEEEcccEEEccEEEEEEEEEEEEccccEEEEEEccEEEEEEccccccccccHHHHcccEEEEcccccccEcccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccEEEEEEccccccccccccHHEccccccEEcccHHHHHHHHHccccccccccc

mssnsnrieTYEDFVKVHGVLLaasglpqsLHRQLFQKLTtetfdagsyfkievcedgrqrrlvldsqsmpkesnvflvdhawtFRLSDAFSQLQEVPGLAQRMASLMCvdtdldtdieeVDAVKGvlhengtksnvEDILESEIhnatekgdgtvkwleledadigdDMLLSlnlsskfpdlqalslcgnkLETVEIIVQEVTKLKNLRALwlnnnpvlkkcdhcmedailqgcpkleiynsnftinfgewalgfcgevydkdnpsslclrdrplqsvtsldlsnrcihnlvnkafspaempslshlnirgnpleqNSVRELLEVLkgfpclqslgvdipgplgESAIEILESlptlctlngvTASKILEEGKHVIdsmlqprlpewsadqpLADRVLSAMWLYLMTYRLANEEKIDETSVWYVMDELgsavrhsdepnfrvapflfmpegklssaVSFSILWpiqnvykrdectrdflygigedkqrsarltawfhtpqsyfINEYEKHCQKLQfkslsytptkssnteslhrsdgcasrvytdipyveefLTRTefvittepkdadiIWTSLqvdedmktatgitdqqyvnqfpFESCLVMKHHLAETVQkahgspewlqptynlethlpqliGDYYVRkrdglnnlwilkpwnmartidtsVTDDLSAVIRLMETGPKICQKYIefpalfqgrkfdLRYIVLVRSmdpleiflSDVFWVRlannpysldkhsffeyethftvmnygrrfnhmntpdfvrgFEAEHQVKWLEIHQRVKNTIRSVFEAAAvahpemhssksraMYGVDimldssfqpkllevtycpdctrackydtealvtgevvkgadffNYVFGclflnktahvtpl

mssnsnriETYEDFVKVHGVLLAASGLPQSLHRQLFQKLTTETFDAGSYFKIEVCEDGRQRRLvldsqsmpkESNVFLVDHAWTFRLSDAFSQLQEVPGLAQRMASLMCVDTDLDTDIEEVDAVkgvlhengtksnvedILESEihnatekgdgtvKWLELEDADIGDDMLLSLNLSSKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEIYNSNFTINFGEWALGFCGEVYDKDNPSSLCLRDRPLQsvtsldlsnrCIHNLVNKAFSPAEMPSLSHLNIRGNPLEQNSVRELLEVLKGFPCLQSLGVDIPGPLGESAIEILESLPTLCTLNGVTASKILEEGKHVIDSMLQPRLPEWSADQPLADRVLSAMWLYLMTYRLANEEKIDETSVWYVMDELGSAVRHSDEPNFRVAPFLFMPEGKLSSAVSFSILWPIQNVYKRDECTRDFLYGIGEDKQRSARLTAWFHTPQSYFINEYEKHCQKLQFKSLSYTPTkssnteslhrsdgcasrvytdIPYVEEFLTRTefvittepkdadIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVMKHHLAETVQKAHGSPEWLQPTYNLETHLPQLIGDYYVRKRDGLNNLWILKPWNMARTIDTSVTDDLSAVIRLMETGPKICQKYIEFPALFQGRKFDLRYIVLVRSMDPLEIFLSDVFWVRLANNPYSLDKHSFFEYETHFTVMNYGRRFNHMNTPDFVRGFEAEHQVKWLEIHQRVKNTIRSVFEAAAvahpemhssKSRAMYGVDIMLDSSFQPKLLEVTYCPDCTRACKYDTEALVTGEVVKGADFFNYVFGCLFLNKTAHVTPL

********ETYEDFVKVHGVLLAASGLPQSLHRQLFQKLTTETFDAGSYFKIEVCEDGRQRRLVL********SNVFLVDHAWTFRLSDAFSQLQEVPGLAQRMASLMCVDTDLDTDIEEVDAVKGVLHENG****VEDILE*EIHNATEKGDGTVKWLELEDADIGDDMLLSLNLSSKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEIYNSNFTINFGEWALGFCGEVYDKDNPSSLCLRDRPLQSVTSLDLSNRCIHNLVNKAFS*********LNI******QNSVRELLEVLKGFPCLQSLGVDIPGPLGESAIEILESLPTLCTLNGVTASKILEEGKHVIDSMLQPRLPEWSADQPLADRVLSAMWLYLMTYRLANEEKIDETSVWYVMDELGSAVRHSDEPNFRVAPFLFMPEGKLSSAVSFSILWPIQNVYKRDECTRDFLYGIGEDKQRSARLTAWFHTPQSYFINEYEKHCQKLQFKSLS****************GCASRVYTDIPYVEEFLTRTEFVITTEPKDADIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVMKHHLAETVQKAHGSPEWLQPTYNLETHLPQLIGDYYVRKRDGLNNLWILKPWNMARTIDTSVTDDLSAVIRLMETGPKICQKYIEFPALFQGRKFDLRYIVLVRSMDPLEIFLSDVFWVRLANNPYSLDKHSFFEYETHFTVMNYGRRFNHMNTPDFVRGFEAEHQVKWLEIHQRVKNTIRSVFEAAAVAH*********AMYGVDIMLDSSFQPKLLEVTYCPDCTRACKYDTEALVTGEVVKGADFFNYVFGCLFLNKTA*****

**********YEDFVKVHGVLLAASGLPQSLHRQLFQKLTTETFDAGSYFKIEVCEDGRQRRLVLDSQSMPKESNVFLVDHAWTFRLSDAFSQLQEVPGLAQRMASLMCVDTDLDTDIEEVDAVKGVLHENGTKSNV*************KGDGTVKWLELEDADIGDDMLLSLNLSSKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEIYNSNFTINFGEWALGFCGEVYDKDNPSSLCLRDRPLQSVTSLDLSNRCIHNLVNKAFSPAEMPSLSHL*****************VLKGFPCLQSLGVDIPGPLGESAIEILESLPTLCTLNGVTAS*************************PLADRVLSAMWLYLMTYRLANEEKIDETSVWYVMDELGSAVRHSDEPNFRVAPFLFMPEGKLSSAVSFSILWPIQNVYKRDECTRDFLYGIGEDKQRSARLTAWFHTPQSYFINEYEKHCQ***********************DGCASRVYTDIPYVEEFLTRTEFVITTEPKDADIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVMKHHLAETVQKAHGSPEWLQPTYNLETHLPQLIGDYYVRKRDGLNNLWILKPWNMARTIDTSVTDDLSAVIRLMETGPKICQKYIEFPALFQGRKFDLRYIVLVRSMDPLEIFLSDVFWVRLANNPYSLDKHSFFEYETHFTVMNYGRRFNHMNTPDFVRGFEAEHQVKWLEIHQRVKNTIRSVFEAAAVAHP*MHSSKSRAMYGVDIMLDSSFQPKLLEVTYCPDCTRACKYDTEALVTGEVVKGADFFNYVFGCLFLNKTA*****

********ETYEDFVKVHGVLLAASGLPQSLHRQLFQKLTTETFDAGSYFKIEVCEDGRQRRLVLDSQSMPKESNVFLVDHAWTFRLSDAFSQLQEVPGLAQRMASLMCVDTDLDTDIEEVDAVKGVLHENGTKSNVEDILESEIHNATEKGDGTVKWLELEDADIGDDMLLSLNLSSKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEIYNSNFTINFGEWALGFCGEVYDKDNPSSLCLRDRPLQSVTSLDLSNRCIHNLVNKAFSPAEMPSLSHLNIRGNPLEQNSVRELLEVLKGFPCLQSLGVDIPGPLGESAIEILESLPTLCTLNGVTASKILEEGKHVIDSMLQPRLPEWSADQPLADRVLSAMWLYLMTYRLANEEKIDETSVWYVMDELGSAVRHSDEPNFRVAPFLFMPEGKLSSAVSFSILWPIQNVYKRDECTRDFLYGIGEDKQRSARLTAWFHTPQSYFINEYEKHCQKLQFKSLSY***************GCASRVYTDIPYVEEFLTRTEFVITTEPKDADIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVMKHHLAETVQKAHGSPEWLQPTYNLETHLPQLIGDYYVRKRDGLNNLWILKPWNMARTIDTSVTDDLSAVIRLMETGPKICQKYIEFPALFQGRKFDLRYIVLVRSMDPLEIFLSDVFWVRLANNPYSLDKHSFFEYETHFTVMNYGRRFNHMNTPDFVRGFEAEHQVKWLEIHQRVKNTIRSVFEAAAVAHPEMHSSKSRAMYGVDIMLDSSFQPKLLEVTYCPDCTRACKYDTEALVTGEVVKGADFFNYVFGCLFLNKTAHVTPL

******RIETYEDFVKVHGVLLAASGLPQSLHRQLFQKLTTETFDAGSYFKIEVCEDGRQRRLVLDSQSMPKESNVFLVDHAWTFRLSDAFSQLQEVPGLAQRMASLMCVDTDLDTDIEEVDAVKGVLHENGTKSNVEDILESEIHNATEKGDGTVKWLELEDADIGDDMLLSLNLSSKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEIYNSNFTINFGEWALGFCGEVYDKDNPSSLCLRDRPLQSVTSLDLSNRCIHNLVNKAFSPAEMPSLSHLNIRGNPLEQNSVRELLEVLKGFPCLQSLGVDIPGPLGESAIEILESLPTLCTLNGVTASKILEEGKHVIDSMLQPRLPEWSADQPLADRVLSAMWLYLMTYRLANEEKIDETSVWYVMDELGSAVRHSDEPNFRVAPFLFMPEGKLSSAVSFSILWPIQNVYKRDECTRDFLYGIGEDKQRSARLTAWFHTPQSYFINEYEKHCQKLQFKSLSYTPTKSSNTESLHRSDGCASRVYTDIPYVEEFLTRTEFVITTEPKDADIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVMKHHLAETVQKAHGSPEWLQPTYNLETHLPQLIGDYYVRKRDGLNNLWILKPWNMARTIDTSVTDDLSAVIRLMETGPKICQKYIEFPALFQGRKFDLRYIVLVRSMDPLEIFLSDVFWVRLANNPYSLDKHSFFEYETHFTVMNYGRRFNHMNTPDFVRGFEAEHQVKWLEIHQRVKNTIRSVFEAAAVAHPEMHSSKSRAMYGVDIMLDSSFQPKLLEVTYCPDCTRACKYDTEALVTGEVVKGADFFNYVFGCLFLNKTA*****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		871	2.2.26 [Sep-21-2011]
Q3UDE2		639	Tubulin--tyrosine ligase-	yes	no	0.506	0.690	0.368	2e-81
Q14166		644	Tubulin--tyrosine ligase-	yes	no	0.506	0.684	0.355	2e-76
A8XXC0		672	Tubulin--tyrosine ligase-	N/A	no	0.562	0.729	0.315	2e-68
Q09512		662	Tubulin--tyrosine ligase-	yes	no	0.597	0.785	0.319	2e-68
Q23AS2		1394	Tubulin glycylase 3E OS=T	N/A	no	0.226	0.141	0.297	2e-13
Q23K29		1015	Tubulin glycylase 3D OS=T	N/A	no	0.223	0.192	0.299	5e-13
Q0VC71		423	Probable tubulin polyglut	no	no	0.307	0.633	0.238	1e-12
Q5PPI9		423	Probable tubulin polyglut	no	no	0.307	0.633	0.238	1e-12
Q91V51		423	Probable tubulin polyglut	no	no	0.307	0.633	0.235	2e-12
O95922		423	Probable tubulin polyglut	no	no	0.307	0.633	0.235	3e-12

>sp\|Q3UDE2\|TTL12_MOUSE Tubulin--tyrosine ligase-like protein 12 OS=Mus musculus GN=Ttll12 PE=1 SV=1	Back alignment and function desciption

 Score =  304 bits (779), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 187/507 (36%), Positives = 270/507 (53%), Gaps = 66/507 (13%)

Query: 398 VLSAMWLYLMTYRLANEEKIDETSVWYVMDELGSAVRHSDEPNFRVAPFLFMPEGKLSSA 457
           VL  MW +  TY+LA+    ++  VWY+MDE GS ++HSD P+F  APF +MP+      
Sbjct: 161 VLEEMWKFNQTYQLAHGTAEEKVPVWYIMDEFGSRIQHSDMPSFATAPFFYMPQ-----Q 215

Query: 458 VSFSILWPIQNVYKRDECTRDFLYGIGEDKQRSARLTAW---------FHTPQ---SYFI 505
           V++++LWP++++   +E TRDF YG  +   R   L  W         F TP+    Y+ 
Sbjct: 216 VAYTLLWPLRDLDTGEEVTRDFAYGEADPLIRKCMLLPWAPADMLDLSFSTPEPPAKYYQ 275

Query: 506 NEYEKHCQKLQFKSLSYTPTKSSNTESLHRSDGCASRVYTDIPYVEEFLTRTEFVITTEP 565
              E++ +KL    L+ +P          R  G   RV+ D+  V   LT   F  T   
Sbjct: 276 AILEENKEKL---PLAISPVA--------RPQGHVFRVHCDVQQVLGHLTHPRFTFTDSE 324

Query: 566 KDADIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVMKHHLAETVQKAHG--SPEWLQ 623
            DADI +      + MK +   + Q  +NQFP E+ L +K  LA   ++A G   P WL 
Sbjct: 325 ADADIFFHFSHFKDYMKLSQE-SPQVLLNQFPCENLLTVKDCLASIARRAGGPEGPPWLP 383

Query: 624 PTYNLETHLPQLIGDYYVRKRDGLNNLWILKPWNMARTIDTSVTDDLSAVIRLMETGPKI 683
            T+NL T LPQ +  +  R+R G +N WI KPWN+AR++DT VT++L ++IR  E+ PK+
Sbjct: 384 RTFNLRTELPQFVSYFQHRERRGEDNHWICKPWNLARSLDTHVTNNLHSIIRHRESTPKV 443

Query: 684 CQKYIEFPALF-----QGRKFDLRYIVLVRSMDPLEIFLSDVFWVRLANNPYSLDKHSFF 738
             KYIE P LF        KFD+RYIVL+RS+ PL +F  DVFW+R +N P++LD     
Sbjct: 444 VSKYIESPVLFLREDVGNVKFDIRYIVLLRSVRPLRLFAYDVFWLRFSNRPFALD--DLD 501

Query: 739 EYETHFTVMNYGRR--FNHMNTPDFVRGFEAEH-QVKWLEIHQRVKNTIRSVFEAAAVAH 795
           +YE HFTVMNY        ++  +F+  FE ++ +  W ++   +      +F+ A    
Sbjct: 502 DYEKHFTVMNYDPDVVLKQVHYNEFIPQFEKQYPEFPWSDVQAEIFKAFTELFQVACAKP 561

Query: 796 PEM---HSSKSRAMYGVDIMLD--------SSFQPKLLEVTYCPDCTRACKYDTEALVTG 844
           P M       SRAMY +D+ML+           QP++LEV + PDC RAC+Y        
Sbjct: 562 PPMGLCDYPSSRAMYAIDLMLNWDNHPDGKRVMQPQILEVNFNPDCERACRYH------- 614

Query: 845 EVVKGADFFNYVFGCLFLNKT--AHVT 869
                  FFN VF  LFL++T   HVT
Sbjct: 615 -----PSFFNDVFSTLFLDETDNCHVT 636

Mus musculus (taxid: 10090)

>sp\|Q14166\|TTL12_HUMAN Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens GN=TTLL12 PE=1 SV=2	Back alignment and function description

>sp\|A8XXC0\|TTL12_CAEBR Tubulin--tyrosine ligase-like protein 12 OS=Caenorhabditis briggsae GN=ttll-12 PE=4 SV=2	Back alignment and function description

>sp\|Q09512\|TTL12_CAEEL Tubulin--tyrosine ligase-like protein 12 OS=Caenorhabditis elegans GN=ttll-12 PE=4 SV=1	Back alignment and function description

>sp\|Q23AS2\|TTL3E_TETTS Tubulin glycylase 3E OS=Tetrahymena thermophila (strain SB210) GN=TTLL3E PE=3 SV=1	Back alignment and function description

>sp\|Q23K29\|TTL3D_TETTS Tubulin glycylase 3D OS=Tetrahymena thermophila (strain SB210) GN=TTLL3D PE=3 SV=1	Back alignment and function description

>sp\|Q0VC71\|TTLL1_BOVIN Probable tubulin polyglutamylase TTLL1 OS=Bos taurus GN=TTLL1 PE=2 SV=1	Back alignment and function description

>sp\|Q5PPI9\|TTLL1_RAT Probable tubulin polyglutamylase TTLL1 OS=Rattus norvegicus GN=Ttll1 PE=2 SV=1	Back alignment and function description

>sp\|Q91V51\|TTLL1_MOUSE Probable tubulin polyglutamylase TTLL1 OS=Mus musculus GN=Ttll1 PE=1 SV=1	Back alignment and function description

>sp\|O95922\|TTLL1_HUMAN Probable tubulin polyglutamylase TTLL1 OS=Homo sapiens GN=TTLL1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		871
224068448		868	predicted protein [Populus trichocarpa]	0.991	0.995	0.771	0.0
359484270		866	PREDICTED: tubulin--tyrosine ligase-like	0.990	0.996	0.766	0.0
147856096		870	hypothetical protein VITISV_006435 [Viti	0.995	0.996	0.764	0.0
255550449		851	protein binding protein, putative [Ricin	0.975	0.998	0.741	0.0
449452568		875	PREDICTED: tubulin--tyrosine ligase-like	0.997	0.993	0.716	0.0
449500492		875	PREDICTED: LOW QUALITY PROTEIN: tubulin-	0.997	0.993	0.715	0.0
356556388		874	PREDICTED: tubulin--tyrosine ligase-like	0.993	0.989	0.717	0.0
356556390		855	PREDICTED: tubulin--tyrosine ligase-like	0.971	0.989	0.701	0.0
297842531		854	predicted protein [Arabidopsis lyrata su	0.977	0.996	0.695	0.0
79383745		855	tubulin-tyrosine ligase [Arabidopsis tha	0.980	0.998	0.688	0.0

>gi\|224068448\|ref\|XP_002326123.1\| predicted protein [Populus trichocarpa] gi\|222833316\|gb\|EEE71793.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

 Score = 1392 bits (3603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/867 (77%), Positives = 763/867 (88%), Gaps = 3/867 (0%)

Query: 7   RIETYEDFVKVHGVLLAASGLPQSLHRQLFQKLTTETFDAGSYFKIEVCEDGRQRRLVLD 66
           +I+ YEDFVKVHG+LLAASGLP++LHR+LF KLT+ETFD G+YF+++ C+DGRQRRL+L 
Sbjct: 3   KIQAYEDFVKVHGILLAASGLPRTLHRKLFDKLTSETFDGGAYFQVDPCQDGRQRRLLLT 62

Query: 67  SQ-SMPKESNVFLVDHAWTFRLSDAFSQLQEVPGLAQRMASLMCVDTDLDTDIEEVDAVK 125
           S  SMPK+SNVFL+DHAWTFRLSDA+ QLQEVPGLAQRMA+LMCVD D ++D+EE+D   
Sbjct: 63  SAASMPKDSNVFLIDHAWTFRLSDAYKQLQEVPGLAQRMAALMCVDIDSNSDVEEIDG-D 121

Query: 126 GVLHENGTKSNVEDILESEIHNATEKGDGTVKWLELEDADIGDDMLLSLNLSSKFPDLQA 185
           GV  +  +K NV DI+E+EI  A E+G  TVKWLELE+ DI DDMLLSL+LSSKFPDL A
Sbjct: 122 GVSRDTYSKLNVTDIVENEIGYAKERGYDTVKWLELEELDIDDDMLLSLDLSSKFPDLLA 181

Query: 186 LSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEIYNSNF 245
           LSLCGNKLE VEI+VQEVTKLKNL+ALWLNNNPVL+ CD CM D I +GCP LEIYNS F
Sbjct: 182 LSLCGNKLENVEIVVQEVTKLKNLKALWLNNNPVLENCDGCMADTIFKGCPGLEIYNSCF 241

Query: 246 TINFGEWALGFCGEVYDKDNPSSLCLRDRPLQSVTSLDLSNRCIHNLVNKAFSPAEMPSL 305
           T NFGEWALGFCG VY+KDNP  +   + PLQSVTSLDLSNR IH+L+NKAFSP EMPSL
Sbjct: 242 TSNFGEWALGFCGGVYEKDNPCPIHQDNHPLQSVTSLDLSNRSIHSLINKAFSPVEMPSL 301

Query: 306 SHLNIRGNPLEQNSVRELLEVLKGFPCLQSLGVDIPGPLGESAIEILESLPTLCTLNGVT 365
           SHLNIRGNPL+QNSV EL +VLKGF  LQ+L VD+PGPLGESAIEILES+P L  LNGV 
Sbjct: 302 SHLNIRGNPLKQNSVSELFKVLKGFTSLQTLEVDLPGPLGESAIEILESVPNLSQLNGVN 361

Query: 366 ASKILEEGKHVIDSMLQPRLPEWSADQPLADRVLSAMWLYLMTYRLANEEKIDETSVWYV 425
            SKILE G HVID++LQPRLPEW+A++PLADRV++AMWLYLMTYRLA+EEKIDETSVWYV
Sbjct: 362 VSKILETGNHVIDAVLQPRLPEWTAEEPLADRVINAMWLYLMTYRLADEEKIDETSVWYV 421

Query: 426 MDELGSAVRHSDEPNFRVAPFLFMPEGKLSSAVSFSILWPIQNVYKRDECTRDFLYGIGE 485
           MDELGSA+RHSDEPNFRVAPFLFMPEG L SAVS+SILWPIQNV   DECTRDFL+GIGE
Sbjct: 422 MDELGSALRHSDEPNFRVAPFLFMPEGNLDSAVSYSILWPIQNVQNGDECTRDFLFGIGE 481

Query: 486 DKQRSARLTAWFHTPQSYFINEYEKHCQKLQFKSLSYTPTKSSNTESLHRSDGCASRVYT 545
           DKQRSARLTA+FHTPQ YFI EYEK  QKLQ KS +  P KSS++ +L R+DGCA RVYT
Sbjct: 482 DKQRSARLTAYFHTPQYYFIQEYEKFHQKLQSKSSTPLPVKSSSSRTLRRTDGCALRVYT 541

Query: 546 DIPYVEEFLTRTEFVITTEPKDADIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVMK 605
           D+P VE FLTRTEF+ITTE KDADIIWT +QVD+D+K A GITDQQY+NQFPFE+CLVMK
Sbjct: 542 DLPQVEGFLTRTEFIITTELKDADIIWTGMQVDDDVKRAAGITDQQYINQFPFEACLVMK 601

Query: 606 HHLAETVQKAHGSPEWLQPTYNLETHLPQLIGDYYVRKRDGLNNLWILKPWNMARTIDTS 665
           HHLAET+QKAHGSP+WL PTYNLE+HL QLIGDYY RKRDG+NNLWILKPWNMARTIDT+
Sbjct: 602 HHLAETIQKAHGSPDWLHPTYNLESHLSQLIGDYYARKRDGMNNLWILKPWNMARTIDTT 661

Query: 666 VTDDLSAVIRLMETGPKICQKYIEFPALFQGRKFDLRYIVLVRSMDPLEIFLSDVFWVRL 725
           VTD+LSA+IRLMETGPKICQKYIE PALF+G+KFD+RYIVLVRS+ PLE+FL+DVFWVRL
Sbjct: 662 VTDNLSAIIRLMETGPKICQKYIEHPALFEGKKFDIRYIVLVRSVKPLELFLADVFWVRL 721

Query: 726 ANNPYSLDKHSFFEYETHFTVMNYGRRFNHMNTPDFVRGFEAEHQVKWLEIHQRVKNTIR 785
           ANN Y+LDKHS FEYETHFTVMNY    NH NTP+FV+ FE EHQVKWL+IH+RV+N IR
Sbjct: 722 ANNQYTLDKHSLFEYETHFTVMNYRGILNHKNTPEFVKEFEQEHQVKWLDIHERVRNMIR 781

Query: 786 SVFEAAAVAHPEMHSSKSRAMYGVDIMLDSSFQPKLLEVTYCPDCTRACKYDTEAL-VTG 844
           SVFEAAA  HPEMHS  SRAMYGVD+MLDSSFQPKLLEVTYCPDCTRACKYDT+A+   G
Sbjct: 782 SVFEAAATVHPEMHSPMSRAMYGVDVMLDSSFQPKLLEVTYCPDCTRACKYDTQAIGGGG 841

Query: 845 EVVKGADFFNYVFGCLFLNKTAHVTPL 871
           E++KG+DF+NYVFGCLFL++T HV PL
Sbjct: 842 ELLKGSDFYNYVFGCLFLDETRHVCPL 868

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|359484270\|ref\|XP_002278055.2\| PREDICTED: tubulin--tyrosine ligase-like protein 12-like [Vitis vinifera] gi\|297738564\|emb\|CBI27809.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|147856096\|emb\|CAN82450.1\| hypothetical protein VITISV_006435 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255550449\|ref\|XP_002516275.1\| protein binding protein, putative [Ricinus communis] gi\|223544761\|gb\|EEF46277.1\| protein binding protein, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|449452568\|ref\|XP_004144031.1\| PREDICTED: tubulin--tyrosine ligase-like protein 12-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449500492\|ref\|XP_004161112.1\| PREDICTED: LOW QUALITY PROTEIN: tubulin--tyrosine ligase-like protein 12-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|356556388\|ref\|XP_003546508.1\| PREDICTED: tubulin--tyrosine ligase-like protein 12-like isoform 1 [Glycine max]	Back alignment and taxonomy information

>gi\|356556390\|ref\|XP_003546509.1\| PREDICTED: tubulin--tyrosine ligase-like protein 12-like isoform 2 [Glycine max]	Back alignment and taxonomy information

>gi\|297842531\|ref\|XP_002889147.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297334988\|gb\|EFH65406.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|79383745\|ref\|NP_177879.3\| tubulin-tyrosine ligase [Arabidopsis thaliana] gi\|47550675\|gb\|AAT35236.1\| At1g77550 [Arabidopsis thaliana] gi\|110741647\|dbj\|BAE98770.1\| hypothetical protein [Arabidopsis thaliana] gi\|332197871\|gb\|AEE35992.1\| tubulin-tyrosine ligase [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		871
TAIR\|locus:2204745		855	AT1G77550 [Arabidopsis thalian	0.979	0.997	0.688	0.0
FB\|FBgn0033225		626	CG1550 [Drosophila melanogaste	0.513	0.714	0.341	9.9e-92
MGI\|MGI:3039573		639	Ttll12 "tubulin tyrosine ligas	0.523	0.713	0.361	8.7e-91
ZFIN\|ZDB-GENE-040426-697		625	ttll12 "tubulin tyrosine ligas	0.467	0.651	0.364	5.3e-89
RGD\|1305319		639	Ttll12 "tubulin tyrosine ligas	0.528	0.719	0.348	1.8e-88
UNIPROTKB\|F1PQD3		682	TTLL12 "Uncharacterized protei	0.538	0.687	0.342	9.7e-88
UNIPROTKB\|F1N5K2		655	TTLL12 "Uncharacterized protei	0.530	0.705	0.344	9.7e-88
UNIPROTKB\|F1NZA1		627	TTLL12 "Uncharacterized protei	0.529	0.735	0.339	2.6e-87
UNIPROTKB\|Q14166		644	TTLL12 "Tubulin--tyrosine liga	0.525	0.711	0.350	5.3e-87
WB\|WBGene00008405		662	ttll-12 [Caenorhabditis elegan	0.602	0.793	0.330	2.2e-84

TAIR\|locus:2204745 AT1G77550 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 3200 (1131.5 bits), Expect = 0., P = 0.
 Identities = 597/867 (68%), Positives = 718/867 (82%)

Query:     6 NRIETYEDFVKVHGVLLAASGLPQSLHRQLFQKLTTETFDAGSYFKIEVCEDGRQRRLVL 65
             ++IE+++DFVKVHG+LLAASGLP  L+ +LF+KL  +TFD G YF+IE CED ++R+L+L
Sbjct:     2 SKIESFDDFVKVHGILLAASGLPPKLYPRLFEKLAYDTFDGGDYFQIESCEDDQRRKLLL 61

Query:    66 DSQSMPKESNVFLVDHAWTFRLSDAFSQLQEVPGLAQRMASLMCVDTDLDTDIEEVDAVK 125
              ++SMPK+S+VFLVDHAWTFRL DA+ QL+E+PGLA+RMASLM VD D+D   EEV    
Sbjct:    62 TAESMPKDSDVFLVDHAWTFRLPDAYKQLKEIPGLAERMASLMSVDIDVDAGEEEV---- 117

Query:   126 GVLHENGTKSNVEDILESEIHNATEKGDGTVKWLELEDADIGDDMLLSLNLSSKFPDLQA 185
                     + +V+ I+++EI  A +KG  +++WLELE   + DD LLSL+L SKF DL A
Sbjct:   118 ------AEELSVDQIIDNEIRYAADKGYDSLRWLELEGLGV-DDSLLSLHLPSKFQDLVA 170

Query:   186 LSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEIYNSNF 245
             LSL GNK+E+ ++++QE+ K KNL+ALWLN+NPVL+K +  M D ILQGCP LEIYNS F
Sbjct:   171 LSLIGNKIESADVVIQEIVKFKNLKALWLNDNPVLQKSERQMADEILQGCPSLEIYNSCF 230

Query:   246 TINFGEWALGFCGEVYDKDNPSSLCLR-DRPLQSVTSLDLSNRCIHNLVNKAFSPAEMPS 304
             T N+G WALGFCG+++ KDNP   C++ D+PL +VTSLDLSNR IHNLVNKAFS  EMP 
Sbjct:   231 TPNYGLWALGFCGDIFGKDNPG--CVQQDQPLCNVTSLDLSNRSIHNLVNKAFSVHEMPL 288

Query:   305 LSHLNIRGNPLEQNSVRELLEVLKGFPCLQSLGVDIPGPLGESAIEILESLPTLCTLNGV 364
             LSHLNIRGN L+QNSV ELLEVLK FP L SL VDIPGPLG +A+EILESL  L  LNGV
Sbjct:   289 LSHLNIRGNSLDQNSVGELLEVLKLFPSLSSLEVDIPGPLGINALEILESLSNLSLLNGV 348

Query:   365 TASKILEEGKHVIDSMLQPRLPEWSADQPLADRVLSAMWLYLMTYRLANEEKIDETSVWY 424
               +KILE GKHV+DSMLQPR+PE + D  L DRVL AMWLY + YRLA++EK+DETS+WY
Sbjct:   349 DTAKILETGKHVVDSMLQPRIPELNPDDTLVDRVLDAMWLYALNYRLADDEKLDETSLWY 408

Query:   425 VMDELGSAVRHSDEPNFRVAPFLFMPEGKLSSAVSFSILWPIQNVYKRDECTRDFLYGIG 484
             VMDELGSA+RHSDEPNF+VAPFLFMP GKL SAVS+S++WPI++  K DECTRDFL GIG
Sbjct:   409 VMDELGSALRHSDEPNFKVAPFLFMPSGKLESAVSYSVMWPIKHSQKGDECTRDFLSGIG 468

Query:   485 EDKQRSARLTAWFHTPQSYFINEYEKHCQKLQFKSLSYTPTKSSNTESLHRSDGCASRVY 544
             EDKQRSARLTAWF TP++YFI+E+EK+ QKLQ K+    P+  S + S+  SDG    VY
Sbjct:   469 EDKQRSARLTAWFQTPENYFIHEFEKYQQKLQAKAFESKPSNPSVSRSIQHSDGSPLLVY 528

Query:   545 TDIPYVEEFLTRTEFVITTEPKDADIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVM 604
             TD+P VEEFLTR EFVIT EPKDADI+WTS+QVD+++K   GITD QY+NQFPFE+CLVM
Sbjct:   529 TDLPQVEEFLTRPEFVITNEPKDADILWTSVQVDDELKKEVGITDDQYINQFPFEACLVM 588

Query:   605 KHHLAETVQKAHGSPEWLQPTYNLETHLPQLIGDYYVRKRDGLNNLWILKPWNMARTIDT 664
             KHHLAET+Q  +GSP+WLQPTYNLET L Q IGDY VRKRD LNNLWILKPWNMARTIDT
Sbjct:   589 KHHLAETIQMGYGSPKWLQPTYNLETQLSQFIGDYCVRKRDQLNNLWILKPWNMARTIDT 648

Query:   665 SVTDDLSAVIRLMETGPKICQKYIEFPALFQGRKFDLRYIVLVRSMDPLEIFLSDVFWVR 724
             S+TD+LSA+IR+METGPKICQKYIE PALF+G KFDLRY+VLVRS+DPLEI+L ++FWVR
Sbjct:   649 SITDNLSAIIRMMETGPKICQKYIEHPALFKGNKFDLRYVVLVRSIDPLEIYLIEIFWVR 708

Query:   725 LANNPYSLDKHSFFEYETHFTVMNYGRRFNHMNTPDFVRGFEAEHQVKWLEIHQRVKNTI 784
             L+NNPYSL+KHSFFEYETHFTVMNYGR+ NH  T +FVR FE EH VKW++IH++VK  I
Sbjct:   709 LSNNPYSLEKHSFFEYETHFTVMNYGRKLNHKPTAEFVREFEQEHNVKWMDIHEKVKQVI 768

Query:   785 RSVFEAAAVAHPEMHSSKSRAMYGVDIMLDSSFQPKLLEVTYCPDCTRACKYDTEALVTG 844
             R+VFEAAA+AHPEM S KSRAMYGVD+MLDSSF+PK+LEVTYCPDC RACKYD E +   
Sbjct:   769 RAVFEAAALAHPEMQSPKSRAMYGVDVMLDSSFEPKILEVTYCPDCMRACKYDMETIDGK 828

Query:   845 EVVKGADFFNYVFGCLFLNKTAHVTPL 871
              +VKG DFFN VFGCLFL++TAHVTPL
Sbjct:   829 GIVKGGDFFNNVFGCLFLDETAHVTPL 855

GO:0004835 "tubulin-tyrosine ligase activity" evidence=IEA;ISS

GO:0005737 "cytoplasm" evidence=ISM

GO:0006464 "cellular protein modification process" evidence=IEA;ISS

GO:0009507 "chloroplast" evidence=IDA

GO:0005829 "cytosol" evidence=RCA

GO:0042991 "transcription factor import into nucleus" evidence=RCA

FB\|FBgn0033225 CG1550 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

MGI\|MGI:3039573 Ttll12 "tubulin tyrosine ligase-like family, member 12" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-697 ttll12 "tubulin tyrosine ligase-like family, member 12" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

RGD\|1305319 Ttll12 "tubulin tyrosine ligase-like family, member 12" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PQD3 TTLL12 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N5K2 TTLL12 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NZA1 TTLL12 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q14166 TTLL12 "Tubulin--tyrosine ligase-like protein 12" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

WB\|WBGene00008405 ttll-12 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	fgenesh4_pg.C_scaffold_28000022	hypothetical protein (868 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		871
pfam03133		291	pfam03133, TTL, Tubulin-tyrosine ligase family	7e-52
cd00116		319	cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo	0.003

>gnl\|CDD\|217380 pfam03133, TTL, Tubulin-tyrosine ligase family	Back alignment and domain information

 Score =  182 bits (465), Expect = 7e-52
 Identities = 73/283 (25%), Positives = 120/283 (42%), Gaps = 24/283 (8%)

Query: 591 QYVNQFPFESCLV----MKHHLAETVQKAHGSPEWLQPTYNLETHLPQLIGDYYVRKRDG 646
           Q +N FP    +     +  ++           ++L  T+ L    P  + ++     D 
Sbjct: 9   QALNHFPGSYEITRKDLLWKNIKRQPCDFGRKFDFLPRTFIL----PTDLAEFVDYFEDN 64

Query: 647 LNNLWILKPWNMARTIDTSVTDDLSAVIRLMETGPKICQKYIEFPALFQGRKFDLRYIVL 706
             N WI+KP   AR     +T+DLS +++ +++ P + QKYIE P L  GRKFD+R  VL
Sbjct: 65  ERNTWIVKPSASARGRGIRITNDLSQILKQIQSRPLVVQKYIERPLLIDGRKFDIRLYVL 124

Query: 707 VRSMDPLEIFLSDVFWVRLANNPYSLDKHSFFEYETHFTVMNY-------GRRFNHMNTP 759
           V S++PL +++     +R A+  YS       + E H T  +           +N  N  
Sbjct: 125 VTSVNPLRVYVYREGLLRFASVKYSPSVSDLDDVEMHLTNYSIQKKSSSLNEDYNEPNGH 184

Query: 760 D-FVRGFEA-EHQVKWLEIHQRVKNTIRSVFEAAAVAHPEMHSSK---SRAMYGVDIMLD 814
              +  F     +    EI   +++ I     AA V    ++         +YG D M+D
Sbjct: 185 KWSLFNFWKYLEEKDKEEIWLEIESIIIKTILAAEVEASRLNVQPLYNCFELYGFDFMID 244

Query: 815 SSFQPKLLEVTYCPDCTRACKYDTEALVTGEVVKGADFFNYVF 857
            + +P LLEV   P      K D  A +  +++   D  N V 
Sbjct: 245 ENLKPWLLEVNASPSLHSTTKLD--ARLKEQLID--DVLNSVV 283

Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed. This modification cycle involves a specific carboxypeptidase and the activity of the tubulin-tyrosine ligase (TTL). The true physiological function of TTL has so far not been established. Tubulin-tyrosine ligase (TTL) catalyzes the ATP-dependent post-translational addition of a tyrosine to the carboxy terminal end of detyrosinated alpha-tubulin. In normally cycling cells, the tyrosinated form of tubulin predominates. However, in breast cancer cells, the detyrosinated form frequently predominates, with a correlation to tumour aggressiveness. On the other hand, 3-nitrotyrosine has been shown to be incorporated, by TTL, into the carboxy terminal end of detyrosinated alpha-tubulin. This reaction is not reversible by the carboxypeptidase enzyme. Cells cultured in 3-nitrotyrosine rich medium showed evidence of altered microtubule structure and function, including altered cell morphology, epithelial barrier dysfunction, and apoptosis. Bacterial homologs of TTL are predicted to form peptide tags. Some of these are fused to a 2-oxoglutarate Fe(II)-dependent dioxygenase domain. Length = 291

>gnl\|CDD\|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		871
KOG2155		631	consensus Tubulin-tyrosine ligase-related protein	100.0
PF03133		292	TTL: Tubulin-tyrosine ligase family; InterPro: IPR	100.0
KOG2156		662	consensus Tubulin-tyrosine ligase-related protein	100.0
KOG2157		497	consensus Predicted tubulin-tyrosine ligase [Postt	100.0
KOG2158		565	consensus Tubulin-tyrosine ligase-related protein	99.97
PF14398		262	ATPgrasp_YheCD: YheC/D like ATP-grasp	99.79
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	99.36
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	99.23
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	99.22
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.17
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.15
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	99.12
KOG0617		264	consensus Ras suppressor protein (contains leucine	99.03
KOG4194		873	consensus Membrane glycoprotein LIG-1 [Signal tran	99.02
PF14580		175	LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ	98.96
KOG0444		1255	consensus Cytoskeletal regulator Flightless-I (con	98.9
KOG2982		418	consensus Uncharacterized conserved protein [Funct	98.85
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.84
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	98.81
KOG0472		565	consensus Leucine-rich repeat protein [Function un	98.78
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.75
PRK15387		788	E3 ubiquitin-protein ligase SspH2; Provisional	98.75
PF08443		190	RimK: RimK-like ATP-grasp domain; InterPro: IPR013	98.74
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.74
cd00116		319	LRR_RI Leucine-rich repeats (LRRs), ribonuclease i	98.71
TIGR00768		277	rimK_fam alpha-L-glutamate ligases, RimK family. T	98.71
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.65
KOG1259		490	consensus Nischarin, modulator of integrin alpha5	98.64
TIGR02144		280	LysX_arch Lysine biosynthesis enzyme LysX. The fam	98.55
KOG0617		264	consensus Ras suppressor protein (contains leucine	98.54
KOG3207		505	consensus Beta-tubulin folding cofactor E [Posttra	98.43
KOG0472		565	consensus Leucine-rich repeat protein [Function un	98.43
PF13535		184	ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A	98.41
KOG0618		1081	consensus Serine/threonine phosphatase 2C containi	98.41
PLN03150		623	hypothetical protein; Provisional	98.41
PLN03210		1153	Resistant to P. syringae 6; Provisional	98.37
PRK01372		304	ddl D-alanine--D-alanine ligase; Reviewed	98.35
PRK10446		300	ribosomal protein S6 modification protein; Provisi	98.34
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	98.34
PLN03210		1153	Resistant to P. syringae 6; Provisional	98.31
TIGR02291		317	rimK_rel_E_lig alpha-L-glutamate ligase-related pr	98.28
PRK01966		333	ddl D-alanyl-alanine synthetase A; Reviewed	98.28
PRK14571		299	D-alanyl-alanine synthetase A; Provisional	98.27
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.26
COG0189		318	RimK Glutathione synthase/Ribosomal protein S6 mod	98.23
PRK14568		343	vanB D-alanine--D-lactate ligase; Provisional	98.21
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	98.18
PRK05246		316	glutathione synthetase; Provisional	98.17
PF07478		203	Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In	98.17
PLN02941		328	inositol-tetrakisphosphate 1-kinase	98.14
TIGR01205		315	D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a	98.14
PLN03150		623	hypothetical protein; Provisional	98.14
PRK15370		754	E3 ubiquitin-protein ligase SlrP; Provisional	98.12
PRK14569		296	D-alanyl-alanine synthetase A; Provisional	98.12
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	98.06
PF02655		161	ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806	98.03
KOG4237		498	consensus Extracellular matrix protein slit, conta	98.01
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	98.0
PF13855		61	LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF	98.0
PF02955		173	GSH-S_ATP: Prokaryotic glutathione synthetase, ATP	97.99
PRK14570		364	D-alanyl-alanine synthetase A; Provisional	97.98
PRK14572		347	D-alanyl-alanine synthetase A; Provisional	97.96
PRK12458		338	glutathione synthetase; Provisional	97.93
TIGR01161		352	purK phosphoribosylaminoimidazole carboxylase, Pur	97.89
KOG1909		382	consensus Ran GTPase-activating protein [RNA proce	97.87
KOG4237		498	consensus Extracellular matrix protein slit, conta	97.82
TIGR03103		547	trio_acet_GNAT GNAT-family acetyltransferase TIGR0	97.75
KOG1859		1096	consensus Leucine-rich repeat proteins [General fu	97.75
TIGR01380		312	glut_syn glutathione synthetase, prokaryotic. This	97.75
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.72
PLN02257		434	phosphoribosylamine--glycine ligase	97.63
TIGR01142		380	purT phosphoribosylglycinamide formyltransferase 2	97.63
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.61
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	97.6
COG4886		394	Leucine-rich repeat (LRR) protein [Function unknow	97.56
PRK06019		372	phosphoribosylaminoimidazole carboxylase ATPase su	97.56
PF14397		285	ATPgrasp_ST: Sugar-transfer associated ATP-grasp	97.55
COG1181		317	DdlA D-alanine-D-alanine ligase and related ATP-gr	97.55
PRK09288		395	purT phosphoribosylglycinamide formyltransferase 2	97.51
PRK00885		420	phosphoribosylamine--glycine ligase; Provisional	97.51
PRK12767		326	carbamoyl phosphate synthase-like protein; Provisi	97.51
KOG2123		388	consensus Uncharacterized conserved protein [Funct	97.48
PRK06849		389	hypothetical protein; Provisional	97.46
PRK13790		379	phosphoribosylamine--glycine ligase; Provisional	97.45
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.45
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	97.44
PF12799		44	LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_	97.42
KOG1644		233	consensus U2-associated snRNP A' protein [RNA proc	97.41
COG1821		307	Predicted ATP-utilizing enzyme (ATP-grasp superfam	97.4
PRK06524		493	biotin carboxylase-like protein; Validated	97.39
PRK02186		887	argininosuccinate lyase; Provisional	97.39
PRK07206		416	hypothetical protein; Provisional	97.37
KOG2120		419	consensus SCF ubiquitin ligase, Skp2 component [Po	97.34
PRK13789		426	phosphoribosylamine--glycine ligase; Provisional	97.32
KOG4579		177	consensus Leucine-rich repeat (LRR) protein associ	97.3
KOG0531		414	consensus Protein phosphatase 1, regulatory subuni	97.3
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	97.28
TIGR00877		423	purD phosphoribosylamine--glycine ligase. This enz	97.28
PRK05586		447	biotin carboxylase; Validated	97.25
PRK05294		1066	carB carbamoyl phosphate synthase large subunit; R	97.22
TIGR02068		864	cya_phycin_syn cyanophycin synthetase. Cyanophycin	97.19
TIGR00514		449	accC acetyl-CoA carboxylase, biotin carboxylase su	97.17
KOG0532		722	consensus Leucine-rich repeat (LRR) protein, conta	97.14
PRK14573		809	bifunctional D-alanyl-alanine synthetase A/UDP-N-a	97.09
TIGR01369		1050	CPSaseII_lrg carbamoyl-phosphate synthase, large s	97.07
PRK08591		451	acetyl-CoA carboxylase biotin carboxylase subunit;	97.02
PRK13278		358	purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D	97.0
KOG4341		483	consensus F-box protein containing LRR [General fu	96.99
PRK08463		478	acetyl-CoA carboxylase subunit A; Validated	96.98
PRK06111		450	acetyl-CoA carboxylase biotin carboxylase subunit;	96.95
PRK08462		445	biotin carboxylase; Validated	96.94
PRK13277		366	5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo	96.9
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	96.9
TIGR01235		1143	pyruv_carbox pyruvate carboxylase. This enzyme pla	96.88
KOG2982		418	consensus Uncharacterized conserved protein [Funct	96.88
PRK12833		467	acetyl-CoA carboxylase biotin carboxylase subunit;	96.86
PRK14016		727	cyanophycin synthetase; Provisional	96.84
TIGR01435		737	glu_cys_lig_rel glutamate--cysteine ligase/gamma-g	96.82
KOG2123		388	consensus Uncharacterized conserved protein [Funct	96.81
KOG2739		260	consensus Leucine-rich acidic nuclear protein [Cel	96.8
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.8
PLN02948		577	phosphoribosylaminoimidazole carboxylase	96.78
PRK07178		472	pyruvate carboxylase subunit A; Validated	96.73
PRK08654		499	pyruvate carboxylase subunit A; Validated	96.72
PRK12999		1146	pyruvate carboxylase; Reviewed	96.7
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.55
PRK06395		435	phosphoribosylamine--glycine ligase; Provisional	96.49
PF15632		329	ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa	96.47
KOG1947		482	consensus Leucine rich repeat proteins, some prote	96.45
COG5238		388	RNA1 Ran GTPase-activating protein (RanGAP) involv	96.4
KOG3665		699	consensus ZYG-1-like serine/threonine protein kina	96.28
PRK02471		752	bifunctional glutamate--cysteine ligase/glutathion	96.27
), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01071">PF01071		194	GARS_A: Phosphoribosylglycinamide synthetase, ATP-	96.23
KOG4341		483	consensus F-box protein containing LRR [General fu	96.08
PRK12815		1068	carB carbamoyl phosphate synthase large subunit; R	96.06
KOG4658		889	consensus Apoptotic ATPase [Signal transduction me	96.05
PLN02735		1102	carbamoyl-phosphate synthase	95.98
KOG2155		631	consensus Tubulin-tyrosine ligase-related protein	95.79
PRK05294		1066	carB carbamoyl phosphate synthase large subunit; R	95.69
PRK15386		426	type III secretion protein GogB; Provisional	95.69
TIGR02712		1201	urea_carbox urea carboxylase. Members of this fami	95.66
KOG1947		482	consensus Leucine rich repeat proteins, some prote	95.6
PRK05784		486	phosphoribosylamine--glycine ligase; Provisional	95.43
KOG3763		585	consensus mRNA export factor TAP/MEX67 [RNA proces	95.21
PRK15386		426	type III secretion protein GogB; Provisional	95.12
TIGR01369		1050	CPSaseII_lrg carbamoyl-phosphate synthase, large s	95.06
PRK12815		1068	carB carbamoyl phosphate synthase large subunit; R	94.93
COG0439		449	AccC Biotin carboxylase [Lipid metabolism]	94.61
PLN02735		1102	carbamoyl-phosphate synthase	94.58
smart00317		116	SET SET (Su(var)3-9, Enhancer-of-zeste, Trithorax)	94.33
PF05770		307	Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6-	93.0
PF14403		445	CP_ATPgrasp_2: Circularly permuted ATP-grasp type	92.92
KOG4308		478	consensus LRR-containing protein [Function unknown	92.72
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	92.52
KOG3763		585	consensus mRNA export factor TAP/MEX67 [RNA proces	92.39
PF02222		172	ATP-grasp: ATP-grasp domain; InterPro: IPR003135 T	92.27
COG2232		389	Predicted ATP-dependent carboligase related to bio	90.71
PF02786		211	CPSase_L_D2: Carbamoyl-phosphate synthase L chain,	90.58
KOG4308		478	consensus LRR-containing protein [Function unknown	90.0
KOG0369		1176	consensus Pyruvate carboxylase [Energy production	89.65
PF13306		129	LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_	89.24
COG0151		428	PurD Phosphoribosylamine-glycine ligase [Nucleotid	88.82
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	87.61
COG2308		488	Uncharacterized conserved protein [Function unknow	86.43
KOG0473		326	consensus Leucine-rich repeat protein [Function un	86.16
PF00560		22	LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le	85.55
COG4770		645	Acetyl/propionyl-CoA carboxylase, alpha subunit [L	84.84
PF13504		17	LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO	83.09
PF00856		162	SET: SET domain; InterPro: IPR001214 The SET domai	81.73
KOG3864		221	consensus Uncharacterized conserved protein [Funct	81.41
smart00370		26	LRR Leucine-rich repeats, outliers.	80.95
smart00369		26	LRR_TYP Leucine-rich repeats, typical (most popula	80.95
PRK10507		619	bifunctional glutathionylspermidine amidase/glutat	80.72

>KOG2155 consensus Tubulin-tyrosine ligase-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=4.2e-146  Score=1167.25  Aligned_cols=617  Identities=42%  Similarity=0.733  Sum_probs=547.2

Q ss_pred             ccchhhHHHHHHHhHHHHHcCCCCHHHHHHHHHHhhhccccCCCceEEEEecCCceeEEEEecC--C--CCCCCcEEEEE
Q 002880            5 SNRIETYEDFVKVHGVLLAASGLPQSLHRQLFQKLTTETFDAGSYFKIEVCEDGRQRRLVLDSQ--S--MPKESNVFLVD   80 (871)
Q Consensus         5 ~~~~~~~~~f~~~h~~~l~~~~~p~~~~~~l~~kl~~~~fd~g~~f~i~~~~~~~~~~~~~~~~--~--~~~~~~iflid   80 (871)
                      +.++++|.+|+++||+||+||||||+||++||+||++|+||||++|||+.+++++.-+--+++|  .  ..|+++||++|
T Consensus         1 ~~~a~~f~~F~~~Hg~~L~ASgvPp~lw~rL~~KL~~~tFDaGd~FqI~~~e~~~dEe~e~arel~~~q~nd~~~~~~l~   80 (631)
T KOG2155|consen    1 DRSAYPFSTFLDQHGGQLNASGVPPELWHRLYKKLSDQTFDAGDHFQIICEENEDDEETEFARELEDLQNNDEDNIFLLD   80 (631)
T ss_pred             CCccccHHHHHHhcccccccCCCCHHHHHHHHHHhhhcccCCcCeeeEEEecccchhHHHHHHHHHhccCCCccceeeee
Confidence            4578999999999999999999999999999999999999999999999888764332234444  3  35788999999


Q ss_pred             eeeeccchHHHHHHhhChhHHHHHHhhhccccCCCcchhhhhhhccccccCCCCcchhhHHHhhhcccccCCCCceeEEe
Q 002880           81 HAWTFRLSDAFSQLQEVPGLAQRMASLMCVDTDLDTDIEEVDAVKGVLHENGTKSNVEDILESEIHNATEKGDGTVKWLE  160 (871)
Q Consensus        81 hawt~~~~~~~~ql~~~p~L~~rl~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~L~  160 (871)
                      |+-+|.-++||++..-..||.+|++.++|||.++-.++++.-+                                     
T Consensus        81 ~~~s~~~ESa~~c~~pn~gl~~~~~~iFgiD~~~t~~vd~t~~-------------------------------------  123 (631)
T KOG2155|consen   81 HFMSFSSESARKCVEPNEGLVERLAGIFGIDTDSTEEVDETVE-------------------------------------  123 (631)
T ss_pred             eeeeeehhhhhcccCCCccHHHhhccccccCCccceeccHHHH-------------------------------------
Confidence            9999999999999999999999999999998766533111000                                     


Q ss_pred             eccccccccccccccccccCCCCcEeeccCCccccHHHHHHHHhcCCCCCeeeCCCCcccccccccchhHHhhcCCCccc
Q 002880          161 LEDADIGDDMLLSLNLSSKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEI  240 (871)
Q Consensus       161 L~~~~i~d~~l~~~~l~~~~p~L~~L~Ls~N~L~~~~~i~~~l~~L~~Lk~L~Ls~N~l~~~~~~~~~~~i~~~lp~Le~  240 (871)
                                  +                                                                   
T Consensus       124 ------------~-------------------------------------------------------------------  124 (631)
T KOG2155|consen  124 ------------K-------------------------------------------------------------------  124 (631)
T ss_pred             ------------H-------------------------------------------------------------------
Confidence                        0                                                                   


Q ss_pred             cccccccccccccccccccccCCCCCCCccccCCcCCccceeecCCccccccccccCCCCCCCCcceEeccCCCCCCcch
Q 002880          241 YNSNFTINFGEWALGFCGEVYDKDNPSSLCLRDRPLQSVTSLDLSNRCIHNLVNKAFSPAEMPSLSHLNIRGNPLEQNSV  320 (871)
Q Consensus       241 lnl~~t~~~~~~~l~~~~~~~~~~~~~~i~~~~~~l~~L~~LdLS~N~I~~l~p~~~~~~~l~~L~~LnLs~N~L~~l~~  320 (871)
                                                                                                      
T Consensus       125 --------------------------------------------------------------------------------  124 (631)
T KOG2155|consen  125 --------------------------------------------------------------------------------  124 (631)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHHHHhcCCCCcceeEeeCCCCCCchhhHHhhhCCCcccccCcccchhhcccccccccccCCCCCCCCCCchhHHHHHH
Q 002880          321 RELLEVLKGFPCLQSLGVDIPGPLGESAIEILESLPTLCTLNGVTASKILEEGKHVIDSMLQPRLPEWSADQPLADRVLS  400 (871)
Q Consensus       321 ~~i~~~l~~lp~L~~L~L~iP~~l~~~~~~Il~~L~~L~~Ln~~~vs~~~~~~~~~~~~~l~~~~~~~~~~~~l~~~Vl~  400 (871)
                                     |..++|       .++++++.++..|+|.+      .+++.++++|++ .|+=.|+.++.++|++
T Consensus       125 ---------------le~~v~-------~e~~e~l~~~s~l~G~~------~~~~~vd~~l~~-~~~~~P~~elv~~VL~  175 (631)
T KOG2155|consen  125 ---------------LETSVE-------KEEAEHLKKISSLTGNL------PRHESVDARLSS-YSVDDPKNELVEKVLK  175 (631)
T ss_pred             ---------------hhccch-------hhHHHHHHHHHHhhCCC------CcccchhhccCc-ccccCcchHHHHHHHH
Confidence                           000000       12444555555666655      356778888888 8888999999999999


Q ss_pred             HHHHHhheeecCcccccCCceeeeeccccccccccCCCCCeeEeeeeecCCCCCCCceEEEEEeecccCCCCCccccccc
Q 002880          401 AMWLYLMTYRLANEEKIDETSVWYVMDELGSAVRHSDEPNFRVAPFLFMPEGKLSSAVSFSILWPIQNVYKRDECTRDFL  480 (871)
Q Consensus       401 ~mW~y~~~Y~~~~~~~~~~~~~wy~~de~gs~i~hs~~pn~~~~pf~~~~~~~~~~~~~ys~~wp~~~~~~g~~~trd~~  480 (871)
                      +||+|+++|+++.+++++++++|||||||||||||||+||||+|||||||++     +|||||||++++..||||||||+
T Consensus       176 amWky~qtY~la~~~~~ek~svWYvMDefGsrvrHsdePnf~~aPf~fmPq~-----vaYsimwp~k~~~tgeE~trDfa  250 (631)
T KOG2155|consen  176 AMWKYSQTYSLAYQGEIEKKSVWYVMDEFGSRVRHSDEPNFRIAPFMFMPQN-----VAYSIMWPTKPVNTGEEITRDFA  250 (631)
T ss_pred             HHHHhhheeecccCccccccceeEEHhhhhhhhccCCCCcceeeeheecchh-----cceeEEeeccCCCCchHHHHHHh
Confidence            9999999999999999999999999999999999999999999999999998     99999999999999999999999


Q ss_pred             CCCCChhhchhhccccccCChhhHHHHHHHHhhhcccccccCCCCCCCCCccccCCCCCceEEEcChHHHHHHHHcCCcE
Q 002880          481 YGIGEDKQRSARLTAWFHTPQSYFINEYEKHCQKLQFKSLSYTPTKSSNTESLHRSDGCASRVYTDIPYVEEFLTRTEFV  560 (871)
Q Consensus       481 ~~~~~~~~r~~~l~~w~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~kv~~d~~~V~~~L~~~gf~  560 (871)
                      .|++++++|+|+|+||++|++.+|..++.++-+.....+     +++.+..+.....|+++|||||.++|.++|+++.|+
T Consensus       251 sg~~~p~~Rk~~l~pWa~tde~~~~~~~~e~~qa~~~e~-----k~s~p~~s~pi~hg~~~kVYtD~~Qv~e~Lt~p~f~  325 (631)
T KOG2155|consen  251 SGVIHPEWRKYILQPWAATDETMIPDATLEYFQATEQET-----KQSAPFTSLPILHGRKIKVYTDDTQVTEHLTNPKFE  325 (631)
T ss_pred             hcCCCHHHHHHHhccccCCCcccCCchHHHHHHHHHHhc-----cccCCccccccccCceeEEEcCcHHHHHhccCCceE
Confidence            999999999999999999988777766554444322111     111111122223489999999999999999999999


Q ss_pred             EeCCCCCceEEEeccCCcchHHhhhCCCCCcEEccccCCCcccccHHHHHHHHHhcCCCCcccceeccCCChhHHHhhhh
Q 002880          561 ITTEPKDADIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVMKHHLAETVQKAHGSPEWLQPTYNLETHLPQLIGDYY  640 (871)
Q Consensus       561 ~~~~~~~~di~W~~~~~~~~~~~~~~l~~~q~vN~fP~~~~lt~K~~L~~~l~~~~g~~~~lP~Tf~L~~el~~f~~~~~  640 (871)
                      +|+++++|||+|+..|++ ||+++++.+|.+++||||++++||.||+||.++++.+|.++|+|.||+|.+++++|+++|+
T Consensus       326 ~t~~~kdADilw~~~hf~-Dykkls~e~p~~~iNQFPfE~cltvKd~LA~~a~r~~g~~~Wlq~TyNL~TqLpqFv~~fq  404 (631)
T KOG2155|consen  326 YTDDIKDADILWMIKHFH-DYKKLSEENPCGMINQFPFESCLTVKDLLAACAMRDPGKNDWLQLTYNLNTQLPQFVARFQ  404 (631)
T ss_pred             eccCccccceeeehhhHH-HHHHHhccCCcceeccCchHHHHHHHHHHHHHHhhcCCCCcccccccccccchHHHHHHHH
Confidence            999999999999999997 6999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhccCCCceEEecCCCCCCCCcEEEecChHHHHHHhccCCcccccccccccccCCceeeeeEEEEEeeecCcEEEEEcc
Q 002880          641 VRKRDGLNNLWILKPWNMARTIDTSVTDDLSAVIRLMETGPKICQKYIEFPALFQGRKFDLRYIVLVRSMDPLEIFLSDV  720 (871)
Q Consensus       641 ~~~~~~~~~~WIvKP~~~srG~GI~v~~~l~~i~~~~~~~~~IvQkYI~~PlLi~grKFDlR~yVLvtS~~PL~vy~y~~  720 (871)
                      +|++.|.+|+||+||||++||.+++|++++.+|+|.++++|+||||||++|+|+.|-||||||+|+++|+.||++|+|+.
T Consensus       405 ~Rer~g~~N~WI~KPWNlAR~~Dt~vT~~L~~IIRm~EtgPKiv~kYIe~P~LFr~gKFDlRYiVllrsi~Pl~~yvy~~  484 (631)
T KOG2155|consen  405 NRERNGQHNVWIVKPWNLARGMDTTVTEDLNQIIRMIETGPKIVCKYIERPLLFRNGKFDLRYIVLLRSIAPLTAYVYNR  484 (631)
T ss_pred             HHHhcCcCceEEechhhhhhcccchhhhhHHHHHHHHhcCchHHHHhcCCcceeecCccceEEEEEEccccchhhhheeh
Confidence            99999999999999999999999999999999999999999999999999999998899999999999999999999999


Q ss_pred             eEEEeecCCCCCCCCCccccccceeeeccccCCCCCCChhhHHHHHHhcc-chHHHHHHHHHHHHHHHHHHHHhhCCCC-
Q 002880          721 FWVRLANNPYSLDKHSFFEYETHFTVMNYGRRFNHMNTPDFVRGFEAEHQ-VKWLEIHQRVKNTIRSVFEAAAVAHPEM-  798 (871)
Q Consensus       721 g~vR~a~~~y~~~~~~l~~~~~HlTn~ny~~~~~~~~~~df~~~~~~~~~-~~w~~I~~~I~~~i~~~~~a~~~~~~~~-  798 (871)
                      +|+|||+++|++.+  +++|++|||+|||..+++||++++|+..++++|+ ..|.++...|..++++.|.+|+...+++ 
T Consensus       485 FWiRfsnn~fsL~~--f~dyEtHFTVmNY~~kl~q~~ceeFi~~~ek~yp~~pw~dvq~~i~~aire~~eaaak~~~e~g  562 (631)
T KOG2155|consen  485 FWIRFSNNEFSLSN--FEDYETHFTVMNYLEKLLQMKCEEFIGEFEKGYPCFPWEDVQCSIVPAIREPFEAAAKLNPECG  562 (631)
T ss_pred             eeeeecCCccchhh--hhhhhhhhhhhhHHHHHhhccHHHHHHHHhhcCCCCCcchhhhHHHHHHHHHHhhhhccCCccc
Confidence            99999999999975  9999999999999999999999999999999998 7899999999999999999998876653 


Q ss_pred             --CCCCcEEEEeeeEEE--cCC--CceEEEEecCCCCCCccccccccccccccccccccchhhhhhhcccCCC--CCCcC
Q 002880          799 --HSSKSRAMYGVDIML--DSS--FQPKLLEVTYCPDCTRACKYDTEALVTGEVVKGADFFNYVFGCLFLNKT--AHVTP  870 (871)
Q Consensus       799 --~~~~~fel~G~D~ml--D~~--~kpwLLEVN~~P~l~~~~~~~~~~~~~~~~~~~p~f~n~~f~~lfl~~~--~~~~~  870 (871)
                        ..++++++||+|+|+  |.+  ++|.|||||++|+|.|+|+||            |+|||+||+||||||+  .+|||
T Consensus       563 ~a~~p~sramygvDlml~~~~~pVmq~qILEVNFnPDc~RACrYh------------pdFfnnVFstLFLDep~~chVtp  630 (631)
T KOG2155|consen  563 AALLPNSRAMYGVDLMLAGDLTPVMQPQILEVNFNPDCKRACRYH------------PDFFNNVFSTLFLDEPSDCHVTP  630 (631)
T ss_pred             ccCCchhhhhhhheeeeccCCCccccceeEEEecCcchHHHhhcC------------hhHHHhHHHHhhccCCCCccccc
Confidence              478999999999999  665  999999999999999999998            9999999999999999  77998


Q ss_pred             C
Q 002880          871 L  871 (871)
Q Consensus       871 ~  871 (871)
                      |
T Consensus       631 L  631 (631)
T KOG2155|consen  631 L  631 (631)
T ss_pred             C
Confidence            7

>PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed	Back alignment and domain information

>KOG2156 consensus Tubulin-tyrosine ligase-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2157 consensus Predicted tubulin-tyrosine ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2158 consensus Tubulin-tyrosine ligase-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14398 ATPgrasp_YheCD: YheC/D like ATP-grasp	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms]	Back alignment and domain information

>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A	Back alignment and domain information

>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton]	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional	Back alignment and domain information

>PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK []	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily	Back alignment and domain information

>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton]	Back alignment and domain information

>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX	Back alignment and domain information

>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms]	Back alignment and domain information

>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0472 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A	Back alignment and domain information

>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms]	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed	Back alignment and domain information

>PRK10446 ribosomal protein S6 modification protein; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PLN03210 Resistant to P	Back alignment and domain information

>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein	Back alignment and domain information

>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed	Back alignment and domain information

>PRK14571 D-alanyl-alanine synthetase A; Provisional	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK14568 vanB D-alanine--D-lactate ligase; Provisional	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05246 glutathione synthetase; Provisional	Back alignment and domain information

>PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6	Back alignment and domain information

>PLN02941 inositol-tetrakisphosphate 1-kinase	Back alignment and domain information

>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase	Back alignment and domain information

>PLN03150 hypothetical protein; Provisional	Back alignment and domain information

>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional	Back alignment and domain information

>PRK14569 D-alanyl-alanine synthetase A; Provisional	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule []	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A	Back alignment and domain information

>PF02955 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP-grasp domain; InterPro: IPR004218 Prokaryotic glutathione synthetase 6	Back alignment and domain information

>PRK14570 D-alanyl-alanine synthetase A; Provisional	Back alignment and domain information

>PRK14572 D-alanyl-alanine synthetase A; Provisional	Back alignment and domain information

>PRK12458 glutathione synthetase; Provisional	Back alignment and domain information

>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein	Back alignment and domain information

>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms]	Back alignment and domain information

>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms]	Back alignment and domain information

>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103	Back alignment and domain information

>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only]	Back alignment and domain information

>TIGR01380 glut_syn glutathione synthetase, prokaryotic	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>PLN02257 phosphoribosylamine--glycine ligase	Back alignment and domain information

>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>COG4886 Leucine-rich repeat (LRR) protein [Function unknown]	Back alignment and domain information

>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed	Back alignment and domain information

>PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp	Back alignment and domain information

>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated	Back alignment and domain information

>PRK00885 phosphoribosylamine--glycine ligase; Provisional	Back alignment and domain information

>PRK12767 carbamoyl phosphate synthase-like protein; Provisional	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK06849 hypothetical protein; Provisional	Back alignment and domain information

>PRK13790 phosphoribosylamine--glycine ligase; Provisional	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B	Back alignment and domain information

>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification]	Back alignment and domain information

>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only]	Back alignment and domain information

>PRK06524 biotin carboxylase-like protein; Validated	Back alignment and domain information

>PRK02186 argininosuccinate lyase; Provisional	Back alignment and domain information

>PRK07206 hypothetical protein; Provisional	Back alignment and domain information

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13789 phosphoribosylamine--glycine ligase; Provisional	Back alignment and domain information

>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only]	Back alignment and domain information

>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>TIGR00877 purD phosphoribosylamine--glycine ligase	Back alignment and domain information

>PRK05586 biotin carboxylase; Validated	Back alignment and domain information

>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed	Back alignment and domain information

>TIGR02068 cya_phycin_syn cyanophycin synthetase	Back alignment and domain information

>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit	Back alignment and domain information

>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton]	Back alignment and domain information

>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional	Back alignment and domain information

>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit	Back alignment and domain information

>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated	Back alignment and domain information

>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PRK08463 acetyl-CoA carboxylase subunit A; Validated	Back alignment and domain information

>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated	Back alignment and domain information

>PRK08462 biotin carboxylase; Validated	Back alignment and domain information

>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>TIGR01235 pyruv_carbox pyruvate carboxylase	Back alignment and domain information

>KOG2982 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional	Back alignment and domain information

>PRK14016 cyanophycin synthetase; Provisional	Back alignment and domain information

>TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type	Back alignment and domain information

>KOG2123 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PLN02948 phosphoribosylaminoimidazole carboxylase	Back alignment and domain information

>PRK07178 pyruvate carboxylase subunit A; Validated	Back alignment and domain information

>PRK08654 pyruvate carboxylase subunit A; Validated	Back alignment and domain information

>PRK12999 pyruvate carboxylase; Reviewed	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>PRK06395 phosphoribosylamine--glycine ligase; Provisional	Back alignment and domain information

>PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification]	Back alignment and domain information

>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only]	Back alignment and domain information

>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional	Back alignment and domain information

>PF01071 GARS_A: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6	Back alignment and domain information

>KOG4341 consensus F-box protein containing LRR [General function prediction only]	Back alignment and domain information

>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed	Back alignment and domain information

>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms]	Back alignment and domain information

>PLN02735 carbamoyl-phosphate synthase	Back alignment and domain information

>KOG2155 consensus Tubulin-tyrosine ligase-related protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>TIGR02712 urea_carbox urea carboxylase	Back alignment and domain information

>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only]	Back alignment and domain information

>PRK05784 phosphoribosylamine--glycine ligase; Provisional	Back alignment and domain information

>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]	Back alignment and domain information

>PRK15386 type III secretion protein GogB; Provisional	Back alignment and domain information

>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit	Back alignment and domain information

>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed	Back alignment and domain information

>COG0439 AccC Biotin carboxylase [Lipid metabolism]	Back alignment and domain information

>PLN02735 carbamoyl-phosphate synthase	Back alignment and domain information

>smart00317 SET SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain	Back alignment and domain information

>PF05770 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6-kinase; InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase	Back alignment and domain information

>PF14403 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 2	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification]	Back alignment and domain information

>PF02222 ATP-grasp: ATP-grasp domain; InterPro: IPR003135 The ATP-grasp domain has an unusual nucleotide-binding fold, also referred to as palmate, and is found in a superfamily of enzymes including D-alanine-D-alanine ligase, glutathione synthetase, biotin carboxylase, and carbamoyl phosphate synthetase, the ribosomal protein S6 modification enzyme (RimK), urea amidolyase, tubulin-tyrosine ligase, and three enzymes of purine biosynthesis

Back alignment and domain information

>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only]	Back alignment and domain information

>PF02786 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, ATP binding domain; InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below)	Back alignment and domain information

>KOG4308 consensus LRR-containing protein [Function unknown]	Back alignment and domain information

>KOG0369 consensus Pyruvate carboxylase [Energy production and conversion]	Back alignment and domain information

>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A	Back alignment and domain information

>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>COG2308 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0473 consensus Leucine-rich repeat protein [Function unknown]	Back alignment and domain information

>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape []	Back alignment and domain information

>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism]	Back alignment and domain information

>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D	Back alignment and domain information

>PF00856 SET: SET domain; InterPro: IPR001214 The SET domain appears generally as one part of a larger multidomain protein, and recently there were described three structures of very different proteins with distinct domain compositions: Neurospora crassa DIM-5, a member of the Su(var) family of HKMTs which methylate histone H3 on lysine 9,human SET7 (also called SET9), which methylates H3 on lysine 4 and garden pea Rubisco LSMT, an enzyme that does not modify histones, but instead methylates lysine 14 in the flexible tail of the large subunit of the enzyme Rubisco

Back alignment and domain information

>KOG3864 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>smart00370 LRR Leucine-rich repeats, outliers	Back alignment and domain information

>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily	Back alignment and domain information

>PRK10507 bifunctional glutathionylspermidine amidase/glutathionylspermidine synthetase; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		871
4i4t_F		384	Crystal Structure Of Tubulin-rb3-ttl-zampanolide Co		1e-06
3tig_A		380	Tubulin Tyrosine Ligase Length = 380		2e-05

>pdb|4I4T|F Chain F, Crystal Structure Of Tubulin-rb3-ttl-zampanolide Complex Length = 384

Back alignment and structure

Iteration: 1

Score = 52.4 bits (124), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 56/211 (26%), Positives = 99/211 (46%), Gaps = 23/211 (10%) Query: 640 YVRKRDGL-NNLWILKPWNMARTIDTSVTDDLSAVIRLMETGPKI--CQKYIEFPALFQ- 695 Y R+R+G N+WI K A+ ++ + S ++ ++ ++ QKY+E P L + Sbjct: 135 YNRRREGREGNVWIAKSSAGAKGEGILISSEASELLDFIDEQGQVHVIQKYLEKPLLLEP 194 Query: 696 -GRKFDLRYIVLVRSMDPLEIFLSDVFWVRLANNPYSLDKHSFFEYETHFT--------V 746 RKFD+R VLV + + ++ V +R ++ PY + +F + H T Sbjct: 195 GHRKFDIRSWVLVDHLYNIYLYREGV--LRTSSEPY--NSANFQDKTCHLTNHCIQKEYS 250 Query: 747 MNYGR--RFNHMNTPDFVRGF-EAEHQVKWLEIHQRVKNTIRSVFEA--AAVAHPEMHSS 801 NYGR N M +F + +A + I ++K+ IRS A++ +H Sbjct: 251 KNYGRYEEGNEMFFEEFNQYLMDALNTTLENSILLQIKHIIRSCLMCIEPAISTKHLHY- 309 Query: 802 KSRAMYGVDIMLDSSFQPKLLEVTYCPDCTR 832 +S ++G D M+D + L+EV P C + Sbjct: 310 QSFQLFGFDFMVDEELKVWLIEVNGAPACAQ 340

PyMOL of 4i4t

>pdb|3TIG|A Chain A, Tubulin Tyrosine Ligase Length = 380

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		871
3tig_A		380	TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si	3e-35
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-10
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-08
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-07
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	2e-08
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-06
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	4e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-05
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	3e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	6e-04
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	7e-04
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	5e-08
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	4e-07
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	8e-08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	1e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	3e-06
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	2e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	4e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	7e-05
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	9e-05
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	9e-08
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	3e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	1e-07
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	4e-06
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	2e-07
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	6e-04
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-07
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	3e-06
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	2e-05
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	1e-04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	2e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-07
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	1e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-05
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	2e-04
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-07
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-07
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	3e-06
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	4e-07
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	4e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	4e-07
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-06
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-05
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	1e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	2e-04
3fxi_A		605	TLR4, htoll, TOLL-like receptor 4; leucine rich re	3e-04
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	1e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	5e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	6e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	9e-06
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	9e-05
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	1e-04
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	9e-04
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	1e-06
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	7e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	1e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-06
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	6e-05
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	3e-04
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	2e-06
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	2e-06
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	5e-05
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	2e-06
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	2e-06
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	6e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	3e-06
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	8e-05
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	4e-06
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	9e-05
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	2e-04
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	6e-04
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	5e-06
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	1e-05
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	1e-05
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	3e-05
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	1e-04
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	2e-05
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	7e-05
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	3e-04
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	2e-05
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	2e-04
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	6e-04
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	2e-05
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	9e-04
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-05
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	1e-04
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	2e-04
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	3e-04
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	3e-05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	4e-05
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	2e-04
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	7e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	5e-05
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	2e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	4e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	6e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	6e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	8e-04
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	9e-04
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	5e-05
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	2e-04
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	6e-05
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	8e-05
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	2e-04
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	6e-05
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	5e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	7e-05
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	1e-04
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	8e-04
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	7e-05
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	1e-04
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	6e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	8e-05
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	2e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	3e-04
1o6v_A		466	Internalin A; bacterial infection, extracellular r	7e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	1e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	5e-04
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	6e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-04
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	1e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	1e-04
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	2e-04
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	1e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	2e-04
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	7e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	2e-04
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	6e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	2e-04
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	6e-04
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	3e-04
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	3e-04
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	4e-04
3jqh_A		167	C-type lectin domain family 4 member M; DC-signr,	6e-04
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	8e-04

>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Length = 380	Back alignment and structure

 Score =  137 bits (346), Expect = 3e-35
 Identities = 58/332 (17%), Positives = 112/332 (33%), Gaps = 48/332 (14%)

Query: 550 VEEFLTRTEFV-ITTEPKDADIIWTSLQVDEDMKTATGITDQQYVNQFPFESCLVMKHHL 608
            +  L   ++  +  +    +++          +        Q VN +     L  K  L
Sbjct: 21  AKILLASGQWKRLKRDNPKFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASL 80

Query: 609 AETVQKAHGSPEWLQ----------PTYNLETH-----------------LPQLIGDYYV 641
            + ++ +    E                                        +    +  
Sbjct: 81  VKLIKTSPELTETCTWFPESYVIYPTNEKTPAMRARNGLPDLANAPRTDEREEFRSSFNK 140

Query: 642 RKRDGLNNLWILKPWNMARTIDTSVTDDLSAVIRLMETGPK--ICQKYIEFPALFQ--GR 697
           +K +   N+WI K  + A+     ++ D + ++  ++   +  + QKY+E P L +   R
Sbjct: 141 KKENEEGNVWIAKSSSGAKGEGILISSDATELLDFIDNQGQVHVIQKYLESPLLLEPGHR 200

Query: 698 KFDLRYIVLVRSMDPLEIFLSDVFWVRLANNPYSLDKHSFFEYETHFTVM--------NY 749
           KFD+R  VLV +     I+L     +R ++ PYS       +  +H T          NY
Sbjct: 201 KFDIRSWVLVDN--QYNIYLYREGVLRTSSEPYSDTNFQ--DMTSHLTNHCIQKEHSKNY 256

Query: 750 GRR--FNHMNTPDFVRGFEAEHQVKWLE-IHQRVKNTIRSVFEAAA-VAHPEMHSSKSRA 805
           GR    N M   +F +       +     I  ++K  IR            +     S  
Sbjct: 257 GRYEEGNEMFFEEFNQYLVTSLNINLENSILCQIKEIIRVCLSCLEPAISTKYLPYHSFQ 316

Query: 806 MYGVDIMLDSSFQPKLLEVTYCPDCTRACKYD 837
           ++G D M+D + +  L+EV   P C +    +
Sbjct: 317 LFGFDFMVDKNLKVWLIEVNGAPACAQKLYAE 348

PyMOL of 3tig

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		871
3tig_A		380	TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si	100.0
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.43
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.43
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.38
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.38
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.37
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.37
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.37
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.36
3rfs_A		272	Internalin B, repeat modules, variable lymphocyte	99.36
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.36
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.35
4fcg_A		328	Uncharacterized protein; structural genomics, PSI-	99.35
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.34
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.34
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.33
1h6u_A		308	Internalin H; cell adhesion, leucine rich repeat,	99.33
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.32
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.32
1ozn_A		285	Reticulon 4 receptor; NOGO receptor, MAD, myelinat	99.31
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.31
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.31
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.31
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.31
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.31
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.3
3m19_A		251	Variable lymphocyte receptor A diversity region; a	99.3
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.3
2o6q_A		270	Variable lymphocyte receptor A; leucine-rich repea	99.3
3zyi_A		452	Leucine-rich repeat-containing protein 4; cell adh	99.3
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.3
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.29
2z66_A		306	Variable lymphocyte receptor B, TOLL-like recepto;	99.29
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.28
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.27
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.27
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.27
4fmz_A		347	Internalin; leucine rich repeat, structural genomi	99.27
2ca6_A		386	RAN GTPase-activating protein 1; GAP, GTPase activ	99.26
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.26
3zyj_A		440	Leucine-rich repeat-containing protein 4C; cell ad	99.26
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.26
3rgz_A		768	Protein brassinosteroid insensitive 1; phytohormon	99.26
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.25
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.25
2id5_A		477	Lingo-1, leucine rich repeat neuronal 6A; CNS-spec	99.24
1ogq_A		313	PGIP-2, polygalacturonase inhibiting protein; inhi	99.24
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.24
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.23
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.23
3goz_A		362	Leucine-rich repeat-containing protein; LEGL7, NES	99.22
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.22
1p9a_G		290	Platelet glycoprotein IB alpha chain precursor; pl	99.22
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.22
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.21
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.21
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.21
1xku_A		330	Decorin; proteoglycan, leucine-rich repeat, struct	99.21
3o6n_A		390	APL1; leucine-rich repeat, protein binding; HET: N	99.21
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.2
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.2
3oja_A		487	Leucine-rich immune molecule 1; coiled-coil, helix	99.2
1wwl_A		312	Monocyte differentiation antigen CD14; LPS, immune	99.2
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.2
3oja_B		597	Anopheles plasmodium-responsive leucine-rich REPE	99.2
3v47_A		455	TOLL-like receptor 5B and variable lymphocyte REC	99.19
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.19
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.19
2ast_B		336	S-phase kinase-associated protein 2; SCF-substrate	99.19
2v9t_B		220	SLIT homolog 2 protein N-product; structural prote	99.19
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.19
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.18
4glp_A		310	Monocyte differentiation antigen CD14; alpha beta	99.18
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.18
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	99.17
2ft3_A		332	Biglycan; proteoglycan, dimer interface, structura	99.17
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.16
1o6v_A		466	Internalin A; bacterial infection, extracellular r	99.16
3e6j_A		229	Variable lymphocyte receptor diversity region; var	99.16
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.16
2v70_A		220	SLIT-2, SLIT homolog 2 protein N-product; neurogen	99.16
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.16
3o53_A		317	Protein LRIM1, AGAP006348-PA; leucine-rich repeat,	99.15
1a9n_A		176	U2A', U2A'; complex (nuclear protein/RNA), RNA, sn	99.15
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.15
3t6q_A		606	CD180 antigen; protein-protein complex, leucine ri	99.14
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.14
3bz5_A		457	Internalin-J, INLJ; leucine rich repeat (LRR), cys	99.14
2z62_A		276	TOLL-like receptor 4, variable lymphocyte recepto;	99.13
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.13
2z7x_B		520	TOLL-like receptor 1, variable lymphocyte recepto;	99.13
1z7x_W		461	Ribonuclease inhibitor; leucine-rich repeat, enzym	99.13
2o6s_A		208	Variable lymphocyte receptor B; leucine-rich repea	99.12
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.12
1h6t_A		291	Internalin B; cell adhesion, leucine rich repeat,	99.12
2je0_A		149	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.12
2z81_A		549	CD282 antigen, TOLL-like receptor 2, variable lymp	99.11
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	99.11
3vq2_A		606	TLR4, TOLL-like receptor 4; leucine rich repeat MD	99.1
1w8a_A		192	SLIT protein; signaling protein, secreted protein,	99.1
1m9s_A		605	Internalin B; cell invasion, GW domains, SH3 domai	99.1
2xwt_C		239	Thyrotropin receptor; signaling protein-immune sys	99.09
2xot_A		361	Amphoterin-induced protein 1; cell adhesion, neuro	99.09
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.08
4g8a_A		635	TOLL-like receptor 4; leucine rich repeat MD-2 rel	99.08
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	99.08
1ziw_A		680	TOLL-like receptor 3; innate immunity, immune syst	99.08
4ecn_A		876	Leucine-rich repeat protein; leucine-rich repeats,	99.06
3a79_B		562	TLR6, VLRB.59, TOLL-like receptor 6, variable lymp	99.06
2ell_A		168	Acidic leucine-rich nuclear phosphoprotein 32 FAM	99.06
2z63_A		570	TOLL-like receptor 4, variable lymphocyte recepto;	99.04
2z80_A		353	TOLL-like receptor 2, variable lymphocyte recepto;	99.04
1xeu_A		263	Internalin C; cellular invasion, leucine-rich repe	99.04
4ezg_A		197	Putative uncharacterized protein; internalin-A, le	99.03
4eco_A		636	Uncharacterized protein; leucine-rich repeats, pro	99.03
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.03
2wfh_A		193	SLIT homolog 2 protein C-product; developmental pr	99.01
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	99.0
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	99.0
3g06_A		622	SSPH2 (leucine-rich repeat protein); E3 ubiquitin	99.0
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.99
2o6r_A		177	Variable lymphocyte receptor B; leucine-rich repea	98.97
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.95
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.91
1jl5_A		454	Outer protein YOPM; leucine-rich repeat, molecular	98.9
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.9
3cvr_A		571	Invasion plasmid antigen; leucine rich repeat and	98.89
3g39_A		170	Variable lymphocyte receptor VLRB.2D; antibody, X-	98.87
1dce_A		567	Protein (RAB geranylgeranyltransferase alpha subun	98.86
3j0a_A		844	TOLL-like receptor 5; membrane protein, leucine-ri	98.86
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	98.85
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.84
2r9u_A		174	Variable lymphocyte receptor; adaptive immunity, V	98.83
4b8c_D		727	Glucose-repressible alcohol dehydrogenase transcr	98.83
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.76
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	98.75
4ay9_X		350	Follicle-stimulating hormone receptor; hormone-rec	98.73
3ogk_B		592	Coronatine-insensitive protein 1; leucine rich rep	98.73
1ds9_A		198	Outer arm dynein; leucine-rich repeat, beta-BETA-a	98.72
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.66
2ifg_A		347	High affinity nerve growth factor receptor; TRK, T	98.65
2p1m_B		594	Transport inhibitor response 1 protein; F-BOX, leu	98.64
3un9_A		372	NLR family member X1; leucine rich repeat (LRR), a	98.64
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.58
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.57
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.49
1iow_A		306	DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho	98.46
1io0_A		185	Tropomodulin; LRR protein, right-handed super-heli	98.44
2i87_A		364	D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco	98.43
3sb4_A		329	Hypothetical leucine rich repeat protein; LRR, rig	98.4
4eg0_A		317	D-alanine--D-alanine ligase; structural genomics,	98.36
1e4e_A		343	Vancomycin/teicoplanin A-type resistance protein;	98.32
3se7_A		346	VANA; alpha-beta structure, D-alanine-D-lactate li	98.28
4fu0_A		357	D-alanine--D-alanine ligase 7; vancomycin resistan	98.28
3rw6_A		267	Nuclear RNA export factor 1; retroviral constituti	98.27
2q7d_A		346	Inositol-tetrakisphosphate 1-kinase; inositol kina	98.24
3i12_A		364	D-alanine-D-alanine ligase A; D-alanyl-alanine syn	98.24
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	98.21
3tqt_A		372	D-alanine--D-alanine ligase; cell envelope; 1.88A	98.21
1uc8_A		280	LYSX, lysine biosynthesis enzyme; alpha-aminoadipa	98.21
3e5n_A		386	D-alanine-D-alanine ligase A; bacterial blight; 2.	98.2
1i7n_A		309	Synapsin II; synapse, phosphorylation, neuropeptid	98.19
1ehi_A		377	LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g	98.14
1z2n_X		324	Inositol 1,3,4-trisphosphate 5/6-kinase; inositol	98.13
3r5x_A		307	D-alanine--D-alanine ligase; alpha-beta structure,	98.11
2r85_A		334	PURP protein PF1517; ATP-grAsp superfamily, unknow	98.1
3ax6_A		380	Phosphoribosylaminoimidazole carboxylase, ATPase;	98.08
3k3p_A		383	D-alanine--D-alanine ligase; D-alanyl-alanine synt	98.04
2p0a_A		344	Synapsin-3, synapsin III; neurotransmitter release	98.03
3q2o_A		389	Phosphoribosylaminoimidazole carboxylase, ATPase;	98.02
2fb9_A		322	D-alanine:D-alanine ligase; 1.90A {Thermus caldoph	98.0
1pk8_A		422	RAT synapsin I; ATP binding, ATP grAsp, calcium (I	98.0
4dim_A		403	Phosphoribosylglycinamide synthetase; structural g	97.98
3vot_A		425	L-amino acid ligase, BL00235; ATP-grAsp motif, ATP	97.91
2ip4_A		417	PURD, phosphoribosylamine--glycine ligase; GAR syn	97.89
3k5i_A		403	Phosphoribosyl-aminoimidazole carboxylase; purine	97.87
1ulz_A		451	Pyruvate carboxylase N-terminal domain; biotin car	97.83
3lwb_A		373	D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan	97.81
2yw2_A		424	Phosphoribosylamine--glycine ligase; glycinamide r	97.81
1kjq_A		391	GART 2, phosphoribosylglycinamide formyltransferas	97.8
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	97.79
3aw8_A		369	PURK, phosphoribosylaminoimidazole carboxylase, AT	97.78
4fdw_A		401	Leucine rich hypothetical protein; putative cell s	97.72
2yrx_A		451	Phosphoribosylglycinamide synthetase; glycinamide	97.71
3ouz_A		446	Biotin carboxylase; structural genomics, center fo	97.71
2vpq_A		451	Acetyl-COA carboxylase; bacteria, ATP-grAsp domain	97.71
2pvp_A		367	D-alanine-D-alanine ligase; 2.40A {Helicobacter py	97.69
2xcl_A		422	Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-	97.69
2ra8_A		362	Uncharacterized protein Q64V53_bacfr; WGR domain,	97.68
1gsa_A		316	Glutathione synthetase; ligase; HET: ADP GSH; 2.00	97.67
4e4t_A		419	Phosphoribosylaminoimidazole carboxylase, ATPase;	97.67
3lp8_A		442	Phosphoribosylamine-glycine ligase; ssgcid, NIH, n	97.67
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.66
3orq_A		377	N5-carboxyaminoimidazole ribonucleotide synthetas;	97.65
2dwc_A		433	PH0318, 433AA long hypothetical phosphoribosylglyc	97.64
2z04_A		365	Phosphoribosylaminoimidazole carboxylase ATPase su	97.6
2qk4_A		452	Trifunctional purine biosynthetic protein adenosi;	97.57
2w70_A		449	Biotin carboxylase; ligase, ATP-binding, fatty aci	97.56
3mjf_A		431	Phosphoribosylamine--glycine ligase; structural ge	97.53
1vkz_A		412	Phosphoribosylamine--glycine ligase; TM1250, struc	97.49
3ln6_A		750	Glutathione biosynthesis bifunctional protein GSH;	97.47
3vmm_A		474	Alanine-anticapsin ligase BACD; ATP-grAsp domain,	97.42
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	97.37
3df7_A		305	Putative ATP-grAsp superfamily protein; putative p	97.36
2pn1_A		331	Carbamoylphosphate synthase large subunit; ZP_0053	97.33
1pgv_A		197	TMD-1, tropomodulin TMD-1; structural genomics, PS	97.33
3glk_A		540	Acetyl-COA carboxylase 2; ATP binding, alternative	97.29
3jrx_A		587	Acetyl-COA carboxylase 2; BC domain, soraphen A, a	97.26
2dzd_A		461	Pyruvate carboxylase; biotin carboxylase, ligase;	97.25
3ln7_A		757	Glutathione biosynthesis bifunctional protein GSH;	97.15
3e4g_A		176	ATP synthase subunit S, mitochondrial; leucine-ric	97.13
1w96_A		554	ACC, acetyl-coenzyme A carboxylase; ligase, obesit	97.09
1a9x_A		1073	Carbamoyl phosphate synthetase (large chain); amid	97.03
3eth_A		355	Phosphoribosylaminoimidazole carboxylase ATPase su	96.95
3u9t_A		675	MCC alpha, methylcrotonyl-COA carboxylase, alpha-s	96.9
3n6r_A		681	Propionyl-COA carboxylase, alpha subunit; protein	96.8
1a9x_A		1073	Carbamoyl phosphate synthetase (large chain); amid	96.65
3n6x_A		474	Putative glutathionylspermidine synthase; domain o	96.57
3hbl_A		1150	Pyruvate carboxylase; TIM barrel, ligase; HET: BTI	96.32
2r7k_A		361	5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib	96.03
2qf7_A		1165	Pyruvate carboxylase protein; multi-domain, multi-	95.93
3va7_A		1236	KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A	95.88
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	95.55
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	95.4
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	95.3
4ffl_A		363	PYLC; amino acid, biosynthesis of pyrrolysine, iso	94.98
4fs7_A		394	Uncharacterized protein; leucine-rich repeats, pro	94.94
2f69_A		261	Histone-lysine N-methyltransferase, H3 lysine-4 sp	94.91
2cqy_A		108	Propionyl-COA carboxylase alpha chain, mitochondri	94.27
2pbz_A		320	Hypothetical protein; NYSGXRC, PSI-II, IMP biosynt	93.98
3t7a_A		330	Inositol pyrophosphate kinase; ATP-grAsp fold, tra	93.7
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	93.48
4gt6_A		394	Cell surface protein; leucine rich repeats, putati	93.41
3f9x_A		166	Histone-lysine N-methyltransferase SETD8; methyltr	93.36
3rfe_A		130	Platelet glycoprotein IB beta chain; platelet surf	92.97
1n3j_A		119	A612L, histone H3 lysine methyltransferase; beta b	92.94
4h09_A		379	Hypothetical leucine rich repeat protein; two LRR_	92.7
3ope_A		222	Probable histone-lysine N-methyltransferase ASH1L;	90.76
3rq4_A		247	Histone-lysine N-methyltransferase SUV420H2; suppr	90.74
2w5y_A		192	Histone-lysine N-methyltransferase HRX; transcript	90.01
3ooi_A		232	Histone-lysine N-methyltransferase, H3 lysine-36 l	89.83
3h6l_A		278	Histone-lysine N-methyltransferase SETD2; SET doma	89.01
2io8_A		619	Bifunctional glutathionylspermidine synthetase/ami	88.59
1h3i_A		293	Histone H3 lysine 4 specific methyltransferase; 2.	88.31
1mvh_A		299	Cryptic LOCI regulator 4; lysine methyltransferase	87.41
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	86.52
3s8p_A		273	Histone-lysine N-methyltransferase SUV420H1; SET d	86.45
2vob_A		652	Trypanothione synthetase; ligase; 2.3A {Leishmania	86.42
3bo5_A		290	Histone-lysine N-methyltransferase setmar; SET dom	86.41
1ml9_A		302	Histone H3 methyltransferase DIM-5; adoMet-depende	86.38
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	85.46
2r3a_A		300	Histone-lysine N-methyltransferase SUV39H2; histon	84.93
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	84.92
3hna_A		287	Histone-lysine N-methyltransferase, H3 lysine-9 sp	84.83
2qpw_A		149	PR domain zinc finger protein 2; methyltransferase	80.64

>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A*	Back alignment and structure

Probab=100.00  E-value=2.4e-57  Score=503.56  Aligned_cols=296  Identities=21%  Similarity=0.289  Sum_probs=226.8

Q ss_pred             cChHHHHHHHHcCC-cEEeC-CCCCceEEEeccCCcchHHhhhCC-CCCcEEccccCCCcccccHHHHHHHHHhc---CC
Q 002880          545 TDIPYVEEFLTRTE-FVITT-EPKDADIIWTSLQVDEDMKTATGI-TDQQYVNQFPFESCLVMKHHLAETVQKAH---GS  618 (871)
Q Consensus       545 ~d~~~V~~~L~~~g-f~~~~-~~~~~di~W~~~~~~~~~~~~~~l-~~~q~vN~fP~~~~lt~K~~L~~~l~~~~---g~  618 (871)
                      |.|+.|+++|++.| |..+. +..+|||+|++.+.. .|..+... .+.|+||||||++.||||+.|+++++++.   ..
T Consensus        15 svy~~V~~vL~~~g~w~ev~~~~~~~dl~W~~~~~~-p~~~l~~~p~~~Q~vNhfPg~~~l~rKd~L~~nl~~~~~~~~~   93 (380)
T 3tig_A           15 TVYAEVAKILLASGQWKRLKRDNPKFNLMLGERNRL-PFGRLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSPELTET   93 (380)
T ss_dssp             HHHHHHHHHHHHTTSEEECCTTCSCCSEEECCSSSC-CGGGSSCSTTCCCEESCCTTTHHHHSHHHHHHHHHHCHHHHTT
T ss_pred             cHHHHHHHHHHhcCCeEEeCCCCCceeEEEecCCCC-CHHHhccCCCcceEEeecCCcccccccHHHHHHHHHhhhcccc
Confidence            57889999999999 98775 467899999988764 35444333 57899999999999999999999998842   35


Q ss_pred             CCcccceecc-CC-----------------------ChhHHHhhhhhhhccCCCceEEecCCCCCCCCcEEEecChHHHH
Q 002880          619 PEWLQPTYNL-ET-----------------------HLPQLIGDYYVRKRDGLNNLWILKPWNMARTIDTSVTDDLSAVI  674 (871)
Q Consensus       619 ~~~lP~Tf~L-~~-----------------------el~~f~~~~~~~~~~~~~~~WIvKP~~~srG~GI~v~~~l~~i~  674 (871)
                      .+|+|+||.| |.                       |+.+|+++|.+++..+.++.||+||++++||+||.++++++++.
T Consensus        94 ~~f~P~ty~L~P~~~~~p~~~~~~~~~~~~~~~~~~E~~~F~~~~~~~~~~~~~~~wI~KP~~~srG~GI~l~~~~~~i~  173 (380)
T 3tig_A           94 CTWFPESYVIYPTNEKTPAMRARNGLPDLANAPRTDEREEFRSSFNKKKENEEGNVWIAKSSSGAKGEGILISSDATELL  173 (380)
T ss_dssp             CTTSCCEEECCC------------------------CCHHHHHHHHHHHHTTCCCCEEEEESCC----CCBCCSCSHHHH
T ss_pred             cCcCCcceeeCccccccccccccccccccccccchhHHHHHHHHHHHhhhcCCCCeEEEeCCccCCCCCEEEeCCHHHHH
Confidence            7899999999 65                       56789999988777889999999999999999999999999998


Q ss_pred             HHhc--cCCccccccccccccc--CCceeeeeEEEEEeeecCcEEEEEcceEEEeecCCCCCCCCCccccccceeeeccc
Q 002880          675 RLME--TGPKICQKYIEFPALF--QGRKFDLRYIVLVRSMDPLEIFLSDVFWVRLANNPYSLDKHSFFEYETHFTVMNYG  750 (871)
Q Consensus       675 ~~~~--~~~~IvQkYI~~PlLi--~grKFDlR~yVLvtS~~PL~vy~y~~g~vR~a~~~y~~~~~~l~~~~~HlTn~ny~  750 (871)
                      +..+  ..++||||||++|+||  +|||||||+||||||  ||++|+|++|++|||+.+|+.++  +++.++||||..++
T Consensus       174 ~~~~~~~~~~VvQkYI~~PlLi~~~grKFDlR~Yvlvts--~l~vy~y~~g~~Rfa~~~y~~~~--~~~~~~HLTN~~iq  249 (380)
T 3tig_A          174 DFIDNQGQVHVIQKYLESPLLLEPGHRKFDIRSWVLVDN--QYNIYLYREGVLRTSSEPYSDTN--FQDMTSHLTNHCIQ  249 (380)
T ss_dssp             HHHHHHTSCEEEEECCSSBCCBTTTTBCEEEEEEEEECT--TCCEEECSCCEEEECC-----------------------
T ss_pred             HHHhccCCcEEEEecccCceeecCCCceeEEEEEEEEcC--CCEEEEEcCCEEEecCCCcCccc--hhhhhhhccccccc
Confidence            7754  5789999999999999  999999999999998  99999999999999999999864  78899999987655


Q ss_pred             cC----------CCCCCChhhHHHHHHhccchHH-HHHHHHHHHHHHHHHHHHhhCCCC-CCCCcEEEEeeeEEEcCCCc
Q 002880          751 RR----------FNHMNTPDFVRGFEAEHQVKWL-EIHQRVKNTIRSVFEAAAVAHPEM-HSSKSRAMYGVDIMLDSSFQ  818 (871)
Q Consensus       751 ~~----------~~~~~~~df~~~~~~~~~~~w~-~I~~~I~~~i~~~~~a~~~~~~~~-~~~~~fel~G~D~mlD~~~k  818 (871)
                      +.          .+.+..++|.+.+++.++..|. .|+++|++++++++.|++...... ...+|||+||+|||||++++
T Consensus       250 k~~~~~y~~~~~g~~~~~~~f~~yL~~~~~~~~~~~i~~~I~~ii~~~l~a~~~~i~~~~~~~~~FEl~G~D~lid~~l~  329 (380)
T 3tig_A          250 KEHSKNYGRYEEGNEMFFEEFNQYLVTSLNINLENSILCQIKEIIRVCLSCLEPAISTKYLPYHSFQLFGFDFMVDKNLK  329 (380)
T ss_dssp             -------------CCBCHHHHHHHHSTTSSCCHHHHTHHHHHHHHHHHHHHHHHHHCCTTSSSEECEEEEEEEEEBTTCC
T ss_pred             cccccccccccCCCcCcHHHHHHHHHHhcCccHHHHHHHHHHHHHHHHHHHHHHHhhhcccCCceEEEEeEEEEEcCCCc
Confidence            42          1223345677777766777774 799999999999999987654332 24579999999999999999


Q ss_pred             eEEEEecCCCCCCccccccccccccccccccccchhhhhhh
Q 002880          819 PKLLEVTYCPDCTRACKYDTEALVTGEVVKGADFFNYVFGC  859 (871)
Q Consensus       819 pwLLEVN~~P~l~~~~~~~~~~~~~~~~~~~p~f~n~~f~~  859 (871)
                      |||||||++|++.+.  +.            |++++++|+.
T Consensus       330 ~wllEVN~~P~~~q~--~i------------~~l~~~~~~i  356 (380)
T 3tig_A          330 VWLIEVNGAPACAQK--LY------------AELCKGIVDL  356 (380)
T ss_dssp             EEEEEEESSCCCCTT--TH------------HHHHHHHHHH
T ss_pred             EEEEEEeCCCCccHH--hH------------HHHHHHHHHH
Confidence            999999999999752  32            7788888875

PyMOL of 3tig

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A*	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri}	Back alignment and structure

>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri}	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B}	Back alignment and structure

>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A*	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens}	Back alignment and structure

>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A*	Back alignment and structure

>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae}	Back alignment and structure

>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A	Back alignment and structure

>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus}	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A	Back alignment and structure

>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus}	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae}	Back alignment and structure

>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A*	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes}	Back alignment and structure

>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A*	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens}	Back alignment and structure

>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I	Back alignment and structure

>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A	Back alignment and structure

>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A	Back alignment and structure

>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A*	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A*	Back alignment and structure

>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7	Back alignment and structure

>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A	Back alignment and structure

>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C*	Back alignment and structure

>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus}	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A*	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A*	Back alignment and structure

>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus}	Back alignment and structure

>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A	Back alignment and structure

>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens}	Back alignment and structure

>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens}	Back alignment and structure

>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes}	Back alignment and structure

>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes}	Back alignment and structure

>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium}	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A}	Back alignment and structure

>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D	Back alignment and structure

>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A*	Back alignment and structure

>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens}	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus}	Back alignment and structure

>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C*	Back alignment and structure

>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B*	Back alignment and structure

>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7	Back alignment and structure

>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B*	Back alignment and structure

>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens}	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A*	Back alignment and structure

>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1	Back alignment and structure

>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A*	Back alignment and structure

>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron}	Back alignment and structure

>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A	Back alignment and structure

>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B*	Back alignment and structure

>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {}	Back alignment and structure

>4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis}	Back alignment and structure

>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A	Back alignment and structure

>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X	Back alignment and structure

>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii}	Back alignment and structure

>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A*	Back alignment and structure

>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A*	Back alignment and structure

>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A*	Back alignment and structure

>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1	Back alignment and structure

>1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X*	Back alignment and structure

>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A*	Back alignment and structure

>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A*	Back alignment and structure

>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima}	Back alignment and structure

>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans}	Back alignment and structure

>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens}	Back alignment and structure

>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A*	Back alignment and structure

>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A*	Back alignment and structure

>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A*	Back alignment and structure

>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii}	Back alignment and structure

>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis}	Back alignment and structure

>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus}	Back alignment and structure

>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A*	Back alignment and structure

>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2	Back alignment and structure

>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis}	Back alignment and structure

>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A	Back alignment and structure

>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A*	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus}	Back alignment and structure

>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A	Back alignment and structure

>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A	Back alignment and structure

>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A*	Back alignment and structure

>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus}	Back alignment and structure

>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori}	Back alignment and structure

>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A*	Back alignment and structure

>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis}	Back alignment and structure

>1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A	Back alignment and structure

>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A	Back alignment and structure

>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A	Back alignment and structure

>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A*	Back alignment and structure

>2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens}	Back alignment and structure

>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ...	Back alignment and structure

>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A	Back alignment and structure

>1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2	Back alignment and structure

>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V}	Back alignment and structure

>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus}	Back alignment and structure

>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum}	Back alignment and structure

>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1	Back alignment and structure

>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A	Back alignment and structure

>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A*	Back alignment and structure

>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans}	Back alignment and structure

>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida}	Back alignment and structure

>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A	Back alignment and structure

>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A	Back alignment and structure

>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A*	Back alignment and structure

>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A*	Back alignment and structure

>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi}	Back alignment and structure

>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A*	Back alignment and structure

>3n6x_A Putative glutathionylspermidine synthase; domain of unknown function (DUF404), structural genomics; 2.35A {Methylobacillus flagellatus}	Back alignment and structure

>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A*	Back alignment and structure

>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A*	Back alignment and structure

>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A*	Back alignment and structure

>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis}	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A*	Back alignment and structure

>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus}	Back alignment and structure

>2f69_A Histone-lysine N-methyltransferase, H3 lysine-4 specific SET7; SET domain, protein lysine methyltransferase, enzyme- peptide-adohcy complex; HET: MLZ SAH; 1.30A {Homo sapiens} SCOP: b.76.2.1 b.85.7.1 PDB: 3m53_A* 3m55_A* 3m54_A* 3m56_A* 3m58_A* 3m57_A* 3m59_A* 3m5a_A* 1xqh_A* 4e47_A* 1n6a_A* 1o9s_A* 3cbp_A* 3cbm_A* 3cbo_A* 3os5_A*	Back alignment and structure

>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP structural genomics, protein structure initiative; HET: ATP; 2.50A {Thermococcus kodakarensis} SCOP: c.30.1.8 d.142.1.9	Back alignment and structure

>3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A*	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165}	Back alignment and structure

>3f9x_A Histone-lysine N-methyltransferase SETD8; methyltransferase, SET, lysine, alternative splicing, cell cycle, cell division, chromatin regulator, chromosomal protein, coiled coil; HET: MLY SAH; 1.25A {Homo sapiens} PDB: 3f9w_A* 3f9y_A* 3f9z_A* 1zkk_A* 4ij8_A* 2bqz_A*	Back alignment and structure

>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A*	Back alignment and structure

>1n3j_A A612L, histone H3 lysine methyltransferase; beta barrel, homodimer; NMR {Paramecium bursaria chlorella virus 1} SCOP: b.85.7.2 PDB: 2g46_A* 3kma_A 3kmj_A 3kmt_A*	Back alignment and structure

>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum}	Back alignment and structure

>3ope_A Probable histone-lysine N-methyltransferase ASH1L; SET, nucleus; HET: SAM; 2.90A {Homo sapiens}	Back alignment and structure

>3rq4_A Histone-lysine N-methyltransferase SUV420H2; suppressor, variegation 4-20 homolog 2, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.80A {Homo sapiens}	Back alignment and structure

>2w5y_A Histone-lysine N-methyltransferase HRX; transcription regulation, chromosomal rearrangement, protein lysine methyltransferase, proto-oncogene; HET: SAH; 2.00A {Homo sapiens} PDB: 2w5z_A*	Back alignment and structure

>3ooi_A Histone-lysine N-methyltransferase, H3 lysine-36 lysine-20 specific; SET domain, S-adenosyl-L methionine; HET: SAM; 1.75A {Homo sapiens}	Back alignment and structure

>2io8_A Bifunctional glutathionylspermidine synthetase/amidase; ligase, hydrolase; HET: ADP; 2.10A {Escherichia coli} SCOP: c.30.1.7 d.3.1.15 d.142.1.8 PDB: 2io7_A* 2io9_A* 2ioa_A* 2iob_A 3o98_A*	Back alignment and structure

>1h3i_A Histone H3 lysine 4 specific methyltransferase; 2.1A {Homo sapiens} SCOP: b.76.2.1 b.85.7.1 PDB: 1mt6_A* 1n6c_A* 1muf_A	Back alignment and structure

>1mvh_A Cryptic LOCI regulator 4; lysine methyltransferase, CLR4, SET-domain; 2.30A {Schizosaccharomyces pombe} SCOP: b.85.7.1 PDB: 1mvx_A	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>3s8p_A Histone-lysine N-methyltransferase SUV420H1; SET domain, histone methyltransferase, transcription regulat histone lysine, SAM, methylation, nucleus; HET: MSE SAM; 1.85A {Homo sapiens}	Back alignment and structure

>2vob_A Trypanothione synthetase; ligase; 2.3A {Leishmania major} PDB: 2vps_A 2vpm_A	Back alignment and structure

>3bo5_A Histone-lysine N-methyltransferase setmar; SET domain, chromati regulator, DNA damage, DNA repair, DNA-binding, nucleus, ST genomics; HET: SAH; 1.59A {Homo sapiens}	Back alignment and structure

>1ml9_A Histone H3 methyltransferase DIM-5; adoMet-dependent methyltransferase histone H3 lysine- 9 methylation; 1.98A {Neurospora crassa} SCOP: b.85.7.1 PDB: 1peg_A*	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>2r3a_A Histone-lysine N-methyltransferase SUV39H2; histone H3-K9 methyltransferase 2, H3 lysine-9 specific 2, alternative splicing, cell cycle; HET: SAM; 2.00A {Homo sapiens}	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>3hna_A Histone-lysine N-methyltransferase, H3 lysine-9 specific 5; EHMT1, structural genomics, SGC, structural genomics consortium, alternative splicing, ANK repeat; HET: MLZ SAH; 1.50A {Homo sapiens} PDB: 2rfi_A* 2igq_A* 3mo0_A* 3mo2_A* 3mo5_A* 3sw9_A* 3swc_A* 4h4h_A* 4i51_A* 3fpd_A* 3k5k_A* 3nni_A* 3rjw_A* 2o8j_A*	Back alignment and structure

>2qpw_A PR domain zinc finger protein 2; methyltransferase, activator, alternative initiation, alternative splicing, DNA-binding, metal-binding, nucleus; 1.79A {Homo sapiens} PDB: 2jv0_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		871
d1xkua_		305	c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99	4e-06
d1z7xw1		460	c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (	3e-05
d2omza2		384	c.10.2.1 (A:33-416) Internalin A {Listeria monocyt	3e-04
d1dcea3		124	c.10.2.2 (A:444-567) Rab geranylgeranyltransferase	4e-04
d1h6ta2		210	c.10.2.1 (A:31-240) Internalin B {Listeria monocyt	6e-04

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 47.3 bits (111), Expect = 4e-06
 Identities = 22/168 (13%), Positives = 54/168 (32%), Gaps = 23/168 (13%)

Query: 178 SKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPK 237
                L  + +    + T+   +       +L  L L+ N    K       ++      
Sbjct: 147 QGMKKLSYIRIADTNITTIPQGL-----PPSLTELHLDGN----KITKVDAASLKGLNNL 197

Query: 238 LEIYNSNFTINFGEWALGFCGEVYDKDNPSSLCLRDRP-----LQSVTSLDLSNRCIHNL 292
            ++  S  +I+  +           + + ++  L   P      + +  + L N  I  +
Sbjct: 198 AKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLADHKYIQVVYLHNNNISAI 257

Query: 293 VNKAFSP----AEMPSLSHLNIRGNPLEQNSVRELLEVLKGFPCLQSL 336
            +  F P     +  S S +++  NP++   ++        F C+   
Sbjct: 258 GSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQP-----STFRCVYVR 300

PyMOL of d1xkua_

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		871
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.42
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.35
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.31
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.26
d1a9na_		162	Splicesomal U2A' protein {Human (Homo sapiens) [Ta	99.23
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.23
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.22
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	99.2
d1h6ua2		227	Internalin H {Listeria monocytogenes [TaxId: 1639]	99.15
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.14
d2omxa2		199	Internalin B {Listeria monocytogenes [TaxId: 1639]	99.14
d1p9ag_		266	von Willebrand factor binding domain of glycoprote	99.12
d1dcea3		124	Rab geranylgeranyltransferase alpha-subunit, C-ter	99.09
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	99.08
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	99.07
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.06
d1w8aa_		192	Slit {Fruit fly (Drosophila melanogaster) [TaxId:	99.04
d2omza2		384	Internalin A {Listeria monocytogenes [TaxId: 1639]	99.04
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	99.01
d1ogqa_		313	Polygalacturonase inhibiting protein PGIP {Kidney	98.99
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.97
d1ozna_		284	Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma	98.95
d1h6ta2		210	Internalin B {Listeria monocytogenes [TaxId: 1639]	98.92
d1m9la_		198	Outer arm dynein light chain 1 {Green algae (Chlam	98.78
d2astb2		284	Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa	98.62
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.6
d1xkua_		305	Decorin {Cow (Bos taurus) [TaxId: 9913]}	98.6
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.59
d1i7na2		206	Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116	98.57
d2ca6a1		344	Rna1p (RanGAP1), N-terminal domain {Fission yeast	98.55
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.54
d2ifga3		156	High affinity nerve growth factor receptor, N-term	98.54
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	98.5
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	98.47
d1z7xw1		460	Ribonuclease inhibitor {Human (Homo sapiens) [TaxI	98.47
d1xwdc1		242	Follicle-stimulating hormone receptor {Human (Homo	98.45
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	98.38
d1e4ea2		211	D-alanine:D-lactate ligase VanA, C-domain {Enteroc	98.33
d1iowa2		210	D-ala-D-ala ligase, C-domain {Escherichia coli, ge	98.27
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.17
d1uc8a2		192	Lysine biosynthesis enzyme LysX ATP-binding domain	98.12
d1jl5a_		353	Leucine rich effector protein YopM {Yersinia pesti	98.12
d1pgva_		167	Tropomodulin C-terminal domain {nematode (Caenorha	98.02
d1ehia2		228	D-alanine:D-lactate ligase VanA, C-domain {Leucono	98.02
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	97.9
d1ulza3		214	Biotin carboxylase (BC), domain 2 {Aquifex aeolicu	97.86
d2r85a2		235	5-formaminoimidazole-4-carboxamide ribonucleotide	97.82
d1vkza3		220	Glycinamide ribonucleotide synthetase (GAR-syn), d	97.71
d2r7ka2		238	5-formaminoimidazole-4-carboxamide ribonucleotide	97.69
d1w96a3		267	Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye	97.58
d1gsaa2		192	Prokaryotic glutathione synthetase, C-domain {Esch	97.55
d1gsoa3		224	Glycinamide ribonucleotide synthetase (GAR-syn), d	97.55
d1koha1		162	mRNA export factor tap {Human (Homo sapiens) [TaxI	97.52
d1io0a_		166	Tropomodulin C-terminal domain {Chicken (Gallus ga	97.5
d1kjqa3		206	Glycinamide ribonucleotide transformylase PurT, do	96.42
d1a9xa6		259	Carbamoyl phosphate synthetase (CPS), large subuni	96.28
d2j9ga3		216	Biotin carboxylase (BC), domain 2 {Escherichia col	96.12
d2g46a1		119	Viral histone H3 Lysine 27 Methyltransferase {Para	95.38
d1a9xa5		275	Carbamoyl phosphate synthetase (CPS), large subuni	94.49
d2f69a2		171	Histone H3 K4-specific methyltransferase SET7/9 ca	94.19
d3etja3		198	N5-carboxyaminoimidazole ribonucleotide synthetase	91.45
d2io8a3		297	Glutathionylspermidine synthase, synthetase domain	91.12
d1mvha_		269	SET domain of Clr4 {Fission yeast (Schizosaccharom	90.88
d1ml9a_		284	Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]}	89.68

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: U2A'-like
domain: Splicesomal U2A' protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.42  E-value=7.6e-14  Score=135.94  Aligned_cols=136  Identities=19%  Similarity=0.222  Sum_probs=96.5

Q ss_pred             ccCCCCcEeeccCCccccHHHHHHHHhcCCCCCeeeCCCCcccccccccchhHHhhcCCCcccccccccccccccccccc
Q 002880          178 SKFPDLQALSLCGNKLETVEIIVQEVTKLKNLRALWLNNNPVLKKCDHCMEDAILQGCPKLEIYNSNFTINFGEWALGFC  257 (871)
Q Consensus       178 ~~~p~L~~L~Ls~N~L~~~~~i~~~l~~L~~Lk~L~Ls~N~l~~~~~~~~~~~i~~~lp~Le~lnl~~t~~~~~~~l~~~  257 (871)
                      .++.+|++|+|++|+|+.++   ..+..+++|+.|+||+|.|....          ++                      
T Consensus        15 ~n~~~lr~L~L~~n~I~~i~---~~~~~l~~L~~L~Ls~N~i~~l~----------~~----------------------   59 (162)
T d1a9na_          15 TNAVRDRELDLRGYKIPVIE---NLGATLDQFDAIDFSDNEIRKLD----------GF----------------------   59 (162)
T ss_dssp             ECTTSCEEEECTTSCCCSCC---CGGGGTTCCSEEECCSSCCCEEC----------CC----------------------
T ss_pred             cCcCcCcEEECCCCCCCccC---ccccccccCCEEECCCCCCCccC----------Cc----------------------
Confidence            45667888888888888753   34567788888888888874332          01                      


Q ss_pred             ccccCCCCCCCccccCCcCCccceeecCCccccccccccCCCCCCCCcceEeccCCCCCCcchHHHHHHhcCCCCcceeE
Q 002880          258 GEVYDKDNPSSLCLRDRPLQSVTSLDLSNRCIHNLVNKAFSPAEMPSLSHLNIRGNPLEQNSVRELLEVLKGFPCLQSLG  337 (871)
Q Consensus       258 ~~~~~~~~~~~i~~~~~~l~~L~~LdLS~N~I~~l~p~~~~~~~l~~L~~LnLs~N~L~~l~~~~i~~~l~~lp~L~~L~  337 (871)
                                      ..+++|+.|+|++|+|+++.+..+.  .+++|+.|+|++|+|.+++  ++ ..+..||+|++|+
T Consensus        60 ----------------~~l~~L~~L~ls~N~i~~l~~~~~~--~l~~L~~L~L~~N~i~~~~--~l-~~l~~l~~L~~L~  118 (162)
T d1a9na_          60 ----------------PLLRRLKTLLVNNNRICRIGEGLDQ--ALPDLTELILTNNSLVELG--DL-DPLASLKSLTYLC  118 (162)
T ss_dssp             ----------------CCCSSCCEEECCSSCCCEECSCHHH--HCTTCCEEECCSCCCCCGG--GG-GGGGGCTTCCEEE
T ss_pred             ----------------ccCcchhhhhcccccccCCCccccc--cccccccceeccccccccc--cc-cccccccccchhh
Confidence                            1266788888888888887555554  6888888888888888744  22 2467788888888


Q ss_pred             eeC-C-CCCCchhhHHhhhCCCcccccCcccchh
Q 002880          338 VDI-P-GPLGESAIEILESLPTLCTLNGVTASKI  369 (871)
Q Consensus       338 L~i-P-~~l~~~~~~Il~~L~~L~~Ln~~~vs~~  369 (871)
                      ++- | ....++...+++.+|+|+.|||..|+..
T Consensus       119 l~~N~i~~~~~~r~~~i~~lp~L~~LD~~~i~~~  152 (162)
T d1a9na_         119 ILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLK  152 (162)
T ss_dssp             CCSSGGGGSTTHHHHHHHHCTTCSEETTEECCHH
T ss_pred             cCCCccccccchHHHHHHHCCCcCeeCCCCCCHH
Confidence            872 1 1233444568899999999999999844

PyMOL of d1a9na_

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]}	Back information, alignment and structure

>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]}	Back information, alignment and structure

>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]}	Back information, alignment and structure

>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]}	Back information, alignment and structure

>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2g46a1 b.85.7.2 (A:1-119) Viral histone H3 Lysine 27 Methyltransferase {Paramecium bursaria chlorella virus 1, PBCV-1 [TaxId: 10506]}	Back information, alignment and structure

>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2f69a2 b.85.7.1 (A:194-364) Histone H3 K4-specific methyltransferase SET7/9 catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2io8a3 d.142.1.8 (A:201-378,A:497-615) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mvha_ b.85.7.1 (A:) SET domain of Clr4 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1ml9a_ b.85.7.1 (A:) Dim-5 {Fungus (Neurospora crassa) [TaxId: 5141]}	Back information, alignment and structure