Citrus Sinensis ID: 003349
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 828 | 2.2.26 [Sep-21-2011] | |||||||
| O04979 | 887 | Lon protease homolog 2, p | N/A | no | 0.977 | 0.912 | 0.838 | 0.0 | |
| O64948 | 888 | Lon protease homolog 2, p | yes | no | 0.977 | 0.911 | 0.842 | 0.0 | |
| Q0J032 | 884 | Lon protease homolog 2, p | yes | no | 0.974 | 0.912 | 0.819 | 0.0 | |
| B8BDV1 | 884 | Lon protease homolog 2, p | N/A | no | 0.974 | 0.912 | 0.819 | 0.0 | |
| P93647 | 885 | Lon protease homolog 2, p | N/A | no | 0.974 | 0.911 | 0.823 | 0.0 | |
| Q5PQY6 | 840 | Lon protease homolog 2, p | yes | no | 0.909 | 0.896 | 0.477 | 0.0 | |
| Q3SX23 | 852 | Lon protease homolog 2, p | yes | no | 0.920 | 0.894 | 0.474 | 0.0 | |
| Q9DBN5 | 852 | Lon protease homolog 2, p | yes | no | 0.931 | 0.904 | 0.459 | 0.0 | |
| Q2TAF8 | 856 | Lon protease homolog 2, p | N/A | no | 0.913 | 0.883 | 0.475 | 0.0 | |
| Q2IIK1 | 843 | Lon protease OS=Anaeromyx | yes | no | 0.875 | 0.860 | 0.470 | 0.0 |
| >sp|O04979|LONP2_SPIOL Lon protease homolog 2, peroxisomal OS=Spinacia oleracea PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 1385 bits (3585), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 685/817 (83%), Positives = 748/817 (91%), Gaps = 8/817 (0%)
Query: 17 GVGGDSSERASKVQVGASD-----GKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI 71
G G DS ER K Q G SD GK+QQE +HWH RGVAARALHLSRGVEKPSGRVTY
Sbjct: 74 GGGTDSGERNVKSQPGLSDSRKADGKSQQEAVHWHTRGVAARALHLSRGVEKPSGRVTYT 133
Query: 72 VVLEGLCRFSVQELSTRGTYYTARISSLEMTKIEMEQVEQDPDFIALSRQFKATAMELIS 131
VVLEGLCRF V EL++RG YYTARIS L++TK +MEQ +QDPDF++L+RQFK TA+ELIS
Sbjct: 134 VVLEGLCRFRVMELNSRGNYYTARISPLDITKADMEQAQQDPDFVSLARQFKVTAVELIS 193
Query: 132 VLEQKQKTGGRTKVLLETVPIHKLADIFVASFEISFEEQLVMLDSVDLKVRLSKATELVD 191
VLEQKQKTGGRTKVLLETVP+HKLADIFVASFEISFEEQL MLDS+DLKVRLSKATELVD
Sbjct: 194 VLEQKQKTGGRTKVLLETVPVHKLADIFVASFEISFEEQLCMLDSIDLKVRLSKATELVD 253
Query: 192 RHLQSIRVAEKITQKVEGQLSKSQKEFLLRQQMRAIKEELGDNDDDEDDLVALERKMQSA 251
RHLQSIRVAEKITQKVEGQLSKSQ+EFLLRQQMRAIKEELGDNDDDEDD+ LERKMQSA
Sbjct: 254 RHLQSIRVAEKITQKVEGQLSKSQREFLLRQQMRAIKEELGDNDDDEDDVAVLERKMQSA 313
Query: 252 GMPSNIWKHVQKELRRLKKMQPQQPGYTSSRVYLELIADLPWEKASEEIDLDLKAAKERL 311
GMP+NIWKH Q+ELRRLKKMQPQQPGY+SSRVYLEL+ADLPW+ A+EE LDL+AAKERL
Sbjct: 314 GMPANIWKHAQRELRRLKKMQPQQPGYSSSRVYLELLADLPWQNATEEQKLDLRAAKERL 373
Query: 312 DSDHYGLVRVKQRIIEYLAVRKLKPDARGPVLCFVGPPGVGKTSLASSIASALGRKFIRI 371
DSDHYGLV+VKQRIIEYLAVRKLKPDARGP+LCFVGPPGVGKTSLA+SI++ALGRKFIRI
Sbjct: 374 DSDHYGLVKVKQRIIEYLAVRKLKPDARGPILCFVGPPGVGKTSLAASISAALGRKFIRI 433
Query: 372 SLGGVKDEADIRGHRRTYIGSMPGRLIDGLKRVGVCNPVMLLDEIDKTGSDVRGDPASAL 431
SLGGVKDEADIRGHRRTYIGSMPGRLIDG+KRVGV NPVMLLDEIDKTGSDVRGDPASAL
Sbjct: 434 SLGGVKDEADIRGHRRTYIGSMPGRLIDGIKRVGVSNPVMLLDEIDKTGSDVRGDPASAL 493
Query: 432 LEVLDPEQNKTFNDHYLNVPFDLSKVIFVATANRAQPIPPPLLDRMEVIELPGYTPEEKL 491
LEVLDPEQNKTFNDHYLNVP+DLSKVIFVATAN+ QPIPPPLLDRMEVIELPGYTPEEK
Sbjct: 494 LEVLDPEQNKTFNDHYLNVPYDLSKVIFVATANKVQPIPPPLLDRMEVIELPGYTPEEKA 553
Query: 492 RIAMRHLIPRVLDQHGLGSEFLQIPEAMVKLVIQRYTREAGVRNLERNLAALARAAAVKV 551
RIAM++LIPRV+DQHGL SEFLQI E MVKL+IQRYTREAGVRNLERNL+ALARAAAVKV
Sbjct: 554 RIAMQYLIPRVMDQHGLSSEFLQISEDMVKLIIQRYTREAGVRNLERNLSALARAAAVKV 613
Query: 552 AEQEQEQALPSSKDVHRLGSPLLDNRLADGAEVEMEVIPMGESTHEVSNTFRITSPLVVD 611
AEQ+ A+ SKD H+ SP+ ++RLA+GAEVEMEVIPMG E+SN ++ SPL+VD
Sbjct: 614 AEQDNATAV--SKDFHQFTSPVEESRLAEGAEVEMEVIPMGVDNREISNALQVMSPLIVD 671
Query: 612 EAMLEKVLGPPRFDDREAAERVAAPGISVGLVWTNFGGEVQFVEATAMRGKGELHLTGQL 671
E MLE VLGPPR+DDRE AERV+ PG+SVGLVWT FGGEVQFVEA+ M GKGEL LTGQL
Sbjct: 672 ETMLENVLGPPRYDDRETAERVSNPGVSVGLVWTAFGGEVQFVEASVMAGKGELRLTGQL 731
Query: 672 GDVIKESAQIALTWVRARATDLQLVAEDGMNLLQGRDIHIHFPAGAVPKDGPSAGVTLVT 731
GDVIKESAQIALTWVRARA +L LVA +NL++GRDIHIHFPAGAVPKDGPSAGVTLVT
Sbjct: 732 GDVIKESAQIALTWVRARAMELNLVATGEINLMEGRDIHIHFPAGAVPKDGPSAGVTLVT 791
Query: 732 ALVSLFSRKRVRADTAMTGEMTLRGLVLPVGGVKDKILAAHRYGIKRVILPERNLKDLVE 791
ALVSL S+KR+RADTAMTGEMTLRGLVLPVGGVKDK+LAAHRYGIKRVILPERNLKDLVE
Sbjct: 792 ALVSLLSQKRMRADTAMTGEMTLRGLVLPVGGVKDKVLAAHRYGIKRVILPERNLKDLVE 851
Query: 792 VPAAVLASLEIILAKRMEDVLEQAFEGGCPWRQHSKL 828
VP+AVL++LEII AKRME VLEQAFEGGCPWRQ ++L
Sbjct: 852 VPSAVLSNLEIIYAKRME-VLEQAFEGGCPWRQRARL 887
|
ATP-dependent serine protease that mediates the selective degradation of misfolded and unassembled polypeptides in the peroxisomal matrix. Necessary for type 2 peroxisome targeting signal (PTS2)-containing protein processing and facilitates peroxisome matrix protein import. Spinacia oleracea (taxid: 3562) EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: - |
| >sp|O64948|LONP2_ARATH Lon protease homolog 2, peroxisomal OS=Arabidopsis thaliana GN=LON2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q0J032|LONP2_ORYSJ Lon protease homolog 2, peroxisomal OS=Oryza sativa subsp. japonica GN=Os09g0533400 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|B8BDV1|LONP2_ORYSI Lon protease homolog 2, peroxisomal OS=Oryza sativa subsp. indica GN=LON1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P93647|LONP2_MAIZE Lon protease homolog 2, peroxisomal OS=Zea mays GN=LON1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5PQY6|LONP2_DANRE Lon protease homolog 2, peroxisomal OS=Danio rerio GN=lonp2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q3SX23|LONP2_BOVIN Lon protease homolog 2, peroxisomal OS=Bos taurus GN=LONP2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9DBN5|LONP2_MOUSE Lon protease homolog 2, peroxisomal OS=Mus musculus GN=Lonp2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q2TAF8|LONP2_XENLA Lon protease homolog 2, peroxisomal OS=Xenopus laevis GN=lonp2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q2IIK1|LON_ANADE Lon protease OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lon PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 828 | ||||||
| 255575800 | 890 | ATP-dependent protease La, putative [Ric | 0.973 | 0.905 | 0.898 | 0.0 | |
| 147834823 | 904 | hypothetical protein VITISV_034238 [Viti | 0.984 | 0.901 | 0.891 | 0.0 | |
| 225427356 | 888 | PREDICTED: lon protease homolog 2, perox | 0.978 | 0.912 | 0.895 | 0.0 | |
| 224126585 | 893 | predicted protein [Populus trichocarpa] | 0.978 | 0.907 | 0.880 | 0.0 | |
| 224137996 | 893 | predicted protein [Populus trichocarpa] | 0.975 | 0.904 | 0.878 | 0.0 | |
| 357482271 | 883 | Lon protease-like protein [Medicago trun | 0.973 | 0.912 | 0.856 | 0.0 | |
| 356497070 | 889 | PREDICTED: lon protease homolog 2, perox | 0.978 | 0.911 | 0.880 | 0.0 | |
| 449511525 | 816 | PREDICTED: lon protease homolog 2, perox | 0.975 | 0.990 | 0.876 | 0.0 | |
| 449464900 | 886 | PREDICTED: lon protease homolog 2, perox | 0.985 | 0.920 | 0.868 | 0.0 | |
| 356563427 | 886 | PREDICTED: lon protease homolog 2, perox | 0.975 | 0.911 | 0.863 | 0.0 |
| >gi|255575800|ref|XP_002528799.1| ATP-dependent protease La, putative [Ricinus communis] gi|223531802|gb|EEF33621.1| ATP-dependent protease La, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1458 bits (3775), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 735/818 (89%), Positives = 767/818 (93%), Gaps = 12/818 (1%)
Query: 17 GVGGDSSERASKVQVGASD------GKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTY 70
GVG DS K+QV SD GK+QQEVI WHNRGVAARALHLSRGVEKPSGRVTY
Sbjct: 79 GVGNDSG----KIQVNNSDNNLKLDGKSQQEVIRWHNRGVAARALHLSRGVEKPSGRVTY 134
Query: 71 IVVLEGLCRFSVQELSTRGTYYTARISSLEMTKIEMEQVEQDPDFIALSRQFKATAMELI 130
IVVLEGLCRFSVQELS RG YYTARISSLEMTK EMEQVEQDPDF++LSRQFKATAMELI
Sbjct: 135 IVVLEGLCRFSVQELSKRGMYYTARISSLEMTKAEMEQVEQDPDFVSLSRQFKATAMELI 194
Query: 131 SVLEQKQKTGGRTKVLLETVPIHKLADIFVASFEISFEEQLVMLDSVDLKVRLSKATELV 190
SVLEQKQKT GRTKVLLETVPIHKLADIFVASFE+SFEEQL MLDS+DLK+RLSKATELV
Sbjct: 195 SVLEQKQKTDGRTKVLLETVPIHKLADIFVASFEMSFEEQLSMLDSIDLKIRLSKATELV 254
Query: 191 DRHLQSIRVAEKITQKVEGQLSKSQKEFLLRQQMRAIKEELGDNDDDEDDLVALERKMQS 250
DRHLQSIRVAEKI+QKVEGQLSKSQKEFLLRQQMRAIKEELGDNDDDEDD+ ALERKMQS
Sbjct: 255 DRHLQSIRVAEKISQKVEGQLSKSQKEFLLRQQMRAIKEELGDNDDDEDDVAALERKMQS 314
Query: 251 AGMPSNIWKHVQKELRRLKKMQPQQPGYTSSRVYLELIADLPWEKASEEIDLDLKAAKER 310
AGMPSNIWKH Q+ELRRLKKMQPQQPGY SSRVYLEL+ADLPW+K SEE DLDLKAAKER
Sbjct: 315 AGMPSNIWKHAQRELRRLKKMQPQQPGYNSSRVYLELLADLPWQKDSEEHDLDLKAAKER 374
Query: 311 LDSDHYGLVRVKQRIIEYLAVRKLKPDARGPVLCFVGPPGVGKTSLASSIASALGRKFIR 370
LDSDHYGLV+VKQRIIEYLAVRKLKPDARGPVLCFVGPPGVGKTSLASSIA+ALGRKF+R
Sbjct: 375 LDSDHYGLVKVKQRIIEYLAVRKLKPDARGPVLCFVGPPGVGKTSLASSIATALGRKFVR 434
Query: 371 ISLGGVKDEADIRGHRRTYIGSMPGRLIDGLKRVGVCNPVMLLDEIDKTGSDVRGDPASA 430
+SLGGVKDEADIRGHRRTYIGSMPGRLIDGLKRVGVCNPVMLLDEIDKTGSDVRGDPASA
Sbjct: 435 LSLGGVKDEADIRGHRRTYIGSMPGRLIDGLKRVGVCNPVMLLDEIDKTGSDVRGDPASA 494
Query: 431 LLEVLDPEQNKTFNDHYLNVPFDLSKVIFVATANRAQPIPPPLLDRMEVIELPGYTPEEK 490
LLEVLDPEQNKTFNDHYLNVPFDLSKVIFVATANRAQPIPPPLLDRMEVIELPGYTPEEK
Sbjct: 495 LLEVLDPEQNKTFNDHYLNVPFDLSKVIFVATANRAQPIPPPLLDRMEVIELPGYTPEEK 554
Query: 491 LRIAMRHLIPRVLDQHGLGSEFLQIPEAMVKLVIQRYTREAGVRNLERNLAALARAAAVK 550
LRIAMRHLIPRVLDQHGLGSEFLQIPEAMVKLVIQRYTREAGVRNLER + A A A
Sbjct: 555 LRIAMRHLIPRVLDQHGLGSEFLQIPEAMVKLVIQRYTREAGVRNLER--SLAALARAAA 612
Query: 551 VAEQEQEQALPSSKDVHRLGSPLLDNRLADGAEVEMEVIPMGESTHEVSNTFRITSPLVV 610
V EQEQALP SK++HRL SPLL+NRLADGAEVEMEVIPM ++ HE+SN+FR+ S LVV
Sbjct: 613 VRLAEQEQALPLSKNMHRLASPLLENRLADGAEVEMEVIPMSDNNHELSNSFRVASALVV 672
Query: 611 DEAMLEKVLGPPRFDDREAAERVAAPGISVGLVWTNFGGEVQFVEATAMRGKGELHLTGQ 670
DEAMLEKVLGPPRFDD+EAAERVA+PGISVGLVWT FGGEVQFVEATAM GKG+LHLTGQ
Sbjct: 673 DEAMLEKVLGPPRFDDKEAAERVASPGISVGLVWTAFGGEVQFVEATAMAGKGDLHLTGQ 732
Query: 671 LGDVIKESAQIALTWVRARATDLQLVAEDGMNLLQGRDIHIHFPAGAVPKDGPSAGVTLV 730
LGDVIKESAQIALTWVRARATDLQ A +NLL+GRDIHIHFPAGAVPKDGPSAGVTLV
Sbjct: 733 LGDVIKESAQIALTWVRARATDLQFAAAHEINLLEGRDIHIHFPAGAVPKDGPSAGVTLV 792
Query: 731 TALVSLFSRKRVRADTAMTGEMTLRGLVLPVGGVKDKILAAHRYGIKRVILPERNLKDLV 790
TALVSLFSRKRVRADTAMTGEMTLRGLVLPVGG+KDKILAAHRYGIKRVILPERNLKDLV
Sbjct: 793 TALVSLFSRKRVRADTAMTGEMTLRGLVLPVGGIKDKILAAHRYGIKRVILPERNLKDLV 852
Query: 791 EVPAAVLASLEIILAKRMEDVLEQAFEGGCPWRQHSKL 828
EVPAAVL SLEI+LAKRMEDVLEQAFEGGCPWR HSKL
Sbjct: 853 EVPAAVLGSLEILLAKRMEDVLEQAFEGGCPWRIHSKL 890
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147834823|emb|CAN75012.1| hypothetical protein VITISV_034238 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225427356|ref|XP_002282657.1| PREDICTED: lon protease homolog 2, peroxisomal [Vitis vinifera] gi|297742183|emb|CBI33970.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224126585|ref|XP_002329591.1| predicted protein [Populus trichocarpa] gi|222870300|gb|EEF07431.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224137996|ref|XP_002326492.1| predicted protein [Populus trichocarpa] gi|222833814|gb|EEE72291.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357482271|ref|XP_003611421.1| Lon protease-like protein [Medicago truncatula] gi|355512756|gb|AES94379.1| Lon protease-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356497070|ref|XP_003517387.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449511525|ref|XP_004163979.1| PREDICTED: lon protease homolog 2, peroxisomal-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449464900|ref|XP_004150167.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356563427|ref|XP_003549964.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 828 | ||||||
| TAIR|locus:2171037 | 888 | LON2 "lon protease 2" [Arabido | 0.977 | 0.911 | 0.806 | 0.0 | |
| ZFIN|ZDB-GENE-041212-1 | 840 | lonp2 "lon peptidase 2, peroxi | 0.585 | 0.577 | 0.458 | 1e-178 | |
| UNIPROTKB|E2RG41 | 852 | LONP2 "Lon protease homolog" [ | 0.590 | 0.573 | 0.441 | 2.9e-172 | |
| UNIPROTKB|Q3SX23 | 852 | LONP2 "Lon protease homolog 2, | 0.925 | 0.899 | 0.445 | 4e-170 | |
| UNIPROTKB|Q86WA8 | 852 | LONP2 "Lon protease homolog 2, | 0.590 | 0.573 | 0.437 | 7.8e-170 | |
| MGI|MGI:1914137 | 852 | Lonp2 "lon peptidase 2, peroxi | 0.916 | 0.890 | 0.438 | 2e-168 | |
| RGD|1305466 | 852 | Lonp2 "lon peptidase 2, peroxi | 0.922 | 0.896 | 0.437 | 1.4e-167 | |
| UNIPROTKB|F1NYI8 | 844 | LONP2 "Lon protease homolog" [ | 0.915 | 0.898 | 0.442 | 2.2e-167 | |
| UNIPROTKB|B7ZKL7 | 808 | LONP2 "Lon protease homolog" [ | 0.483 | 0.495 | 0.469 | 1.3e-158 | |
| TIGR_CMR|GSU_3193 | 819 | GSU_3193 "ATP-dependent protea | 0.562 | 0.568 | 0.431 | 9e-156 |
| TAIR|locus:2171037 LON2 "lon protease 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 3324 (1175.2 bits), Expect = 0., P = 0.
Identities = 660/818 (80%), Positives = 712/818 (87%)
Query: 17 GVGGDSSERASKVQVGA-----SDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI 71
G G DS ER+ K VG SD K+QQ+ + WH RGVAARALHLSRGVEKPSGRVTY+
Sbjct: 74 GAGSDSGERSLKFLVGTTDAQKSDAKDQQD-LQWHTRGVAARALHLSRGVEKPSGRVTYV 132
Query: 72 VVLEGLCRFSVQELSTRGTYYTARISSLEMTKIEMEQVEQDPDFIALSRQFKATAMELIS 131
VVLEGL RF+VQEL RG Y ARI+SLEMTK E+EQV+QDPDF+ALSRQFK TAMEL+S
Sbjct: 133 VVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELEQVKQDPDFVALSRQFKTTAMELVS 192
Query: 132 VLEQKQKTGGRTKVLLETVPIHKLADIFVASFEISFEEQLVMLDSVDLKVRLSKATELVD 191
VLEQKQKTGGRTKVLLETVPIHKLADIFVASFE+SFEEQL MLDSVDLKVRLSKATELVD
Sbjct: 193 VLEQKQKTGGRTKVLLETVPIHKLADIFVASFEMSFEEQLSMLDSVDLKVRLSKATELVD 252
Query: 192 RHLQSIRVAEKITQKVEGQLSKSQKEFLLRQQMRAIKXXXXXXXXXXXXXXXXXRKMQSA 251
RHLQSIRVAEKITQKVEGQLSKSQKE+LLRQQMRAIK RKMQ+A
Sbjct: 253 RHLQSIRVAEKITQKVEGQLSKSQKEYLLRQQMRAIKEELGDNDDDEDDVAALERKMQAA 312
Query: 252 GMPSNIWKHVQKELRRLKKMQPQQPGYTSSRVYLELIADLPWEKASEEIDLDLKAAKERL 311
GMPSNIWKH Q+ELRRLKKMQPQQPGY SSRVYLEL+ADLPW+KASEE +LDLKAAKERL
Sbjct: 313 GMPSNIWKHAQRELRRLKKMQPQQPGYNSSRVYLELLADLPWDKASEEHELDLKAAKERL 372
Query: 312 DSDHYGLVRVKQRIIEYLAVRKLKPDARGPVLCFVGPPGVGKTSLASSIASALGRKFIRI 371
DSDHYGL +VKQRIIEYLAVRKLKPDARGPVLCFVGPPGVGKTSLASSIA+ALGRKF+R+
Sbjct: 373 DSDHYGLAKVKQRIIEYLAVRKLKPDARGPVLCFVGPPGVGKTSLASSIAAALGRKFVRL 432
Query: 372 SLGGVKDEADIRGHRRTYIGSMPGRLIDGLKRVGVCNPVMLLDEIDKTGSDVRGDPASAL 431
SLGGVKDEADIRGHRRTYIGSMPGRLIDGLKRVGVCNPVMLLDEIDKTGSDVRGDPASAL
Sbjct: 433 SLGGVKDEADIRGHRRTYIGSMPGRLIDGLKRVGVCNPVMLLDEIDKTGSDVRGDPASAL 492
Query: 432 LEVLDPEQNKTFNDHYLNVPFDLSKVIFVATANRAQPIPPPLLDRMEVIELPGYTPEEKL 491
LEVLDPEQNK+FNDHYLNVP+DLSKV+FVATANR QPIPPPLLDRME+IELPGYT EEKL
Sbjct: 493 LEVLDPEQNKSFNDHYLNVPYDLSKVVFVATANRVQPIPPPLLDRMELIELPGYTQEEKL 552
Query: 492 RIAMRHLIPRVLDQHGLGSEFLQIPEAMVKLVIQRYTREAGXXXXXXXXXXXXXXXXXXX 551
+IAMRHLIPRVLDQHGL SEFL+IPEAMVK +IQRYTREAG
Sbjct: 553 KIAMRHLIPRVLDQHGLSSEFLKIPEAMVKNIIQRYTREAGVRSLERNLAALARAAAVMV 612
Query: 552 XXXXXXXXXPSSKDVHRLGSPLLDNRLADGAEVEMEVIPMGESTHEVSNTFRITSPLVVD 611
P SKDV +L SPLL+ R+A+G EVEMEVIPMG + HE+ TF+ S LVVD
Sbjct: 613 AEHEQSL--PLSKDVQKLTSPLLNGRMAEGGEVEMEVIPMGVNDHEIGGTFQSPSALVVD 670
Query: 612 EAMLEKVLGPPRFDDREAAERVAAPGISVGLVWTNFGGEVQFVEATAMRGKGELHLTGQL 671
E MLEK+LGPPRFDD EAA+RVA+ G+SVGLVWT FGGEVQFVEAT+M GKGE+HLTGQL
Sbjct: 671 ETMLEKILGPPRFDDSEAADRVASAGVSVGLVWTTFGGEVQFVEATSMVGKGEMHLTGQL 730
Query: 672 GDVIKESAQIALTWVRARATDLQLVAEDGMNLLQGRDIHIHFPAGAVPKDGPSAGVTLVT 731
GDVIKESAQ+ALTWVRARA+D +L MN+L GRDIHIHFPAGAVPKDGPSAGVTLVT
Sbjct: 731 GDVIKESAQLALTWVRARASDFKLALAGDMNVLDGRDIHIHFPAGAVPKDGPSAGVTLVT 790
Query: 732 ALVSLFSRKRVRADTAMTGEMTLRGLVLPVGGVKDKILAAHRYGIKRVILPERNLKDLVE 791
ALVSLFS+KRVRADTAMTGEMTLRGLVLPVGG+KDKILAAHRYGIKRVILP+RN KDLVE
Sbjct: 791 ALVSLFSQKRVRADTAMTGEMTLRGLVLPVGGIKDKILAAHRYGIKRVILPQRNSKDLVE 850
Query: 792 VPAAVLASLEIILAKRMEDVLEQAFEGGCPWRQ-HSKL 828
VPAAVL+SLE+ILAKRMEDVLE AFEGGCPWR +SKL
Sbjct: 851 VPAAVLSSLEVILAKRMEDVLENAFEGGCPWRNNYSKL 888
|
|
| ZFIN|ZDB-GENE-041212-1 lonp2 "lon peptidase 2, peroxisomal" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RG41 LONP2 "Lon protease homolog" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3SX23 LONP2 "Lon protease homolog 2, peroxisomal" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86WA8 LONP2 "Lon protease homolog 2, peroxisomal" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914137 Lonp2 "lon peptidase 2, peroxisomal" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1305466 Lonp2 "lon peptidase 2, peroxisomal" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NYI8 LONP2 "Lon protease homolog" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7ZKL7 LONP2 "Lon protease homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|GSU_3193 GSU_3193 "ATP-dependent protease La" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| B8BDV1 | LONP2_ORYSI | 3, ., 4, ., 2, 1, ., - | 0.8190 | 0.9746 | 0.9128 | N/A | no |
| Q3SX23 | LONP2_BOVIN | 3, ., 4, ., 2, 1, ., - | 0.4742 | 0.9202 | 0.8943 | yes | no |
| Q6MGP8 | LON2_BDEBA | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4244 | 0.8297 | 0.8576 | yes | no |
| B5YFG2 | LON_DICT6 | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4474 | 0.8248 | 0.8623 | yes | no |
| B3QSJ7 | LON_CHLT3 | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4200 | 0.8357 | 0.8277 | yes | no |
| B8CY71 | LON_HALOH | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4127 | 0.8248 | 0.8722 | yes | no |
| Q86WA8 | LONP2_HUMAN | 3, ., 4, ., 2, 1, ., - | 0.4686 | 0.9190 | 0.8931 | yes | no |
| Q2IIK1 | LON_ANADE | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4700 | 0.8756 | 0.8600 | yes | no |
| P0A9M1 | LON_ECOL6 | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4341 | 0.8188 | 0.8647 | yes | no |
| Q1MS21 | LON_LAWIP | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4382 | 0.8381 | 0.8361 | yes | no |
| Q5PQY6 | LONP2_DANRE | 3, ., 4, ., 2, 1, ., - | 0.4778 | 0.9094 | 0.8964 | yes | no |
| Q3MIB4 | LONP2_RAT | 3, ., 4, ., 2, 1, ., - | 0.4615 | 0.9214 | 0.8955 | yes | no |
| P93647 | LONP2_MAIZE | 3, ., 4, ., 2, 1, ., - | 0.8237 | 0.9746 | 0.9118 | N/A | no |
| Q0AWF3 | LON_SYNWW | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4310 | 0.8212 | 0.8374 | yes | no |
| O69177 | LON_RHIME | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4106 | 0.8647 | 0.8883 | yes | no |
| B8EMF2 | LON_METSB | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4095 | 0.8768 | 0.8962 | yes | no |
| Q1IPZ8 | LON_KORVE | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4298 | 0.8248 | 0.8390 | yes | no |
| P46067 | LON_ERWAM | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4268 | 0.8272 | 0.8737 | yes | no |
| A4XJL4 | LON_CALS8 | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4435 | 0.8188 | 0.8759 | yes | no |
| B2KCC0 | LON_ELUMP | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4168 | 0.8381 | 0.8361 | yes | no |
| P36774 | LON2_MYXXA | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4788 | 0.8719 | 0.8730 | yes | no |
| Q39QP7 | LON_GEOMG | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4481 | 0.8393 | 0.8444 | yes | no |
| Q9DBN5 | LONP2_MOUSE | 3, ., 4, ., 2, 1, ., - | 0.4595 | 0.9311 | 0.9049 | yes | no |
| B0TFI9 | LON_HELMI | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4459 | 0.8248 | 0.8400 | yes | no |
| Q5H432 | LON_XANOR | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4294 | 0.8659 | 0.8435 | yes | no |
| B3E7K2 | LON_GEOLS | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4219 | 0.8466 | 0.8590 | yes | no |
| A4J7L6 | LON_DESRM | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4188 | 0.8429 | 0.8617 | yes | no |
| Q2LVS9 | LON_SYNAS | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4539 | 0.8502 | 0.8911 | yes | no |
| O64948 | LONP2_ARATH | 3, ., 4, ., 2, 1, ., - | 0.8422 | 0.9770 | 0.9110 | yes | no |
| A9B5N1 | LON1_HERA2 | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4368 | 0.8333 | 0.8466 | yes | no |
| B2TFQ5 | LON_BURPP | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4190 | 0.8236 | 0.8482 | yes | no |
| O04979 | LONP2_SPIOL | 3, ., 4, ., 2, 1, ., - | 0.8384 | 0.9770 | 0.9120 | N/A | no |
| A0LG61 | LON2_SYNFM | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4184 | 0.8115 | 0.8506 | yes | no |
| Q3JBB6 | LON_NITOC | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4232 | 0.8272 | 0.8873 | yes | no |
| B2V6N0 | LON_SULSY | 3, ., 4, ., 2, 1, ., 5, 3 | 0.4223 | 0.8236 | 0.8525 | yes | no |
| Q0J032 | LONP2_ORYSJ | 3, ., 4, ., 2, 1, ., - | 0.8190 | 0.9746 | 0.9128 | yes | no |
| Q5R6M5 | LONP2_PONAB | 3, ., 4, ., 2, 1, ., - | 0.4649 | 0.9190 | 0.8931 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.4.21 | 0.921 |
| 3rd Layer | 3.4.21.53 | 0.914 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | estExt_fgenesh4_pg.C_1180067 | hypothetical protein (893 aa) | |||||||||
(Populus trichocarpa) | |||||||||||
 | gw1.XV.374.1 | • | • | 0.686 | |||||||
 | gw1.XII.172.1 | • | • | 0.640 | |||||||
 | fgenesh4_pg.C_scaffold_15407000001 | • | • | 0.555 | |||||||
 | gw1.86.193.1 | • | • | 0.486 | |||||||
 | eugene3.00020856 | • | • | 0.455 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 828 | |||
| TIGR00763 | 775 | TIGR00763, lon, ATP-dependent protease La | 0.0 | |
| COG0466 | 782 | COG0466, Lon, ATP-dependent Lon protease, bacteria | 0.0 | |
| PRK10787 | 784 | PRK10787, PRK10787, DNA-binding ATP-dependent prot | 0.0 | |
| pfam05362 | 205 | pfam05362, Lon_C, Lon protease (S16) C-terminal pr | 4e-91 | |
| pfam00004 | 131 | pfam00004, AAA, ATPase family associated with vari | 5e-28 | |
| TIGR00764 | 608 | TIGR00764, lon_rel, lon-related putative ATP-depen | 4e-23 | |
| TIGR02902 | 531 | TIGR02902, spore_lonB, ATP-dependent protease LonB | 2e-22 | |
| COG1067 | 647 | COG1067, LonB, Predicted ATP-dependent protease [P | 9e-22 | |
| PRK13765 | 637 | PRK13765, PRK13765, ATP-dependent protease Lon; Pr | 2e-21 | |
| TIGR02903 | 615 | TIGR02903, spore_lon_C, ATP-dependent protease, Lo | 3e-20 | |
| COG0714 | 329 | COG0714, COG0714, MoxR-like ATPases [General funct | 4e-16 | |
| cd00009 | 151 | cd00009, AAA, The AAA+ (ATPases Associated with a | 7e-13 | |
| pfam02190 | 191 | pfam02190, LON, ATP-dependent protease La (LON) do | 5e-11 | |
| pfam07728 | 135 | pfam07728, AAA_5, AAA domain (dynein-related subfa | 2e-09 | |
| COG0464 | 494 | COG0464, SpoVK, ATPases of the AAA+ class [Posttra | 1e-08 | |
| COG2256 | 436 | COG2256, MGS1, ATPase related to the helicase subu | 1e-07 | |
| PRK13342 | 413 | PRK13342, PRK13342, recombination factor protein R | 1e-07 | |
| PRK11823 | 446 | PRK11823, PRK11823, DNA repair protein RadA; Provi | 3e-07 | |
| COG1750 | 579 | COG1750, COG1750, Archaeal serine proteases [Gener | 5e-07 | |
| smart00382 | 148 | smart00382, AAA, ATPases associated with a variety | 9e-07 | |
| PHA02544 | 316 | PHA02544, 44, clamp loader, small subunit; Provisi | 1e-06 | |
| TIGR00416 | 454 | TIGR00416, sms, DNA repair protein RadA | 2e-06 | |
| pfam07724 | 168 | pfam07724, AAA_2, AAA domain (Cdc48 subfamily) | 3e-06 | |
| COG2255 | 332 | COG2255, RuvB, Holliday junction resolvasome, heli | 4e-06 | |
| TIGR03345 | 852 | TIGR03345, VI_ClpV1, type VI secretion ATPase, Clp | 5e-06 | |
| TIGR02639 | 730 | TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi | 5e-06 | |
| TIGR02653 | 675 | TIGR02653, Lon_rel_chp, conserved hypothetical pro | 6e-06 | |
| pfam07726 | 131 | pfam07726, AAA_3, ATPase family associated with va | 2e-05 | |
| TIGR00635 | 305 | TIGR00635, ruvB, Holliday junction DNA helicase, R | 2e-05 | |
| COG1066 | 456 | COG1066, Sms, Predicted ATP-dependent serine prote | 3e-05 | |
| pfam13541 | 121 | pfam13541, ChlI, Subunit ChlI of Mg-chelatase | 4e-05 | |
| COG4930 | 683 | COG4930, COG4930, Predicted ATP-dependent Lon-type | 5e-05 | |
| COG5271 | 4600 | COG5271, MDN1, AAA ATPase containing von Willebran | 6e-05 | |
| COG0542 | 786 | COG0542, clpA, ATP-binding subunits of Clp proteas | 5e-04 | |
| PRK11034 | 758 | PRK11034, clpA, ATP-dependent Clp protease ATP-bin | 8e-04 | |
| TIGR03922 | 557 | TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas | 0.002 | |
| PRK10733 | 644 | PRK10733, hflB, ATP-dependent metalloprotease; Rev | 0.002 | |
| COG1484 | 254 | COG1484, DnaC, DNA replication protein [DNA replic | 0.002 | |
| pfam00910 | 105 | pfam00910, RNA_helicase, RNA helicase | 0.002 | |
| PRK00080 | 328 | PRK00080, ruvB, Holliday junction DNA helicase Ruv | 0.002 | |
| COG4088 | 261 | COG4088, COG4088, Predicted nucleotide kinase [Nuc | 0.002 | |
| cd00267 | 157 | cd00267, ABC_ATPase, ATP-binding cassette transpor | 0.002 |
| >gnl|CDD|233119 TIGR00763, lon, ATP-dependent protease La | Back alignment and domain information |
|---|
Score = 1005 bits (2600), Expect = 0.0
Identities = 377/779 (48%), Positives = 505/779 (64%), Gaps = 56/779 (7%)
Query: 39 QQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISS 98
+ E ++ GV A+ L + SG TY VV+EGL R ++ELS +G Y R+ +
Sbjct: 52 EPEEDDIYSVGVVAQILEMLPLPS--SGTATYKVVVEGLRRIRIKELSDKGGYLVVRVDN 109
Query: 99 LEMTKIEMEQVEQDPDFIALSRQFKATAMELISVLEQKQKTGGRTKVLLETVPIHKLADI 158
L+ + D + AL+R+ K T ELIS+ + ++ L + +LAD
Sbjct: 110 LKEEPFDK----DDEEIKALTREIKETFRELISLSKLFREQPALLSALEDIDEPGRLADF 165
Query: 159 FVASFEIS-FEEQLVMLDSVDLKVRLSKATELVDRHLQSIRVAEKITQKVEGQLSKSQKE 217
AS ++ +E +L++V+++ RL KA EL+ + L+ +++ KIT+KVE ++ K+Q+E
Sbjct: 166 VAASLQLKEKDELQEVLETVNIEKRLKKALELLKKELELLKLQNKITKKVEEKMEKTQRE 225
Query: 218 FLLRQQMRAIKEELGDNDDDEDDLVALERKMQSAGMPSNIWKHVQKELRRLKKMQPQQPG 277
+ LR+Q++AIK+ELG DD+D+L L+ K++ +P + K ++KEL +L ++P
Sbjct: 226 YYLREQLKAIKKELGIEKDDKDELEKLKEKLEELKLPEEVKKVIEKELTKLSLLEPSSSE 285
Query: 278 YTSSRVYLELIADLPWEKASEEIDLDLKAAKERLDSDHYGLVRVKQRIIEYLAVRKLKPD 337
+T +R YL+ + DLPW K S+E +LDLK AKE LD DHYGL +VK+RI+EYLAV+KL+
Sbjct: 286 FTVTRNYLDWLTDLPWGKYSKE-NLDLKRAKEILDEDHYGLKKVKERILEYLAVQKLRGK 344
Query: 338 ARGPVLCFVGPPGVGKTSLASSIASALGRKFIRISLGGVKDEADIRGHRRTYIGSMPGRL 397
+GP+LC VGPPGVGKTSL SIA AL RKF+R SLGGV+DEA+IRGHRRTY+G+MPGR+
Sbjct: 345 MKGPILCLVGPPGVGKTSLGKSIAKALNRKFVRFSLGGVRDEAEIRGHRRTYVGAMPGRI 404
Query: 398 IDGLKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNKTFNDHYLNVPFDLSKV 457
I GLK+ NP+ LLDEIDK GS RGDPASALLEVLDPEQN F+DHYL+VPFDLSKV
Sbjct: 405 IQGLKKAKTKNPLFLLDEIDKIGSSFRGDPASALLEVLDPEQNNAFSDHYLDVPFDLSKV 464
Query: 458 IFVATANRAQPIPPPLLDRMEVIELPGYTPEEKLRIAMRHLIPRVLDQHGLGSEFLQIPE 517
IF+ATAN IP PLLDRMEVIEL GYT EEKL IA ++LIP+ L+ HGL + L+I +
Sbjct: 465 IFIATANSIDTIPRPLLDRMEVIELSGYTEEEKLEIAKKYLIPKALEDHGLKPDELKITD 524
Query: 518 AMVKLVIQRYTREAGVRNLERNLAALARAAAVKVAEQEQEQALPSSKDVHRLGSPLLDNR 577
+ L+I+ YTREAGVRNLER + + R AAVK+ EQ
Sbjct: 525 EALLLLIKYYTREAGVRNLERQIEKICRKAAVKLVEQG---------------------- 562
Query: 578 LADGAEVEMEVIPMGESTHEVSNTFRITSPLVVDEAMLEKVLGPPRFDDREAAERVAAPG 637
E + +V+ L+K LG P F E A V PG
Sbjct: 563 -----EKKKSEA----------------ESVVITPDNLKKYLGKPVFTY-ERAYEVTPPG 600
Query: 638 ISVGLVWTNFGGEVQFVEATAMRGKGELHLTGQLGDVIKESAQIALTWVRARATDLQLVA 697
+ +GL WT GG+ F+E T + GKG L LTGQLGDV+KESAQIALT+VR+ A DL +
Sbjct: 601 VVMGLAWTPMGGDTLFIETTKVAGKGSLELTGQLGDVMKESAQIALTYVRSIAADLGI-- 658
Query: 698 EDGMNLLQGRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRGL 757
N + DIH+H P GA PKDGPSAG+T+ TAL+SL + K VR D AMTGE+TLRG
Sbjct: 659 --SPNFFEKADIHLHVPEGATPKDGPSAGITMATALLSLATGKPVRPDVAMTGEITLRGK 716
Query: 758 VLPVGGVKDKILAAHRYGIKRVILPERNLKDLVEVPAAVLASLEIILAKRMEDVLEQAF 816
VLP+GG+K+K +AA R GIK +ILPE+N +DL E+P V LEI K ++VL++AF
Sbjct: 717 VLPIGGLKEKTIAAKRAGIKTIILPEKNRRDLEELPENVKEGLEIHFVKHYDEVLKKAF 775
|
This protein is induced by heat shock and other stresses in E. coli, B. subtilis, and other species. The yeast member, designated PIM1, is located in the mitochondrial matrix, required for mitochondrial function, and also induced by heat shock [Protein fate, Degradation of proteins, peptides, and glycopeptides]. Length = 775 |
| >gnl|CDD|223542 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|182730 PRK10787, PRK10787, DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|191262 pfam05362, Lon_C, Lon protease (S16) C-terminal proteolytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|233120 TIGR00764, lon_rel, lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >gnl|CDD|131948 TIGR02902, spore_lonB, ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >gnl|CDD|223994 COG1067, LonB, Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|237495 PRK13765, PRK13765, ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234053 TIGR02903, spore_lon_C, ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >gnl|CDD|216923 pfam02190, LON, ATP-dependent protease La (LON) domain | Back alignment and domain information |
|---|
| >gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) | Back alignment and domain information |
|---|
| >gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236994 PRK11823, PRK11823, DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224664 COG1750, COG1750, Archaeal serine proteases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >gnl|CDD|222866 PHA02544, 44, clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232966 TIGR00416, sms, DNA repair protein RadA | Back alignment and domain information |
|---|
| >gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) | Back alignment and domain information |
|---|
| >gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234172 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >gnl|CDD|131701 TIGR02653, Lon_rel_chp, conserved hypothetical protein | Back alignment and domain information |
|---|
| >gnl|CDD|116340 pfam07726, AAA_3, ATPase family associated with various cellular activities (AAA) | Back alignment and domain information |
|---|
| >gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223993 COG1066, Sms, Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|205719 pfam13541, ChlI, Subunit ChlI of Mg-chelatase | Back alignment and domain information |
|---|
| >gnl|CDD|227267 COG4930, COG4930, Predicted ATP-dependent Lon-type protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|236828 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA | Back alignment and domain information |
|---|
| >gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|216186 pfam00910, RNA_helicase, RNA helicase | Back alignment and domain information |
|---|
| >gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|226573 COG4088, COG4088, Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 828 | |||
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 100.0 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 100.0 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 100.0 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 100.0 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 100.0 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 100.0 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 100.0 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 100.0 | |
| TIGR02653 | 675 | Lon_rel_chp conserved hypothetical protein. This m | 100.0 | |
| PF05362 | 204 | Lon_C: Lon protease (S16) C-terminal proteolytic d | 100.0 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 100.0 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 100.0 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 100.0 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 100.0 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 99.97 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.97 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.97 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.96 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 99.96 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 99.95 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 99.95 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 99.95 | |
| PF13541 | 121 | ChlI: Subunit ChlI of Mg-chelatase | 99.94 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 99.93 | |
| COG1067 | 647 | LonB Predicted ATP-dependent protease [Posttransla | 99.93 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 99.92 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 99.92 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 99.91 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 99.9 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 99.9 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 99.89 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 99.89 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 99.89 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 99.88 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 99.88 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 99.88 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 99.88 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 99.87 | |
| KOG0728 | 404 | consensus 26S proteasome regulatory complex, ATPas | 99.86 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 99.86 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 99.85 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 99.85 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 99.84 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 99.84 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 99.84 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 99.84 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 99.84 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.83 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 99.83 | |
| KOG0726 | 440 | consensus 26S proteasome regulatory complex, ATPas | 99.82 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 99.81 | |
| KOG0729 | 435 | consensus 26S proteasome regulatory complex, ATPas | 99.81 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 99.81 | |
| KOG0652 | 424 | consensus 26S proteasome regulatory complex, ATPas | 99.81 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 99.8 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 99.8 | |
| COG4930 | 683 | Predicted ATP-dependent Lon-type protease [Posttra | 99.8 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 99.79 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 99.79 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 99.78 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 99.78 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 99.78 | |
| KOG0732 | 1080 | consensus AAA+-type ATPase containing the bromodom | 99.78 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 99.77 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 99.77 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 99.75 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 99.75 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 99.74 | |
| KOG0740 | 428 | consensus AAA+-type ATPase [Posttranslational modi | 99.74 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 99.74 | |
| COG2802 | 221 | Uncharacterized protein, similar to the N-terminal | 99.74 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 99.73 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.71 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 99.71 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 99.71 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 99.7 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 99.7 | |
| KOG0745 | 564 | consensus Putative ATP-dependent Clp-type protease | 99.69 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 99.68 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 99.67 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 99.67 | |
| KOG0989 | 346 | consensus Replication factor C, subunit RFC4 [Repl | 99.66 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 99.66 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 99.64 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 99.63 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 99.63 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 99.63 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 99.61 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 99.6 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 99.6 | |
| PF02190 | 205 | LON: ATP-dependent protease La (LON) domain; Inter | 99.59 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 99.59 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 99.58 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 99.57 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 99.57 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 99.57 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.57 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 99.56 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 99.56 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 99.56 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.56 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 99.56 | |
| COG1220 | 444 | HslU ATP-dependent protease HslVU (ClpYQ), ATPase | 99.56 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 99.55 | |
| KOG2028 | 554 | consensus ATPase related to the helicase subunit o | 99.55 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 99.55 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 99.55 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 99.54 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 99.54 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 99.54 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 99.53 | |
| COG1750 | 579 | Archaeal serine proteases [General function predic | 99.53 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 99.53 | |
| PHA02244 | 383 | ATPase-like protein | 99.53 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 99.53 | |
| KOG0743 | 457 | consensus AAA+-type ATPase [Posttranslational modi | 99.52 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 99.52 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 99.52 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 99.51 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 99.51 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 99.51 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 99.51 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 99.5 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 99.5 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 99.5 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 99.5 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 99.5 | |
| COG3604 | 550 | FhlA Transcriptional regulator containing GAF, AAA | 99.49 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 99.49 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 99.49 | |
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 99.48 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 99.48 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 99.47 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 99.47 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 99.46 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 99.46 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 99.46 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 99.46 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 99.45 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 99.45 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 99.44 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 99.44 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 99.44 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 99.43 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.43 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 99.43 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 99.42 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 99.42 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 99.42 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 99.41 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 99.4 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 99.39 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 99.39 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 99.38 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 99.37 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 99.37 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 99.37 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 99.36 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 99.36 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 99.36 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 99.35 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 99.35 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 99.34 | |
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 99.34 | |
| KOG0991 | 333 | consensus Replication factor C, subunit RFC2 [Repl | 99.34 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 99.34 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 99.33 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 99.32 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 99.32 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 99.31 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 99.31 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 99.3 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 99.29 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 99.29 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 99.28 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 99.27 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 99.27 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 99.27 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 99.26 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 99.25 | |
| PRK08727 | 233 | hypothetical protein; Validated | 99.25 | |
| COG3480 | 342 | SdrC Predicted secreted protein containing a PDZ d | 99.25 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 99.24 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 99.23 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 99.23 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 99.23 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 99.22 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 99.22 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 99.21 | |
| PRK06620 | 214 | hypothetical protein; Validated | 99.21 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 99.21 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 99.2 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 99.19 | |
| PRK09087 | 226 | hypothetical protein; Validated | 99.19 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 99.17 | |
| PTZ00111 | 915 | DNA replication licensing factor MCM4; Provisional | 99.16 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 99.16 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 99.16 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 99.15 | |
| KOG0736 | 953 | consensus Peroxisome assembly factor 2 containing | 99.15 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 99.14 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 99.14 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 99.14 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 99.12 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 99.12 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 99.11 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 99.11 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 99.1 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 99.1 | |
| KOG2035 | 351 | consensus Replication factor C, subunit RFC3 [Cell | 99.09 | |
| KOG0478 | 804 | consensus DNA replication licensing factor, MCM4 c | 99.09 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 99.08 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 99.08 | |
| COG1241 | 682 | MCM2 Predicted ATPase involved in replication cont | 99.07 | |
| COG1239 | 423 | ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis | 99.06 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 99.05 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 99.01 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 99.01 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 98.99 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 98.98 | |
| KOG0480 | 764 | consensus DNA replication licensing factor, MCM6 c | 98.97 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 98.96 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 98.96 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 98.96 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 98.96 | |
| KOG1942 | 456 | consensus DNA helicase, TBP-interacting protein [R | 98.96 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 98.95 | |
| KOG2170 | 344 | consensus ATPase of the AAA+ superfamily [General | 98.95 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 98.95 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 98.93 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 98.92 | |
| KOG0990 | 360 | consensus Replication factor C, subunit RFC5 [Repl | 98.92 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 98.9 | |
| COG3283 | 511 | TyrR Transcriptional regulator of aromatic amino a | 98.9 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 98.9 | |
| PRK08181 | 269 | transposase; Validated | 98.84 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 98.83 | |
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 98.83 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 98.78 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 98.77 | |
| COG3284 | 606 | AcoR Transcriptional activator of acetoin/glycerol | 98.75 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 98.74 | |
| KOG0482 | 721 | consensus DNA replication licensing factor, MCM7 c | 98.73 | |
| PF00493 | 331 | MCM: MCM2/3/5 family This family extends the MCM d | 98.73 | |
| PRK08116 | 268 | hypothetical protein; Validated | 98.71 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 98.7 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 98.68 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 98.67 | |
| PRK06526 | 254 | transposase; Provisional | 98.65 | |
| COG2607 | 287 | Predicted ATPase (AAA+ superfamily) [General funct | 98.63 | |
| KOG2680 | 454 | consensus DNA helicase TIP49, TBP-interacting prot | 98.62 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 98.6 | |
| PRK12377 | 248 | putative replication protein; Provisional | 98.59 | |
| PRK07276 | 290 | DNA polymerase III subunit delta'; Validated | 98.59 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 98.54 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 98.53 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 98.49 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 98.47 | |
| KOG0481 | 729 | consensus DNA replication licensing factor, MCM5 c | 98.47 | |
| KOG0477 | 854 | consensus DNA replication licensing factor, MCM2 c | 98.47 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 98.46 | |
| PF13173 | 128 | AAA_14: AAA domain | 98.46 | |
| KOG2227 | 529 | consensus Pre-initiation complex, subunit CDC6, AA | 98.44 | |
| PRK05818 | 261 | DNA polymerase III subunit delta'; Validated | 98.4 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 98.4 | |
| COG4650 | 531 | RtcR Sigma54-dependent transcription regulator con | 98.4 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 98.39 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 98.38 | |
| KOG1514 | 767 | consensus Origin recognition complex, subunit 1, a | 98.37 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 98.35 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 98.33 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 98.27 | |
| KOG0479 | 818 | consensus DNA replication licensing factor, MCM3 c | 98.25 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 98.24 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 98.23 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 98.11 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 98.11 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 98.1 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 98.08 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 98.06 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 98.04 | |
| KOG1970 | 634 | consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 | 98.01 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 97.94 | |
| KOG1051 | 898 | consensus Chaperone HSP104 and related ATP-depende | 97.92 | |
| KOG1808 | 1856 | consensus AAA ATPase containing von Willebrand fac | 97.88 | |
| PF05729 | 166 | NACHT: NACHT domain | 97.86 | |
| PHA02774 | 613 | E1; Provisional | 97.81 | |
| PRK06581 | 263 | DNA polymerase III subunit delta'; Validated | 97.74 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 97.7 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 97.69 | |
| PF05272 | 198 | VirE: Virulence-associated protein E; InterPro: IP | 97.6 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 97.59 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 97.58 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 97.56 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 97.5 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 97.48 | |
| COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 97.47 | |
| KOG2228 | 408 | consensus Origin recognition complex, subunit 4 [R | 97.44 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 97.39 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 97.39 | |
| PF08298 | 358 | AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 Thi | 97.36 | |
| KOG1968 | 871 | consensus Replication factor C, subunit RFC1 (larg | 97.34 | |
| COG3267 | 269 | ExeA Type II secretory pathway, component ExeA (pr | 97.33 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 97.32 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.29 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 97.29 | |
| TIGR01613 | 304 | primase_Cterm phage/plasmid primase, P4 family, C- | 97.25 | |
| PHA02624 | 647 | large T antigen; Provisional | 97.2 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 97.17 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 97.14 | |
| PF10431 | 81 | ClpB_D2-small: C-terminal, D2-small domain, of Clp | 97.12 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 97.1 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.1 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 97.08 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 97.07 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 97.07 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 97.05 | |
| COG5245 | 3164 | DYN1 Dynein, heavy chain [Cytoskeleton] | 97.05 | |
| PF07693 | 325 | KAP_NTPase: KAP family P-loop domain; InterPro: IP | 97.04 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 97.03 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 97.0 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 96.99 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 96.98 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 96.95 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 96.94 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 96.94 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 96.93 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 96.9 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 96.9 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.87 | |
| PF00519 | 432 | PPV_E1_C: Papillomavirus helicase; InterPro: IPR00 | 96.87 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 96.86 | |
| PF12780 | 268 | AAA_8: P-loop containing dynein motor region D4; I | 96.86 | |
| PRK03839 | 180 | putative kinase; Provisional | 96.85 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 96.84 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 96.84 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.82 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 96.8 | |
| COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 96.8 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 96.78 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 96.78 | |
| PRK13695 | 174 | putative NTPase; Provisional | 96.77 | |
| cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 96.75 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 96.74 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 96.74 | |
| COG4178 | 604 | ABC-type uncharacterized transport system, permeas | 96.74 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 96.73 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 96.73 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 96.7 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 96.69 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 96.68 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 96.67 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 96.65 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 96.64 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 96.62 | |
| KOG2543 | 438 | consensus Origin recognition complex, subunit 5 [R | 96.6 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 96.6 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 96.59 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 96.59 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 96.59 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 96.59 | |
| PRK06696 | 223 | uridine kinase; Validated | 96.59 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 96.58 | |
| PHA01747 | 425 | putative ATP-dependent protease | 96.58 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 96.55 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 96.55 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 96.53 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 96.52 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 96.51 | |
| PRK06217 | 183 | hypothetical protein; Validated | 96.51 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 96.51 | |
| COG1485 | 367 | Predicted ATPase [General function prediction only | 96.5 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 96.5 | |
| cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 96.48 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 96.48 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 96.46 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 96.46 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.45 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 96.44 | |
| PTZ00202 | 550 | tuzin; Provisional | 96.43 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 96.41 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 96.41 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 96.38 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 96.36 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 96.36 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 96.34 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 96.34 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 96.33 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 96.32 | |
| COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 96.31 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 96.28 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 96.27 | |
| PF13479 | 213 | AAA_24: AAA domain | 96.27 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 96.26 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 96.24 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 96.23 | |
| COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 96.23 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.22 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.21 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 96.2 | |
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 96.2 | |
| COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 96.2 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 96.18 | |
| KOG0058 | 716 | consensus Peptide exporter, ABC superfamily [Intra | 96.18 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 96.18 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 96.17 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 96.16 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 96.16 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 96.16 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 96.14 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 96.14 | |
| PF10923 | 416 | DUF2791: P-loop Domain of unknown function (DUF279 | 96.13 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 96.13 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.12 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 96.1 | |
| PLN02200 | 234 | adenylate kinase family protein | 96.1 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 96.09 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 96.09 | |
| PRK14700 | 300 | recombination factor protein RarA; Provisional | 96.08 | |
| COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 96.08 | |
| smart00464 | 92 | LON Found in ATP-dependent protease La (LON). N-te | 96.08 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 96.07 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 96.06 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.05 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 96.04 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 96.01 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 96.0 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 95.99 | |
| PRK13764 | 602 | ATPase; Provisional | 95.98 | |
| cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 95.98 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 95.94 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 95.93 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 95.93 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 95.93 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 95.91 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 95.9 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 95.9 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 95.89 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 95.89 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 95.88 | |
| PLN02674 | 244 | adenylate kinase | 95.85 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 95.85 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 95.84 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 95.84 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 95.81 | |
| TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 95.81 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 95.81 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 95.79 | |
| PRK08485 | 206 | DNA polymerase III subunit delta'; Validated | 95.79 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 95.78 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 95.77 | |
| PRK14709 | 469 | hypothetical protein; Provisional | 95.77 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.76 | |
| KOG3595 | 1395 | consensus Dyneins, heavy chain [Cytoskeleton] | 95.76 | |
| cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 95.74 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 95.74 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 95.72 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 95.71 | |
| cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 95.71 | |
| TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 95.71 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 95.7 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 95.7 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 95.7 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 95.68 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 95.67 | |
| TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 95.67 | |
| cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 95.67 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 95.67 | |
| cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 95.67 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 95.67 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 95.66 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 95.66 | |
| PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 95.66 | |
| cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 95.66 | |
| cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 95.65 | |
| cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 95.64 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 95.64 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 95.64 | |
| cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 95.63 | |
| cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 95.63 | |
| TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 95.62 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 95.62 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 95.62 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 95.61 | |
| TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 95.6 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 95.59 | |
| PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 95.58 | |
| cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 95.58 | |
| cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 95.58 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 95.58 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 95.58 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 95.56 | |
| TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 95.55 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 95.55 | |
| cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 95.55 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 95.54 | |
| cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 95.54 | |
| PF10443 | 431 | RNA12: RNA12 protein; InterPro: IPR018850 Mitochon | 95.54 | |
| TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 95.54 | |
| cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 95.54 |
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.3e-132 Score=1097.71 Aligned_cols=723 Identities=50% Similarity=0.806 Sum_probs=683.4
Q ss_pred cCCCCCCCCCCccccccceeEEEEEEeccCccCCCCceEEEEEEEEeeEEEEeeecccCCeEEEEEEEeccchhhhhccC
Q 003349 31 VGASDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISSLEMTKIEMEQVE 110 (828)
Q Consensus 31 ~~~~~~~~~~~~~~l~~vGt~a~I~~~~~~~~~~dG~~~~~I~~~G~~RfrI~~~~~~~~y~~a~Ve~l~~~~~~~~~~~ 110 (828)
.|+....++|.++++|+|||+|+|.++.++ ||| ++.|.++|.+|++|.++...+.|..|+++.+++ ++.+
T Consensus 54 ~qk~~~~d~p~~~dly~vGt~a~I~q~~~l---pdg--~~kvlveg~~R~~I~~~~~~~~~~~a~~~~i~~-----~~~~ 123 (782)
T COG0466 54 TQKDASTDEPTEDDLYEVGTLAKILQILKL---PDG--TVKVLVEGLQRVRISKLSDEEEFFEAEIELLPD-----EPID 123 (782)
T ss_pred EecccccCCCChhhhhhcchheeeeeeeeC---CCC--cEEEEEEeeeeEEEEeeccCCCceEEEEEecCC-----Cccc
Confidence 445455666788899999999999999999 999 889999999999999999888899999999985 2222
Q ss_pred CChHHHHHHHHHHHHHHHHHHHhhhccCchhhHHHhhccCChHHHHHHHHHcCCCCHHHHHHHhhccCHHHHHHHHHHHH
Q 003349 111 QDPDFIALSRQFKATAMELISVLEQKQKTGGRTKVLLETVPIHKLADIFVASFEISFEEQLVMLDSVDLKVRLSKATELV 190 (828)
Q Consensus 111 ~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~la~~la~~lpl~~~~kq~LLe~~d~~~Rl~~l~~~l 190 (828)
...+..++.+.+...|.+|...... ..+.....+..+++++.+||.+|++++++.++||++|++.+...||+.++.+|
T Consensus 124 ~~~~~~al~~~i~~~~~~~~~l~~~--~~~e~l~~~~~i~~~~klad~iaa~l~~~~~~kQ~iLe~~~v~~Rlek~l~~l 201 (782)
T COG0466 124 EEREIEALVRSILSEFEEYAKLNKK--IPPEELQSLNSIDDPGKLADTIAAHLPLKLEEKQEILETLDVKERLEKLLDLL 201 (782)
T ss_pred chhHHHHHHHHHHHHHHHHHHhccC--CCHHHHHHHhcccchHHHHHHHHHhCCCCHHHHHHHHHhCCHHHHHHHHHHHH
Confidence 2456788999999999999887742 34445555668899999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHhhhhcchhHHHHHHHHHHHHHHHHhCCCCCChhHHHHHHHHHHHcCCChhhHHHHHHHHHHHHh
Q 003349 191 DRHLQSIRVAEKITQKVEGQLSKSQKEFLLRQQMRAIKEELGDNDDDEDDLVALERKMQSAGMPSNIWKHVQKELRRLKK 270 (828)
Q Consensus 191 ~~~~~~l~~~~~i~~~i~~~~~~~~r~~~l~~ql~~l~~~~~~~~~~~~~~~~~~~~l~~~~lp~~a~~~~~~e~~~l~~ 270 (828)
..++..++++++|+++++.+++++||+|||+||++.||+|+|..++..++++++++++++..||+++.+.+..|++++++
T Consensus 202 ~~ei~~~~~ek~I~~kVk~~meK~QREyyL~EQlKaIqkELG~~~d~~~e~~~~~~kie~~~~p~evk~k~~~El~kL~~ 281 (782)
T COG0466 202 EKEIDLLQLEKRIRKKVKEQMEKSQREYYLREQLKAIQKELGEDDDDKDEVEELREKIEKLKLPKEAKEKAEKELKKLET 281 (782)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCccchhHHHHHHHHHhhcCCCHHHHHHHHHHHHHHhc
Confidence 99999999999999999999999999999999999999999988766789999999999999999999999999999999
Q ss_pred cCCCCCCcchHHHHHHHHhcCCCCccchhHHhcHHHHHHhhcccccchHHHHHHHHHHHHHhhhCCCCCCCeEEEEcCCC
Q 003349 271 MQPQQPGYTSSRVYLELIADLPWEKASEEIDLDLKAAKERLDSDHYGLVRVKQRIIEYLAVRKLKPDARGPVLCFVGPPG 350 (828)
Q Consensus 271 ~~~~~~~~~~~~~~l~~~~~iP~~~~~~~~~~~l~~~~~~l~~~i~G~~~~~~~l~~~l~~~~~~~~~~~~~lLL~GppG 350 (828)
+.+.+++++.+|+|++|++.+||...+.. ..|+..++++|+.+|||++++|++|+++++...+.+..+|+++||+||||
T Consensus 282 m~~~SaE~~ViRnYlDwll~lPW~~~sk~-~~Dl~~a~~iLd~dHYGLekVKeRIlEyLAV~~l~~~~kGpILcLVGPPG 360 (782)
T COG0466 282 MSPMSAEATVIRNYLDWLLDLPWGKRSKD-KLDLKKAEKILDKDHYGLEKVKERILEYLAVQKLTKKLKGPILCLVGPPG 360 (782)
T ss_pred CCCCCchHHHHHHHHHHHHhCCCccccch-hhhHHHHHHHhcccccCchhHHHHHHHHHHHHHHhccCCCcEEEEECCCC
Confidence 99999999999999999999999999988 99999999999999999999999999999999998889999999999999
Q ss_pred CchhHHHHHHHHHhCCCeEEEecCCcCchhhhccCcccccccCcchHHHHHHhcCCCCcEEEEecccccCCCCCCChHHH
Q 003349 351 VGKTSLASSIASALGRKFIRISLGGVKDEADIRGHRRTYIGSMPGRLIDGLKRVGVCNPVMLLDEIDKTGSDVRGDPASA 430 (828)
Q Consensus 351 tGKT~la~~la~~l~~~~~~i~~~~~~~~~~l~g~~~~~vg~~~g~l~~~~~~~~~~~~vl~iDEid~l~~~~~~~~~~~ 430 (828)
+|||+|+++||+.+++.|++++++|.+|+++++||+++|+|++||++.+.++++...|||++|||||+++.+.+|||.++
T Consensus 361 VGKTSLgkSIA~al~RkfvR~sLGGvrDEAEIRGHRRTYIGamPGrIiQ~mkka~~~NPv~LLDEIDKm~ss~rGDPaSA 440 (782)
T COG0466 361 VGKTSLGKSIAKALGRKFVRISLGGVRDEAEIRGHRRTYIGAMPGKIIQGMKKAGVKNPVFLLDEIDKMGSSFRGDPASA 440 (782)
T ss_pred CCchhHHHHHHHHhCCCEEEEecCccccHHHhccccccccccCChHHHHHHHHhCCcCCeEEeechhhccCCCCCChHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHhcCcccccccccccCCeeecCCCcEEEEecCCCCCCCccccCceEEEEcCCCCHHHHHHHHHHhhcHHHHHhcCCCC
Q 003349 431 LLEVLDPEQNKTFNDHYLNVPFDLSKVIFVATANRAQPIPPPLLDRMEVIELPGYTPEEKLRIAMRHLIPRVLDQHGLGS 510 (828)
Q Consensus 431 Ll~~ld~~~~~~~~~~~~~~~~~~~~viiI~TtN~~~~l~~aLl~R~~~i~~~~~~~ee~~~Il~~~l~~~~~~~~~~~~ 510 (828)
||++||++||..|.|||+..++|+++|+||+|+|..+.+|.+|+||+++|.++.|+.+|+.+|+++||.|++++.+|+.+
T Consensus 441 LLEVLDPEQN~~F~DhYLev~yDLS~VmFiaTANsl~tIP~PLlDRMEiI~lsgYt~~EKl~IAk~~LiPk~~~~~gL~~ 520 (782)
T COG0466 441 LLEVLDPEQNNTFSDHYLEVPYDLSKVMFIATANSLDTIPAPLLDRMEVIRLSGYTEDEKLEIAKRHLIPKQLKEHGLKK 520 (782)
T ss_pred HHhhcCHhhcCchhhccccCccchhheEEEeecCccccCChHHhcceeeeeecCCChHHHHHHHHHhcchHHHHHcCCCc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccccCHHHHHHHHHHhhhhhchHHHHHHHHHHHHHHHHHHHHHhhhhcCCCCccccccCCccccccccCCCeeEEeecc
Q 003349 511 EFLQIPEAMVKLVIQRYTREAGVRNLERNLAALARAAAVKVAEQEQEQALPSSKDVHRLGSPLLDNRLADGAEVEMEVIP 590 (828)
Q Consensus 511 ~~~~i~~~~l~~l~~~~~~~~g~R~l~~~i~~l~~~a~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~ 590 (828)
..+.++++++..|++.|++++|+|+|+|.|..+||+++..++.+..
T Consensus 521 ~el~i~d~ai~~iI~~YTREAGVR~LeR~i~ki~RK~~~~i~~~~~---------------------------------- 566 (782)
T COG0466 521 GELTITDEAIKDIIRYYTREAGVRNLEREIAKICRKAAKKILLKKE---------------------------------- 566 (782)
T ss_pred cceeecHHHHHHHHHHHhHhhhhhHHHHHHHHHHHHHHHHHHhcCc----------------------------------
Confidence 9999999999999999999999999999999999999999887610
Q ss_pred CCCcccccccccccCcceeecccchhhccCCCccCchhhhhhcCCCceeEEEEEeecCceEEEEEEEEEcCcceEEEeeC
Q 003349 591 MGESTHEVSNTFRITSPLVVDEAMLEKVLGPPRFDDREAAERVAAPGISVGLVWTNFGGEVQFVEATAMRGKGELHLTGQ 670 (828)
Q Consensus 591 ~~~~~~~~~~~~~~~~~~~i~~~~L~~~l~~~~~~~~~~~~~~~~~G~v~g~~~~~~~g~~~~ie~~~~~g~~~~~~~G~ 670 (828)
...+.++.++|++|||++.|.. +...+...+|.++|+|||.+||.++.||+..+||.|.+++||+
T Consensus 567 --------------k~~~~i~~~~l~~yLG~~~f~~-~~~~~~~~vGvVtGLAWT~vGGd~L~IE~~~~~Gkg~l~lTG~ 631 (782)
T COG0466 567 --------------KSIVKIDEKNLKKYLGVPVFRY-GKAEEEDQVGVVTGLAWTEVGGDLLTIEAVKMPGKGKLTLTGS 631 (782)
T ss_pred --------------ccceeeCHHHHHHHhCCcccCc-cccccCCCCeeEeeeeeecCCceEEEEEEEEecCCccEEEecc
Confidence 1125899999999999999988 5566778899999999999999999999999999999999999
Q ss_pred CChHHHHHHHHHHHHHHHhhhhhhhhhhccCCCCCcccEEEEccCCCCCCCCchhHHHHHHHHHHhccCCCCCCCEEEEe
Q 003349 671 LGDVIKESAQIALTWVRARATDLQLVAEDGMNLLQGRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTG 750 (828)
Q Consensus 671 ~~~~~~es~~~a~~~~~~~~~~l~~~~~~~~~~~~~~dv~i~~~~~~~~~~g~sa~laia~ai~sa~~~~~~~~~~~~~G 750 (828)
+|++||||++.|++|+++|+..++. +..+|...|||||+|.|++||||||||+|||+|++|+++++|+++++||||
T Consensus 632 LGdVMKESa~~A~s~vrs~a~~~~i----~~~~fek~dIHiHVPeGAtPKDGPSAGitm~TAlvS~lt~~~V~~~vAMTG 707 (782)
T COG0466 632 LGDVMKESAQAALSYVRSRAEKLGI----DPDFFEKRDIHIHVPEGATPKDGPSAGITMATALVSLLTGKPVRADVAMTG 707 (782)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHcCC----CcccccccceEEECCCCCCCCCCcchHHHHHHHHHHHHhCCCCCCCcccee
Confidence 9999999999999999999988875 345689999999999999999999999999999999999999999999999
Q ss_pred ecCCCceeeecCCHHHHHHHHHHcCCCEEeecccChhhhccChhhhhCCcEEEEcCCHHHHHHHHHcCC
Q 003349 751 EMTLRGLVLPVGGVKDKILAAHRYGIKRVILPERNLKDLVEVPAAVLASLEIILAKRMEDVLEQAFEGG 819 (828)
Q Consensus 751 ei~L~G~v~~v~gi~~ki~~A~~~G~k~viiP~~n~~~~~~~~~~~~~~i~i~~v~~l~e~~~~~~~~~ 819 (828)
||+|+|.|.||||+++|+.+|.++|+|+||+|.+|.+|+.++|++++++++|++|++++|+++++|...
T Consensus 708 EITLrG~VLpIGGLKEKllAA~R~GIk~viiP~~N~~DleeiP~~vk~~l~i~~V~~~~eVl~~al~~~ 776 (782)
T COG0466 708 EITLRGRVLPIGGLKEKLLAAHRGGIKTVIIPKDNERDLEEIPDNVKEGLEIHPVKTIDEVLKLALVGN 776 (782)
T ss_pred eEEeeeceeecccHHHHHHHHHhcCCcEEeccccccccHHhCCHHHHcCCeEEEeccHHHHHHHHhcCC
Confidence 999999999999999999999999999999999999999999999999999999999999999999764
|
|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >TIGR02653 Lon_rel_chp conserved hypothetical protein | Back alignment and domain information |
|---|
| >PF05362 Lon_C: Lon protease (S16) C-terminal proteolytic domain; InterPro: IPR008269 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PF13541 ChlI: Subunit ChlI of Mg-chelatase | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1067 LonB Predicted ATP-dependent protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >COG4930 Predicted ATP-dependent Lon-type protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2802 Uncharacterized protein, similar to the N-terminal domain of Lon protease [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF02190 LON: ATP-dependent protease La (LON) domain; InterPro: IPR003111 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1750 Archaeal serine proteases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >PTZ00111 DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0482 consensus DNA replication licensing factor, MCM7 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK07276 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >KOG0481 consensus DNA replication licensing factor, MCM5 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0477 consensus DNA replication licensing factor, MCM2 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK05818 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >KOG0479 consensus DNA replication licensing factor, MCM3 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1808 consensus AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PRK06581 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF05272 VirE: Virulence-associated protein E; InterPro: IPR007936 This family contains several bacterial virulence-associated protein E like proteins | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PF08298 AAA_PrkA: PrkA AAA domain; InterPro: IPR013153 This is entry is found at the N terminus of PrkA proteins - bacterial and archaeal serine kinases approximately 630 residues in length | Back alignment and domain information |
|---|
| >KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >TIGR01613 primase_Cterm phage/plasmid primase, P4 family, C-terminal domain | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PF10431 ClpB_D2-small: C-terminal, D2-small domain, of ClpB protein ; InterPro: IPR019489 Most Clp ATPases form complexes with peptidase subunits and are involved in protein degradation, though some, such as ClpB, do not associate with peptidases and are involved in protein disaggregation [] | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF00519 PPV_E1_C: Papillomavirus helicase; InterPro: IPR001177 Papillomaviruses are a large family of DNA tumour viruses which give rise to warts in their host species | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA01747 putative ATP-dependent protease | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >COG1485 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF10923 DUF2791: P-loop Domain of unknown function (DUF2791); InterPro: IPR021228 This is a family of proteins found in archaea and bacteria | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK14700 recombination factor protein RarA; Provisional | Back alignment and domain information |
|---|
| >COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
|---|
| >smart00464 LON Found in ATP-dependent protease La (LON) | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >PRK08485 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PRK14709 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >KOG3595 consensus Dyneins, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
|---|
| >cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
|---|
| >cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
|---|
| >cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
|---|
| >cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
|---|
| >TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
|---|
| >cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
|---|
| >PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] | Back alignment and domain information |
|---|
| >TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
|---|
| >cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 828 | ||||
| 3m6a_A | 543 | Crystal Structure Of Bacillus Subtilis Lon C-Termin | 3e-91 | ||
| 3m6a_A | 543 | Crystal Structure Of Bacillus Subtilis Lon C-Termin | 9e-43 | ||
| 1rr9_A | 200 | Catalytic Domain Of E.Coli Lon Protease Length = 20 | 6e-46 | ||
| 1rre_A | 200 | Crystal Structure Of E.Coli Lon Proteolytic Domain | 2e-44 | ||
| 2x36_A | 207 | Structure Of The Proteolytic Domain Of The Human Mi | 9e-37 | ||
| 1xhk_A | 187 | Crystal Structure Of M. Jannaschii Lon Proteolytic | 4e-15 | ||
| 3k1j_A | 604 | Crystal Structure Of Lon Protease From Thermococcus | 3e-14 | ||
| 1z0c_A | 207 | Crystal Structure Of A. Fulgidus Lon Proteolytic Do | 4e-14 | ||
| 1z0w_A | 207 | Crystal Structure Of A. Fulgidus Lon Proteolytic Do | 5e-14 | ||
| 1z0e_A | 205 | Crystal Structure Of A. Fulgidus Lon Proteolytic Do | 5e-14 | ||
| 1z0b_A | 207 | Crystal Structure Of A. Fulgidus Lon Proteolytic Do | 1e-13 | ||
| 1x37_A | 124 | Structure Of Bacillus Subtilis Lon Protease Ssd Dom | 3e-05 | ||
| 1ixr_C | 312 | Ruva-Ruvb Complex Length = 312 | 5e-05 | ||
| 1ixs_B | 318 | Structure Of Ruvb Complexed With Ruva Domain Iii Le | 8e-05 | ||
| 1qzm_A | 94 | Alpha-Domain Of Atpase Length = 94 | 1e-04 | ||
| 1hqc_A | 324 | Structure Of Ruvb From Thermus Thermophilus Hb8 Len | 1e-04 | ||
| 1ksf_X | 758 | Crystal Structure Of Clpa, An Hsp100 Chaperone And | 2e-04 | ||
| 1qvr_A | 854 | Crystal Structure Analysis Of Clpb Length = 854 | 4e-04 |
| >pdb|3M6A|A Chain A, Crystal Structure Of Bacillus Subtilis Lon C-Terminal Domain Length = 543 | Back alignment and structure |
|
| >pdb|3M6A|A Chain A, Crystal Structure Of Bacillus Subtilis Lon C-Terminal Domain Length = 543 | Back alignment and structure |
| >pdb|1RR9|A Chain A, Catalytic Domain Of E.Coli Lon Protease Length = 200 | Back alignment and structure |
| >pdb|1RRE|A Chain A, Crystal Structure Of E.Coli Lon Proteolytic Domain Length = 200 | Back alignment and structure |
| >pdb|2X36|A Chain A, Structure Of The Proteolytic Domain Of The Human Mitochondrial Lon Protease Length = 207 | Back alignment and structure |
| >pdb|1XHK|A Chain A, Crystal Structure Of M. Jannaschii Lon Proteolytic Domain Length = 187 | Back alignment and structure |
| >pdb|3K1J|A Chain A, Crystal Structure Of Lon Protease From Thermococcus Onnurineus Na1 Length = 604 | Back alignment and structure |
| >pdb|1Z0C|A Chain A, Crystal Structure Of A. Fulgidus Lon Proteolytic Domain D508a Mutant Length = 207 | Back alignment and structure |
| >pdb|1Z0W|A Chain A, Crystal Structure Of A. Fulgidus Lon Proteolytic Domain At 1.2a Resolution Length = 207 | Back alignment and structure |
| >pdb|1Z0E|A Chain A, Crystal Structure Of A. Fulgidus Lon Proteolytic Domain Length = 205 | Back alignment and structure |
| >pdb|1Z0B|A Chain A, Crystal Structure Of A. Fulgidus Lon Proteolytic Domain E506a Mutant Length = 207 | Back alignment and structure |
| >pdb|1X37|A Chain A, Structure Of Bacillus Subtilis Lon Protease Ssd Domain Length = 124 | Back alignment and structure |
| >pdb|1IXR|C Chain C, Ruva-Ruvb Complex Length = 312 | Back alignment and structure |
| >pdb|1IXS|B Chain B, Structure Of Ruvb Complexed With Ruva Domain Iii Length = 318 | Back alignment and structure |
| >pdb|1QZM|A Chain A, Alpha-Domain Of Atpase Length = 94 | Back alignment and structure |
| >pdb|1HQC|A Chain A, Structure Of Ruvb From Thermus Thermophilus Hb8 Length = 324 | Back alignment and structure |
| >pdb|1KSF|X Chain X, Crystal Structure Of Clpa, An Hsp100 Chaperone And Regulator Of Clpap Protease: Structural Basis Of Differences In Function Of The Two Aaa+ Atpase Domains Length = 758 | Back alignment and structure |
| >pdb|1QVR|A Chain A, Crystal Structure Analysis Of Clpb Length = 854 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Length = 543 | Back alignment and structure |
|---|
Score = 848 bits (2193), Expect = 0.0
Identities = 265/587 (45%), Positives = 364/587 (62%), Gaps = 55/587 (9%)
Query: 232 GDNDDDEDDLVALERKMQSAGMPSNIWKHVQKELRRLKKMQPQQPGYTSSRVYLELIADL 291
GD + ++ L K++ AGMP ++ + KEL R +K+ + R Y++ + L
Sbjct: 1 GDKEGKTGEVQTLTEKIEEAGMPDHVKETALKELNRYEKIPSSSAESSVIRNYIDWLVAL 60
Query: 292 PWEKASEEIDLDLKAAKERLDSDHYGLVRVKQRIIEYLAVRKLKPDARGPVLCFVGPPGV 351
PW +++ LDLK A LD +H+GL +VK+RI+EYLAV+KL +GP+LC GPPGV
Sbjct: 61 PWTDETDD-KLDLKEAGRLLDEEHHGLEKVKERILEYLAVQKLTKSLKGPILCLAGPPGV 119
Query: 352 GKTSLASSIASALGRKFIRISLGGVKDEADIRGHRRTYIGSMPGRLIDGLKRVGVCNPVM 411
GKTSLA SIA +LGRKF+RISLGGV+DE++IRGHRRTY+G+MPGR+I G+K+ G NPV
Sbjct: 120 GKTSLAKSIAKSLGRKFVRISLGGVRDESEIRGHRRTYVGAMPGRIIQGMKKAGKLNPVF 179
Query: 412 LLDEIDKTGSDVRGDPASALLEVLDPEQNKTFNDHYLNVPFDLSKVIFVATANRAQPIPP 471
LLDEIDK SD RGDP+SA+LEVLDPEQN +F+DHY+ FDLSKV+F+ATAN IP
Sbjct: 180 LLDEIDKMSSDFRGDPSSAMLEVLDPEQNSSFSDHYIEETFDLSKVLFIATANNLATIPG 239
Query: 472 PLLDRMEVIELPGYTPEEKLRIAMRHLIPRVLDQHGLGSEFLQIPEAMVKLVIQRYTREA 531
PL DRME+I + GYT EKL I HL+P+ + +HGL LQ+ + + +I+ YTREA
Sbjct: 240 PLRDRMEIINIAGYTEIEKLEIVKDHLLPKQIKEHGLKKSNLQLRDQAILDIIRYYTREA 299
Query: 532 GVRNLERNLAALARAAAVKVAEQEQEQALPSSKDVHRLGSPLLDNRLADGAEVEMEVIPM 591
GVR+LER LAA+ R AA + +E++
Sbjct: 300 GVRSLERQLAAICRKAAKAIVAEERK---------------------------------- 325
Query: 592 GESTHEVSNTFRITSPLVVDEAMLEKVLGPPRFDDREAAERVAAPGISVGLVWTNFGGEV 651
+ V E L+ +G F AE G+ GL +T GG+
Sbjct: 326 ---------------RITVTEKNLQDFIGKRIF-RYGQAETEDQVGVVTGLAYTTVGGDT 369
Query: 652 QFVEATAMRGKGELHLTGQLGDVIKESAQIALTWVRARATDLQLVAEDGMNLLQGRDIHI 711
+E + GKG+L LTG+LGDV++ESAQ A ++VR++ +L + + + DIHI
Sbjct: 370 LSIEVSLSPGKGKLILTGKLGDVMRESAQAAFSYVRSKTEELGIEPD----FHEKYDIHI 425
Query: 712 HFPAGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRGLVLPVGGVKDKILAA 771
H P GAVPKDGP+AG+T+ TALVS + + V + MTGE+TLRG VLP+GG+K+K L A
Sbjct: 426 HVPEGAVPKDGPAAGITMATALVSALTGRAVSREVGMTGEITLRGRVLPIGGLKEKALGA 485
Query: 772 HRYGIKRVILPERNLKDLVEVPAAVLASLEIILAKRMEDVLEQAFEG 818
HR G+ +I P+ N KD+ ++P +V L ILA +++VLE A G
Sbjct: 486 HRAGLTTIIAPKDNEKDIEDIPESVREGLTFILASHLDEVLEHALVG 532
|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Length = 604 | Back alignment and structure |
|---|
| >1rre_A ATP-dependent protease LA; catalytic Ser-Lys DYAD, hydrolase; HET: MSE; 1.75A {Escherichia coli} SCOP: d.14.1.10 PDB: 1rr9_A* Length = 200 | Back alignment and structure |
|---|
| >2x36_A LON protease homolog, mitochondrial; hydrolase, catalytic DYAD, transit peptide; 2.00A {Homo sapiens} Length = 207 | Back alignment and structure |
|---|
| >1xhk_A Putative protease LA homolog; LON protease, ATP dependent, catalytic DYAD, hydrolase; HET: MES; 1.90A {Methanocaldococcus jannaschii} SCOP: d.14.1.10 Length = 187 | Back alignment and structure |
|---|
| >1z0w_A Putative protease LA homolog type; ATP-dependent protease, catalytic Ser-Lys DYAD, B-type LON, hydrolase; 1.20A {Archaeoglobus fulgidus} PDB: 1z0b_A 1z0c_A 1z0e_A 1z0g_A 1z0t_A 1z0v_A Length = 207 | Back alignment and structure |
|---|
| >1qzm_A ATP-dependent protease LA; oligomerization domain, AAA+ protein, hydrolase; 1.90A {Escherichia coli} SCOP: c.37.1.20 Length = 94 | Back alignment and structure |
|---|
| >3ljc_A ATP-dependent protease LA; LON N-domain, allosteric enzyme, ATP-binding, DNA-binding, H nucleotide-binding, serine protease, stress respo; 2.60A {Escherichia coli} Length = 252 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Length = 758 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Length = 318 | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 | Back alignment and structure |
|---|
| >3m65_A ATP-dependent protease LA 1; coiled-coil, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; 2.60A {Bacillus subtilis} Length = 209 | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 828 | |||
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 100.0 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 100.0 | |
| 1rre_A | 200 | ATP-dependent protease LA; catalytic Ser-Lys DYAD, | 100.0 | |
| 2x36_A | 207 | LON protease homolog, mitochondrial; hydrolase, ca | 100.0 | |
| 1xhk_A | 187 | Putative protease LA homolog; LON protease, ATP de | 100.0 | |
| 1z0w_A | 207 | Putative protease LA homolog type; ATP-dependent p | 100.0 | |
| 3ljc_A | 252 | ATP-dependent protease LA; LON N-domain, allosteri | 99.96 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 99.94 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.94 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 99.94 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 99.93 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 99.93 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 99.92 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 99.92 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.91 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 99.91 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.91 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 99.89 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 99.88 | |
| 3m65_A | 209 | ATP-dependent protease LA 1; coiled-coil, ATP-bind | 99.88 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.87 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.86 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 99.86 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.86 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 99.85 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 99.85 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 99.85 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 99.84 | |
| 1zbo_A | 210 | Hypothetical protein BPP1347; alpha-beta protein, | 99.83 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 99.82 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 99.82 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.82 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 99.81 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 99.81 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 99.8 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 99.79 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 99.79 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 99.78 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 99.78 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 99.78 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 99.78 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 99.74 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 99.73 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.71 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.7 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 99.69 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 99.68 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 99.67 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 99.67 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 99.66 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 99.66 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 99.63 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 99.63 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 99.63 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 99.61 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 99.61 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 99.6 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 99.59 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 99.59 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 99.58 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 99.58 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 99.56 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 99.54 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 99.53 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 99.52 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 99.52 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 99.5 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 99.5 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.5 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 99.48 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 99.47 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 99.47 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.47 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 99.45 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 99.45 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 99.44 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 99.44 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.43 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 99.43 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 99.42 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 99.42 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 99.42 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 99.4 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 99.39 | |
| 1qzm_A | 94 | ATP-dependent protease LA; oligomerization domain, | 99.39 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 99.39 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 99.38 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 99.37 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 99.35 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 99.31 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 99.31 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 99.29 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 99.24 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.21 | |
| 2ane_A | 125 | ATP-dependent protease LA; LONN119, LON protease, | 99.07 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 98.91 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 98.91 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 98.71 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 98.71 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 98.66 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 98.6 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 98.59 | |
| 1jr3_D | 343 | DNA polymerase III, delta subunit; processivity, p | 98.49 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 98.44 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 98.44 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 98.39 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 98.33 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 98.32 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 98.31 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 98.0 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 97.88 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 97.84 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 97.56 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 97.48 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 97.38 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 97.34 | |
| 2pnl_A | 203 | Protease VP4; acyl-enzyme, Ser/Lys DYAD, viral pro | 97.23 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 97.08 | |
| 2gef_A | 217 | Protease VP4; birnavirus, serine/lysine DYAD mecha | 97.05 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 97.01 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 96.95 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 96.93 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 96.89 | |
| 1z6t_A | 591 | APAF-1, apoptotic protease activating factor 1; ca | 96.86 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 96.84 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 96.82 | |
| 2a5y_B | 549 | CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis | 96.8 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.77 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 96.77 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 96.71 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 96.7 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 96.69 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 96.68 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 96.65 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 96.63 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 96.63 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 96.62 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 96.62 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 96.61 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 96.6 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 96.6 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 96.59 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 96.57 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 96.56 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 96.54 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 96.53 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 96.51 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 96.51 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 96.51 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 96.48 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 96.45 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 96.44 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 96.42 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 96.39 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 96.38 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 96.38 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 96.38 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 96.37 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 96.37 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 96.37 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 96.36 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 96.34 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 96.31 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 96.3 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 96.26 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 96.25 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 96.24 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 96.22 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 96.21 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 96.2 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 96.2 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 96.18 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 96.16 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 96.14 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 96.13 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 96.12 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 96.12 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 96.12 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 96.11 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 96.11 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 96.1 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 96.1 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 96.1 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 96.07 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 96.01 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 95.99 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 95.99 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 95.99 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 95.98 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 95.97 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 95.95 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 95.93 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 95.93 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 95.93 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 95.92 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 95.92 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 95.91 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 95.9 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 95.88 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 95.88 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 95.87 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 95.87 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 95.87 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 95.86 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 95.84 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 95.84 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 95.82 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 95.82 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 95.82 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 95.81 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 95.81 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 95.8 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 95.79 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 95.77 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 95.77 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 95.76 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 95.76 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 95.75 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 95.75 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 95.74 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 95.74 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 95.73 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 95.72 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 95.72 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 95.72 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 95.71 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 95.7 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 95.7 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 95.69 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 95.69 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 95.69 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 95.68 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 95.67 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 95.66 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 95.66 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 95.65 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 95.64 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 95.63 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 95.62 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 95.61 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 95.6 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 95.6 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 95.6 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 95.59 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 95.57 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 95.56 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 95.55 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 95.52 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 95.49 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 95.44 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 95.44 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 95.4 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 95.4 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 95.39 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 95.39 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 95.39 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 95.38 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 95.37 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 95.36 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 95.35 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 95.34 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 95.32 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 95.31 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 95.29 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 95.26 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 95.24 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 95.24 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 95.24 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 95.2 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 95.16 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 95.12 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 95.1 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 95.1 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 95.1 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 95.1 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 95.09 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 95.09 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 95.07 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 95.07 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 95.07 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 95.06 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 95.06 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 95.04 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 95.0 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 94.98 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 94.96 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 94.93 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 94.9 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 94.89 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 94.87 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 94.83 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 94.82 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 94.81 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 94.78 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 94.75 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 94.69 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 94.66 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 94.61 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 94.6 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 94.55 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 94.52 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 94.48 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 94.48 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 94.45 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 94.41 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 94.37 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 94.32 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 94.29 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.29 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 94.29 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 94.27 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 94.27 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 94.22 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 94.19 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 94.19 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 94.18 | |
| 2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 94.17 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 94.12 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 94.12 | |
| 4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 94.07 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 94.06 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 94.05 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 94.02 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 94.0 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 93.92 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 93.86 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 93.84 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 93.83 | |
| 3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 93.78 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 93.73 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 93.72 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 93.61 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 93.61 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 93.52 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 93.4 | |
| 3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 93.36 | |
| 2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 93.24 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.1 | |
| 3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 93.06 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 92.99 | |
| 3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 92.95 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 92.92 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 92.92 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 92.91 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 92.87 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 92.82 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 92.78 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 92.72 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 92.65 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 92.65 | |
| 2krk_A | 86 | 26S protease regulatory subunit 8; structural geno | 92.64 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 92.64 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 92.61 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 92.59 | |
| 4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 92.59 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 92.58 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 92.57 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 92.53 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 92.49 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 92.45 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 92.42 | |
| 3kw6_A | 78 | 26S protease regulatory subunit 8; structural geno | 92.42 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 92.36 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 92.36 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 92.31 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 92.29 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 92.29 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 92.27 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 92.2 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 92.19 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 92.15 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 92.08 | |
| 3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 92.04 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 91.99 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 91.91 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 91.7 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 91.63 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 91.49 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 91.46 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 91.4 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 91.36 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 91.33 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 91.3 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 91.27 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 91.26 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 91.26 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 91.23 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 91.22 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 91.17 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 91.11 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 91.1 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 91.07 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 91.03 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 91.01 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 90.98 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 90.96 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 90.94 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 90.89 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 90.85 | |
| 3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 90.8 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 90.78 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 90.76 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 90.74 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 90.72 | |
| 3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 90.71 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 90.53 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 90.49 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 90.47 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 90.46 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 90.38 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 90.38 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 90.35 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 90.33 | |
| 1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 90.32 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 90.28 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 90.27 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 90.25 | |
| 3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 90.23 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 90.19 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 90.17 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 90.15 | |
| 1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 90.15 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 90.08 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 90.04 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 90.02 | |
| 2aka_B | 299 | Dynamin-1; fusion protein, GTPase domain, myosin, | 89.96 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 89.91 | |
| 1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 89.9 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 89.9 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 89.9 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 89.87 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 89.86 | |
| 3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 89.85 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 89.8 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 89.8 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 89.78 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 89.77 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 89.75 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 89.7 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 89.64 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 89.55 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 89.51 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 89.49 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 89.28 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 89.25 | |
| 1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 89.19 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 89.19 | |
| 3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 89.18 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 89.17 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 89.15 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 89.1 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 89.09 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 89.07 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 89.06 | |
| 3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 89.03 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 89.0 | |
| 2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 88.98 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 88.9 | |
| 3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 88.88 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 88.83 | |
| 2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 88.8 | |
| 2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 88.79 | |
| 3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 88.79 | |
| 3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 88.73 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 88.73 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 88.72 | |
| 3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 88.68 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 88.65 | |
| 1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 88.61 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 88.55 | |
| 2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 88.49 | |
| 3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 88.48 | |
| 3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 88.48 | |
| 3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 88.47 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 88.46 | |
| 1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 88.45 | |
| 2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 88.44 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 88.35 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 88.33 | |
| 2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 88.31 | |
| 3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 88.3 | |
| 2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 88.18 | |
| 3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 88.14 | |
| 2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 88.11 | |
| 1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 88.03 | |
| 2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 87.99 | |
| 1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 87.98 | |
| 1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 87.98 | |
| 3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 87.97 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 87.95 | |
| 3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 87.93 | |
| 1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 87.93 | |
| 2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 87.89 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 87.88 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 87.88 | |
| 3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 87.84 | |
| 1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 87.83 | |
| 3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 87.81 | |
| 2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 87.81 | |
| 2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 87.76 |
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-77 Score=698.86 Aligned_cols=534 Identities=49% Similarity=0.842 Sum_probs=460.5
Q ss_pred ChhHHHHHHHHHHHcCCChhhHHHHHHHHHHHHhcCCCCCCcchHHHHHHHHhcCCCCccchhHHhcHHHHHHhhccccc
Q 003349 237 DEDDLVALERKMQSAGMPSNIWKHVQKELRRLKKMQPQQPGYTSSRVYLELIADLPWEKASEEIDLDLKAAKERLDSDHY 316 (828)
Q Consensus 237 ~~~~~~~~~~~l~~~~lp~~a~~~~~~e~~~l~~~~~~~~~~~~~~~~l~~~~~iP~~~~~~~~~~~l~~~~~~l~~~i~ 316 (828)
...+++++++++.+.++|+++.+.+.+++++++.+.+.+.++..+++|+++++.+||...... ..++..+++.|+.+++
T Consensus 6 ~~~~~~~~~~~~~~~~~~~~~~~~~~~el~~l~~~~~~~~e~~~~~~~l~~~~~lp~~~~~~~-~~~~~~~~~~l~~di~ 84 (543)
T 3m6a_A 6 KTGEVQTLTEKIEEAGMPDHVKETALKELNRYEKIPSSSAESSVIRNYIDWLVALPWTDETDD-KLDLKEAGRLLDEEHH 84 (543)
T ss_dssp -CCTTTHHHHHHHSSSCCCHHHHHHHHHHHSSCCCSSSCTTTTHHHHHHHHHHHSCSSCCCCC-CCCTTTGGGTHHHHCS
T ss_pred HHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHhcCCCCCchHhHHHHHHHHHhcCCCCccccc-cccHHHHHHHHHHHhc
Confidence 346788999999999999999999999999999999999999999999999999999988876 7788888999999999
Q ss_pred chHHHHHHHHHHHHHhhhCCCCCCCeEEEEcCCCCchhHHHHHHHHHhCCCeEEEecCCcCchhhhccCcccccccCcch
Q 003349 317 GLVRVKQRIIEYLAVRKLKPDARGPVLCFVGPPGVGKTSLASSIASALGRKFIRISLGGVKDEADIRGHRRTYIGSMPGR 396 (828)
Q Consensus 317 G~~~~~~~l~~~l~~~~~~~~~~~~~lLL~GppGtGKT~la~~la~~l~~~~~~i~~~~~~~~~~l~g~~~~~vg~~~g~ 396 (828)
|++++++.+.+++.........+++++||+||||||||++|+++|..++.+++.+++++..+.+.+.++.+.|+|+.++.
T Consensus 85 G~~~vk~~i~~~~~l~~~~~~~~g~~vll~Gp~GtGKTtlar~ia~~l~~~~~~i~~~~~~~~~~~~g~~~~~ig~~~~~ 164 (543)
T 3m6a_A 85 GLEKVKERILEYLAVQKLTKSLKGPILCLAGPPGVGKTSLAKSIAKSLGRKFVRISLGGVRDESEIRGHRRTYVGAMPGR 164 (543)
T ss_dssp SCHHHHHHHHHHHHHHHHSSSCCSCEEEEESSSSSSHHHHHHHHHHHHTCEEEEECCCC--------------------C
T ss_pred cHHHHHHHHHHHHHHHHhcccCCCCEEEEECCCCCCHHHHHHHHHHhcCCCeEEEEecccchhhhhhhHHHHHhccCchH
Confidence 99999999999888877766668889999999999999999999999999999999999888888888888999999999
Q ss_pred HHHHHHhcCCCCcEEEEecccccCCCCCCChHHHHHHhcCcccccccccccCCeeecCCCcEEEEecCCCCCCCccccCc
Q 003349 397 LIDGLKRVGVCNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNKTFNDHYLNVPFDLSKVIFVATANRAQPIPPPLLDR 476 (828)
Q Consensus 397 l~~~~~~~~~~~~vl~iDEid~l~~~~~~~~~~~Ll~~ld~~~~~~~~~~~~~~~~~~~~viiI~TtN~~~~l~~aLl~R 476 (828)
+.+.|..+...++|+||||||++.++.+++.++.|+++|++.+...|.+++.+.++++++++||+|||.++.++++|++|
T Consensus 165 ~~~~~~~a~~~~~vl~lDEid~l~~~~~~~~~~~LL~~ld~~~~~~~~~~~~~~~~~~~~v~iI~ttN~~~~l~~aL~~R 244 (543)
T 3m6a_A 165 IIQGMKKAGKLNPVFLLDEIDKMSSDFRGDPSSAMLEVLDPEQNSSFSDHYIEETFDLSKVLFIATANNLATIPGPLRDR 244 (543)
T ss_dssp HHHHHHTTCSSSEEEEEEESSSCC---------CCGGGTCTTTTTBCCCSSSCCCCBCSSCEEEEECSSTTTSCHHHHHH
T ss_pred HHHHHHHhhccCCEEEEhhhhhhhhhhccCHHHHHHHHHhhhhcceeecccCCeeecccceEEEeccCccccCCHHHHhh
Confidence 99999988877889999999999998777778999999999988999999999999999999999999999999999999
Q ss_pred eEEEEcCCCCHHHHHHHHHHhhcHHHHHhcCCCCcccccCHHHHHHHHHHhhhhhchHHHHHHHHHHHHHHHHHHHHHhh
Q 003349 477 MEVIELPGYTPEEKLRIAMRHLIPRVLDQHGLGSEFLQIPEAMVKLVIQRYTREAGVRNLERNLAALARAAAVKVAEQEQ 556 (828)
Q Consensus 477 ~~~i~~~~~~~ee~~~Il~~~l~~~~~~~~~~~~~~~~i~~~~l~~l~~~~~~~~g~R~l~~~i~~l~~~a~~~~l~~~~ 556 (828)
|++|.|++|+.+++.+|++.++.++.+..+++....+.++++++..++..|++..|+|.|++.|+++|+.++.++++..
T Consensus 245 ~~vi~~~~~~~~e~~~Il~~~l~~~~~~~~~~~~~~i~i~~~~l~~l~~~~~~~~~vR~L~~~i~~~~~~aa~~~~~~~- 323 (543)
T 3m6a_A 245 MEIINIAGYTEIEKLEIVKDHLLPKQIKEHGLKKSNLQLRDQAILDIIRYYTREAGVRSLERQLAAICRKAAKAIVAEE- 323 (543)
T ss_dssp EEEEECCCCCHHHHHHHHHHTHHHHHHHHTTCCGGGCEECHHHHHHHHHHHCCCSSSHHHHHHHHHHHHHHHHHHHTTC-
T ss_pred cceeeeCCCCHHHHHHHHHHHHHHHHHHHcCCCcccccCCHHHHHHHHHhCChhhchhHHHHHHHHHHHHHHHHHHhcC-
Confidence 9999999999999999999999999999999888889999999999999999999999999999999999888776540
Q ss_pred hhcCCCCccccccCCccccccccCCCeeEEeeccCCCcccccccccccCcceeecccchhhccCCCccCchhhhhhcCCC
Q 003349 557 EQALPSSKDVHRLGSPLLDNRLADGAEVEMEVIPMGESTHEVSNTFRITSPLVVDEAMLEKVLGPPRFDDREAAERVAAP 636 (828)
Q Consensus 557 ~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~L~~~l~~~~~~~~~~~~~~~~~ 636 (828)
...+.|+.++++++++++.+.. ....+...+
T Consensus 324 ------------------------------------------------~~~~~It~~~l~~~Lg~~~~~~-e~~~~~~~~ 354 (543)
T 3m6a_A 324 ------------------------------------------------RKRITVTEKNLQDFIGKRIFRY-GQAETEDQV 354 (543)
T ss_dssp ------------------------------------------------CSCCEECTTTTHHHHCSCCSCC-STTTCCCBS
T ss_pred ------------------------------------------------CcceecCHHHHHHHhCCcccCc-hhhhccccc
Confidence 1246799999999999999987 444456778
Q ss_pred ceeEEEEEeecCceEEEEEEEEEcCcceEEEeeCCChHHHHHHHHHHHHHHHhhhhhhhhhhccCCCCCcccEEEEccCC
Q 003349 637 GISVGLVWTNFGGEVQFVEATAMRGKGELHLTGQLGDVIKESAQIALTWVRARATDLQLVAEDGMNLLQGRDIHIHFPAG 716 (828)
Q Consensus 637 G~v~g~~~~~~~g~~~~ie~~~~~g~~~~~~~G~~~~~~~es~~~a~~~~~~~~~~l~~~~~~~~~~~~~~dv~i~~~~~ 716 (828)
|.++|++|++.+|.+++||+.+++|.|++++||+++++||||.++|++++++.+..++. ...+|+++|||||+++|
T Consensus 355 g~v~g~a~~~~~g~~~~ve~~~~~g~~~~~~~G~~~~~~~es~~~a~~~v~~~~~~~g~----~~~~~~~~di~v~~~~g 430 (543)
T 3m6a_A 355 GVVTGLAYTTVGGDTLSIEVSLSPGKGKLILTGKLGDVMRESAQAAFSYVRSKTEELGI----EPDFHEKYDIHIHVPEG 430 (543)
T ss_dssp SEEEEEEEETTEEEEEEEEEEEESSCSCEEEEESCCHHHHHHHHHHHHHHTSSCGGGSS----CSSCTTTCEEEEEECTT
T ss_pred cccccccccCCCccceeeEEEeeCCCCceEEecCchHHHHHHHHHHHHHHHHHHHHcCC----CccccCCcceEEEeCCC
Confidence 99999999999999999999999999999999999999999999999999987755442 22337899999999888
Q ss_pred CCCCCCchhHHHHHHHHHHhccCCCCCCCEEEEeecCCCceeeecCCHHHHHHHHHHcCCCEEeecccChhhhccChhhh
Q 003349 717 AVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRGLVLPVGGVKDKILAAHRYGIKRVILPERNLKDLVEVPAAV 796 (828)
Q Consensus 717 ~~~~~g~sa~laia~ai~sa~~~~~~~~~~~~~Gei~L~G~v~~v~gi~~ki~~A~~~G~k~viiP~~n~~~~~~~~~~~ 796 (828)
+++|+|||||||+|+||+|+++++|++++++|||||+|+|+|+||||+.+|+.+|.++|+++||+|.+|.+++..+|+.+
T Consensus 431 ~~~k~gpsa~l~ia~ai~s~~~~~~~~~~~~~~GEi~L~G~v~~v~g~~~~~~~a~~~g~~~~iiP~~n~~~~~~~~~~~ 510 (543)
T 3m6a_A 431 AVPKDGPAAGITMATALVSALTGRAVSREVGMTGEITLRGRVLPIGGLKEKALGAHRAGLTTIIAPKDNEKDIEDIPESV 510 (543)
T ss_dssp BCGGGGGGGHHHHHHHHHHHHTSCCBCTTCEECCEECTTCBEECCSCHHHHHHHHHHTTCSBEEEEGGGGGGGGGSCHHH
T ss_pred CCCCCCchhHHHHHHHHHHHccCCCCCCCEEEEEEEcCCceEEeeCCHHHHHHHHHHCCCCEEEECHHHHHHHHhhHHHH
Confidence 89999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hCCcEEEEcCCHHHHHHHHHcCCCCCCCC
Q 003349 797 LASLEIILAKRMEDVLEQAFEGGCPWRQH 825 (828)
Q Consensus 797 ~~~i~i~~v~~l~e~~~~~~~~~~~~~~~ 825 (828)
..+++|++|+|+.||++++|...+...||
T Consensus 511 ~~~~~i~~v~~l~e~~~~~~~~~~~~~~~ 539 (543)
T 3m6a_A 511 REGLTFILASHLDEVLEHALVGEKKLEHH 539 (543)
T ss_dssp HTSCBCCEESBHHHHHHHHBC--------
T ss_pred hCCCEEEEeCCHHHHHHHHHhccCccccc
Confidence 99999999999999999998877555444
|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1rre_A ATP-dependent protease LA; catalytic Ser-Lys DYAD, hydrolase; HET: MSE; 1.75A {Escherichia coli} SCOP: d.14.1.10 PDB: 1rr9_A* | Back alignment and structure |
|---|
| >2x36_A LON protease homolog, mitochondrial; hydrolase, catalytic DYAD, transit peptide; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1xhk_A Putative protease LA homolog; LON protease, ATP dependent, catalytic DYAD, hydrolase; HET: MES; 1.90A {Methanocaldococcus jannaschii} SCOP: d.14.1.10 | Back alignment and structure |
|---|
| >1z0w_A Putative protease LA homolog type; ATP-dependent protease, catalytic Ser-Lys DYAD, B-type LON, hydrolase; 1.20A {Archaeoglobus fulgidus} PDB: 1z0b_A 1z0c_A 1z0e_A 1z0g_A 1z0t_A 1z0v_A | Back alignment and structure |
|---|
| >3ljc_A ATP-dependent protease LA; LON N-domain, allosteric enzyme, ATP-binding, DNA-binding, H nucleotide-binding, serine protease, stress respo; 2.60A {Escherichia coli} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3m65_A ATP-dependent protease LA 1; coiled-coil, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; 2.60A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >1zbo_A Hypothetical protein BPP1347; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.60A {Bordetella parapertussis} SCOP: b.122.1.10 | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1qzm_A ATP-dependent protease LA; oligomerization domain, AAA+ protein, hydrolase; 1.90A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >2ane_A ATP-dependent protease LA; LONN119, LON protease, hydrolase; 2.03A {Escherichia coli} SCOP: b.122.1.10 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >2pnl_A Protease VP4; acyl-enzyme, Ser/Lys DYAD, viral protease, substrate complex, product complex, hydrolase; 2.21A {Infectious pancreatic necrosis virus} PDB: 2pnm_A 3rbp_A 3r0b_A | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2gef_A Protease VP4; birnavirus, serine/lysine DYAD mechamism, lysine general base, hydrolase; 2.20A {Blotched snakehead virus} | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
| >3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
|---|
| >3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
|---|
| >2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
|---|
| >3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
|---|
| >3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
|---|
| >1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
|---|
| >2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
|---|
| >3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
|---|
| >2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
|---|
| >2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
|---|
| >1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
|---|
| >1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
|---|
| >3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
|---|
| >1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
|---|
| >3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
|---|
| >2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
|---|
| >2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 828 | ||||
| d1rrea_ | 182 | d.14.1.10 (A:) ATP-dependent protease Lon (La), ca | 7e-43 | |
| d1svma_ | 362 | c.37.1.20 (A:) Papillomavirus large T antigen heli | 4e-33 | |
| d1xhka_ | 185 | d.14.1.10 (A:) ATP-dependent protease Lon (La), ca | 4e-31 | |
| d1ofha_ | 309 | c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId | 2e-29 | |
| d1gvnb_ | 273 | c.37.1.21 (B:) Plasmid maintenance system epsilon/ | 2e-28 | |
| d1r6bx3 | 315 | c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A | 1e-25 | |
| d1lv7a_ | 256 | c.37.1.20 (A:) AAA domain of cell division protein | 2e-22 | |
| d1ixza_ | 247 | c.37.1.20 (A:) AAA domain of cell division protein | 1e-18 | |
| d1np6a_ | 170 | c.37.1.10 (A:) Molybdopterin-guanine dinucleotide | 9e-18 | |
| d1qzma_ | 94 | c.37.1.20 (A:) ATPase domain of protease Lon (La) | 2e-16 | |
| d1w5sa2 | 287 | c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t | 6e-16 | |
| d1r7ra3 | 265 | c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p | 1e-14 | |
| d1qvra3 | 315 | c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus | 1e-10 | |
| d1w44a_ | 321 | c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta | 3e-10 | |
| d1ixsb2 | 239 | c.37.1.20 (B:4-242) Holliday junction helicase Ruv | 5e-07 | |
| d1fnna2 | 276 | c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob | 4e-05 | |
| d1e32a2 | 258 | c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p | 5e-05 | |
| d2gnoa2 | 198 | c.37.1.20 (A:11-208) gamma subunit of DNA polymera | 1e-04 | |
| d1d2na_ | 246 | c.37.1.20 (A:) Hexamerization domain of N-ethylmal | 2e-04 | |
| d2iyva1 | 165 | c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycoba | 2e-04 | |
| d1in4a2 | 238 | c.37.1.20 (A:17-254) Holliday junction helicase Ru | 5e-04 | |
| d1ak2a1 | 190 | c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Co | 5e-04 | |
| d1m8pa3 | 183 | c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d | 5e-04 | |
| d1rkba_ | 173 | c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien | 6e-04 | |
| d1lw7a2 | 192 | c.37.1.1 (A:220-411) Transcriptional regulator Nad | 6e-04 | |
| d1zp6a1 | 176 | c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { | 7e-04 | |
| d1kaga_ | 169 | c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia | 7e-04 | |
| d1e6ca_ | 170 | c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr | 0.002 | |
| d2awna2 | 232 | c.37.1.12 (A:4-235) Maltose transport protein MalK | 0.002 | |
| d1viaa_ | 161 | c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobact | 0.002 | |
| d2ak3a1 | 189 | c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow | 0.004 | |
| d1ukza_ | 196 | c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Sac | 0.004 |
| >d1rrea_ d.14.1.10 (A:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli [TaxId: 562]} Length = 182 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ribosomal protein S5 domain 2-like superfamily: Ribosomal protein S5 domain 2-like family: ATP-dependent protease Lon (La), catalytic domain domain: ATP-dependent protease Lon (La), catalytic domain species: Escherichia coli [TaxId: 562]
Score = 151 bits (383), Expect = 7e-43
Identities = 94/182 (51%), Positives = 123/182 (67%), Gaps = 4/182 (2%)
Query: 637 GISVGLVWTNFGGEVQFVEATAMRGKGELHLTGQLGDVIKESAQIALTWVRARATDLQLV 696
G GL WT GG++ +E + GKG+L TG LG+V++ES Q ALT VRARA L +
Sbjct: 3 GQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGIN 62
Query: 697 AEDGMNLLQGRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRG 756
+ RDIH+H P GA PKDGP+AG+ + TALVS + VRAD AMTGE+TLRG
Sbjct: 63 PDFYEK----RDIHVHVPEGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRG 118
Query: 757 LVLPVGGVKDKILAAHRYGIKRVILPERNLKDLVEVPAAVLASLEIILAKRMEDVLEQAF 816
VLP+GG+K+K+LAAHR GIK V++P N +DL E+P V+A L+I KR+E+VL A
Sbjct: 119 QVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPDNVIADLDIHPVKRIEEVLTLAL 178
Query: 817 EG 818
+
Sbjct: 179 QN 180
|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 | Back information, alignment and structure |
|---|
| >d1xhka_ d.14.1.10 (A:) ATP-dependent protease Lon (La), catalytic domain {Methanococcus jannaschii [TaxId: 2190]} Length = 185 | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315 | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170 | Back information, alignment and structure |
|---|
| >d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} Length = 94 | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315 | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Length = 198 | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 165 | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Length = 190 | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170 | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Length = 161 | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Length = 189 | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 196 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 828 | |||
| d1rrea_ | 182 | ATP-dependent protease Lon (La), catalytic domain | 100.0 | |
| d1xhka_ | 185 | ATP-dependent protease Lon (La), catalytic domain | 100.0 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.96 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 99.95 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 99.92 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 99.91 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.91 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.89 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 99.88 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 99.87 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 99.77 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 99.76 | |
| d1zboa1 | 197 | Hypothetical protein BPP1347 {Bordetella parapertu | 99.73 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 99.72 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 99.7 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 99.69 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 99.68 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 99.67 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 99.67 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 99.66 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 99.6 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 99.58 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 99.57 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 99.56 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 99.52 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 99.51 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 99.46 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 99.46 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 99.41 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 99.37 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 99.32 | |
| d1qzma_ | 94 | ATPase domain of protease Lon (La) {Escherichia co | 99.31 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 99.3 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 99.29 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 99.16 | |
| d2anea1 | 110 | ATP-dependent protease La (Lon), N-terminal domain | 98.9 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 98.45 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 98.19 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 97.94 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 97.85 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 97.83 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 97.6 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 97.53 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 97.52 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 97.46 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 97.42 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 97.39 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.39 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 97.34 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 97.28 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 97.26 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 97.21 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 97.2 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 97.18 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 97.18 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.13 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 97.08 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.04 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 97.01 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 97.0 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 96.96 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 96.89 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 96.88 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 96.87 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.85 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.84 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 96.77 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 96.76 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.71 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 96.68 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 96.66 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 96.66 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 96.62 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 96.55 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 96.5 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 96.4 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 96.34 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 96.32 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.31 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 96.26 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 96.19 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 96.16 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 96.16 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 96.16 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 96.14 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 96.06 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 96.04 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 96.04 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 96.01 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 95.97 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 95.96 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 95.95 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 95.9 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 95.89 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 95.89 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 95.87 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 95.83 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 95.79 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 95.79 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 95.75 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 95.66 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 95.66 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 95.66 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 95.64 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 95.63 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 95.52 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 95.51 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 95.5 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 95.34 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 95.29 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 95.28 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 95.24 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.1 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.99 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 94.97 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 94.92 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 94.89 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 94.83 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 94.78 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 94.75 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 94.66 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 94.64 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 94.48 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 94.31 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 94.25 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 94.13 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 93.79 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 93.66 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 93.65 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.63 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 93.53 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 93.51 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 93.23 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 93.19 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 92.81 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 92.75 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.69 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 92.65 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 92.59 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 92.51 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 92.48 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 92.42 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 92.39 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 92.36 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 92.36 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 92.28 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 92.21 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 92.21 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 91.83 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 91.81 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 91.71 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 91.67 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 91.67 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 91.64 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 91.55 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 91.55 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 91.49 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 91.38 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 91.29 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 91.29 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 91.23 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 91.19 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 91.16 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 91.04 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 91.01 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 90.97 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 90.96 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 90.92 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 90.9 | |
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 90.87 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 90.81 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 90.69 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 90.66 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 90.65 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 90.53 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 90.43 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 90.41 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 90.4 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 90.36 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 90.2 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 90.18 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 90.15 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 90.07 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 90.05 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 90.05 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 90.04 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 89.94 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 89.88 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 89.83 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 89.79 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 89.78 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 89.74 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 89.64 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 89.56 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 89.54 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 89.4 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 89.39 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 89.35 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 89.33 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 89.33 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 89.33 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 89.3 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 89.23 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 88.99 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 88.98 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 88.87 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 88.62 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 88.61 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 88.58 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 88.44 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 88.43 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 88.37 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 88.31 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 88.23 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 88.15 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 88.09 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 88.04 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 88.03 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 87.72 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 87.72 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 87.6 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 87.6 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 87.52 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 87.3 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 87.3 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 87.24 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 87.22 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 86.88 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 86.79 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 86.27 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 85.94 | |
| d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 85.7 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 85.44 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 85.15 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 85.11 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 84.76 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 84.73 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 84.68 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 84.35 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 84.15 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 83.52 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 83.44 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 83.17 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 82.59 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 81.59 | |
| d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 80.28 |
| >d1rrea_ d.14.1.10 (A:) ATP-dependent protease Lon (La), catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ribosomal protein S5 domain 2-like superfamily: Ribosomal protein S5 domain 2-like family: ATP-dependent protease Lon (La), catalytic domain domain: ATP-dependent protease Lon (La), catalytic domain species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=6.2e-35 Score=286.68 Aligned_cols=181 Identities=52% Similarity=0.846 Sum_probs=168.5
Q ss_pred CCceeEEEEEeecCceEEEEEEEEEcCcceEEEeeCCChHHHHHHHHHHHHHHHhhhhhhhhhhccCCCCCcccEEEEcc
Q 003349 635 APGISVGLVWTNFGGEVQFVEATAMRGKGELHLTGQLGDVIKESAQIALTWVRARATDLQLVAEDGMNLLQGRDIHIHFP 714 (828)
Q Consensus 635 ~~G~v~g~~~~~~~g~~~~ie~~~~~g~~~~~~~G~~~~~~~es~~~a~~~~~~~~~~l~~~~~~~~~~~~~~dv~i~~~ 714 (828)
+.|+++|++|++.||.+++||+++.+|.|+++++|.++..++||..+++++++++...+.. ...++.++|+|+|++
T Consensus 1 ~iG~v~GL~v~~~gG~ll~IEv~~~~G~g~~~~tG~~~~~~~es~~~a~~~~~~~~~~~~~----~~~~~~~~di~i~~~ 76 (182)
T d1rrea_ 1 RVGQVTGLAWTEVGGDLLTIETACVPGKGKLTYTGSLGEVMQESIQAALTVVRARAEKLGI----NPDFYEKRDIHVHVP 76 (182)
T ss_dssp CCEEEEEEEEETTEEEEEEEEEEEEECSSCEEEESSBCHHHHHHHHHHHHHHHHTHHHHTC----CTTTTTSEEEEEECS
T ss_pred CeEEEEEEEEECCCCEEEEEEEEEEcCCCcEEEecCcchhhhHHHHHHHHHHHHHHHHcCC----CcccccccceEEEee
Confidence 4699999999999999999999999999999999999999999999999999986654442 112267899999999
Q ss_pred CCCCCCCCchhHHHHHHHHHHhccCCCCCCCEEEEeecCCCceeeecCCHHHHHHHHHHcCCCEEeecccChhhhccChh
Q 003349 715 AGAVPKDGPSAGVTLVTALVSLFSRKRVRADTAMTGEMTLRGLVLPVGGVKDKILAAHRYGIKRVILPERNLKDLVEVPA 794 (828)
Q Consensus 715 ~~~~~~~g~sa~laia~ai~sa~~~~~~~~~~~~~Gei~L~G~v~~v~gi~~ki~~A~~~G~k~viiP~~n~~~~~~~~~ 794 (828)
+++.+++|||+|+|+++|++|++.++|++++++|||||+|+|+|+||||+.+|+.+|.++|+|+||||++|.+++.++|+
T Consensus 77 ~~~~~~~g~sa~la~~~a~~s~~~~~~i~~~~a~tGei~l~G~V~~Vggi~~ki~~A~~~G~k~viiP~~n~~~~~~~~~ 156 (182)
T d1rrea_ 77 EGATPKDGPAAGIAMCTALVSCLTGNPVRADVAMTGEITLRGQVLPIGGLKEKLLAAHRGGIKTVLIPFENKRDLEEIPD 156 (182)
T ss_dssp STTSCEESSTTHHHHHHHHHHHHHTCCBCTTEEECCEECTTCBEECCSCHHHHHHHHHHTTCCEEEEEGGGGGGGGGSCH
T ss_pred cccccccchhhHHHHHHHHHHHHhCccccccceeeeccccchhhccCCChHHHHHHHHHcCCcEEEecHHHHHHHHhhhH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhhCCcEEEEcCCHHHHHHHHHcCC
Q 003349 795 AVLASLEIILAKRMEDVLEQAFEGG 819 (828)
Q Consensus 795 ~~~~~i~i~~v~~l~e~~~~~~~~~ 819 (828)
++.++++|++|+|++||++++|.+.
T Consensus 157 ~~~~~i~i~~v~~i~e~~~~~l~~~ 181 (182)
T d1rrea_ 157 NVIADLDIHPVKRIEEVLTLALQNE 181 (182)
T ss_dssp HHHHHSEEEEESBHHHHHHHHBSSC
T ss_pred HHhCCcEEEEeCcHHHHHHHHhccC
Confidence 9999999999999999999987654
|
| >d1xhka_ d.14.1.10 (A:) ATP-dependent protease Lon (La), catalytic domain {Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zboa1 b.122.1.10 (A:2-198) Hypothetical protein BPP1347 {Bordetella parapertussis [TaxId: 519]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2anea1 b.122.1.10 (A:8-117) ATP-dependent protease La (Lon), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|