Citrus Sinensis ID: 003969

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780---
MASFPTETLNLPPPINGQDSTSHNEPLQNADDEQIQPSIPQSTDDVTTTAAEKRKREDVATEGPQSESAEPSPSPSLHPLHKTSLCSYFRKVGTCCHGSTCRYAHGEEELRIRPDNTWDPTSERAKKARKLEDGDKCEAKEDAVEEVMMTEAVVDGDGDGDQDVELSKCLVHLPRKWHSDNLKKFLADHGILYKSAKKKKGMTVGFVKFESVEQLKNAVEELEGISIGNKTLKVANVVPRSFDKNIKSPMTLSGNAKQASESAVPGELAEAHASSNGHEDGNGNDEGLAGDGSGLKVKSARDVVTPLAHMSYSVQLEHKKNSIAQMLKKLTRNARKACPNGVSLPEWIMKSREIGGLPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKPTVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGRSPGKPLDVENLEVNISEVNISEVMLIAQVSSATFDDAVVNSEFERLAKAFAAGATASSPSLPLTALVIQDHQGVSNVAPADAPLRLLSIPKADGEPEESNDVVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDVMGSLLKDYLNPLREEDEHASEGSNKEITIAEEKDSSRDNVPENEGCSGQDPENDIADSNCPEGSGKEPQSQLQKDCTSEGNSLAQPFKNVVAIVDPPRGGLHPTVIKILRTHARLQRLLHIM
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccHHHHHHHHHcccccccccccccccccEEEEEcccccccHHHHHHHHHHcccccccEEcccccEEEEEEEccHHHHHHHHHHHcccEEcccEEEEEEcccccccccccccccccccccccccccccccEEEEEEEEcccccEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHccccccccccccccccccccccccccEEEEEccccccEEEEEEEccccccEEEEEcccccccccHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEccccccccccccccccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccccccccccEEEccccccccccccccccccccEEEEEccEEEEEcccccccccHHHHHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHcccccEEcccccccccccEEEEcccccccccccccccccccccccEEEEcccccccccccHHHcccccccccccccccccccEEEcccccccccHHHHHHHHHcccccccEEEc
cccccHcHcccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccHccHHHHHcccccccccccccccccHHHHcccccccccccHHHHHHHHHccccccHHHHHHHHHHEEEEEEEEcccccccccHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHcccccEEEEEEcccccccccEEEEEEEEcccccccEEEEccEEEEEEcccEEEEcccEcccccccccccEEEEEEEEEccccEEEEEEcccccccccccHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHccccccccEEccccccccccccccccEEEEccccccEEEEEEEcccccccccEEEcHHHcccccHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEcccccEEEEEEEEEcccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHcccHccccccEEEEEEEEcccccEEEEccccEEEEcccccccccccHccccccHHHHHHcccEEEEccHHHEcccHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHEEEEEEcHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHccccccEEEEccccccccHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHccccccEEEccccccccccccHHEEEEEccEEEEEccccccccHHHHHHHHccHHHcEEEEEc
masfptetlnlpppingqdstshneplqnaddeqiqpsipqstdDVTTTAAEkrkredvategpqsesaepspspslhplhktslcsyfrkvgtcchgstcryahgeeelrirpdntwdptserakkarkledgdkceaKEDAVEEVMMTEAvvdgdgdgdqdvELSKclvhlprkwhsdNLKKFLADHGILyksakkkkgmtvgfVKFESVEQLKNAVEELEgisignktlkvanvvprsfdknikspmtlsgnakqasesavpgelaeahassnghedgngndeglagdgsglkvksardvvtplaHMSYSVQLEHKKNSIAQMLKKLTRNarkacpngvslpeWIMKSreigglpcklegilgsplvngyrnkcefsvgyslqakptvgfmlgnfregvtaveepvdcpnvsEIACKYASIFQEFlqqsdlpvwnrfknsgfwRQLTVregrspgkpldvenlevnisevnISEVMLIAQVSSATFDDAVVNSEFERLAKAFAagatasspslpltaLVIQdhqgvsnvapadaplrllsipkadgepeesndVVEARIHDsisnlrfcisptaffQVNTLAAEKLYSlggdwadlgpdtllfdvccgtgtigltLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDVMGSLLKDYLnplreedehasegsnkeitiaeekdssrdnvpenegcsgqdpendiadsncpegsgkepqsqlqkdctsegnslaqpfknvvaivdpprgglhpTVIKILRTHARLQRLLHIM
masfptetlnlpppinGQDSTSHNEPLQNAddeqiqpsipqstdDVTTTAAEKrkredvategpqsesaepspspslhpLHKTSLCSYFRKVGTCCHGSTcryahgeeelrirpdntwdptserakkarkledgdkceAKEDAVEEVMMTEAVvdgdgdgdQDVELSKCLVhlprkwhsdnlKKFLADHGILYksakkkkgmtVGFVKFESVEQLKNAVEelegisignktlkvanVVPRSFDKNIKSPMTLSGNAKQASESAVPGELAEAHASSNGHEDGNGNDEGLAGDGSGLKVKSARDVVTPLAHMSysvqlehkkNSIAQMLKKLTrnarkacpngvslpeWIMKSREIGGLPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKPTVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTvregrspgkpldvenLEVNISEVNISEVMLIAQVSSATFDDAVVNSEFERLAKAFAAGATASSPSLPLTALVIQDHQGVSNVAPADAPLRLLSIPKADGEPEESNDVVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDVMGSLLKDYLNPLReedehasegsnkeitiaeekdssrdnvpenegcsgqdpenDIADSNCPEGSGKEPQSQLQKDCTSEGNSLAQPFKNVVAIVDPPRGGLHPTVIKILRTHARLQRLLHIM
MASFPTETLNLPPPINGQDSTSHNEPLQNADDEQIQPSIPQSTDDVTTTAAEKRKREDVATEGpqsesaepspspslhplhKTSLCSYFRKVGTCCHGSTCRYAHGEEELRIRPDNTWDPTSERAKKARKLEDGDKCEAKedaveevmmteavvdgdgdgdqdvELSKCLVHLPRKWHSDNLKKFLADHGILYKSAKKKKGMTVGFVKFESVEQLKNAVEELEGISIGNKTLKVANVVPRSFDKNIKSPMTLSGNAKQASESAVPGELAEAHASSnghedgngndegLAGDGSGLKVKSARDVVTPLAHMSYSVQLEHKKNSIAQMLKKLTRNARKACPNGVSLPEWIMKSREIGGLPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKPTVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGRSPGKPLDVENLEVNISEVNISEVMLIAQVSSATFDDAVVNSEFERLakafaagataSSPSLPLTALVIQDHQGVSNVAPADAPLRLLSIPKADGEPEESNDVVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDVMGSLLKDYLNPLREEDEHASEGSNKEITIAEEKDSSRDNVPENEGCSGQDPENDIADSNCPEGSGKEPQSQLQKDCTSEGNSLAQPFKNVVAIVDPPRGGLHPTVIKILRTHARLQRLLHIM
**********************************************************************************TSLCSYFRKVGTCCHGSTCRYAHGE*******************************************************DVELSKCLVHLPRKWHSDNLKKFLADHGILYKSAKKKKGMTVGFVKFESVEQLKNAVEELEGISIGNKTLKVANVVP****************************************************************VTPLAHMSYSVQL******IAQMLKKLTRNARKACPNGVSLPEWIMKSREIGGLPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKPTVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVRE*******LDVENLEVNISEVNISEVMLIAQVSSATFDDAVVNSEFERLAKAFAAGAT*****LPLTALVIQDHQGV****************************VEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDVMGSLLKDYL*****************************************************************************FKNVVAIVDPPRGGLHPTVIKILRTHARLQRLL***
*********************************************************************************KTSLCSY************************************************************************DQDVELSKCLVHLPRKWHSDNLKKFLADHGI*******K*GMTVGFVKFESVEQLKNAVEELEGISIGNKTLKVANVVPRSF***************QASESAVPGELAEAHASSNGHEDGNGNDE*********KVKSARDVVTPLAHMSYSVQLEHKKNSIAQMLKKLTRNARKACPNGVSLPEWIMKSREIGGLPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKPTVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGRSPGKPLDVENLEVNISEVNISEVMLIAQVSSATFDDAVVNSEFERLAKAFAAGATASSPSLPLTALVIQDHQGVSNVAPADAPLRLLSIPKADGEPEESNDVVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDVMGSLLKDYLNPLREEDEHASEGSNKEITIAEEKDSSRDNVPENEGCSGQDPENDIADSNCPEGSGKEPQSQLQKDCTSEGNSLAQPFKNVVAIVDPPRGGLHPTVIKILRTHARLQRLLHIM
MASFPTETLNLPPPINGQDSTSHNEPLQNADDEQIQPSIP*************************************HPLHKTSLCSYFRKVGTCCHGSTCRYAHGEEELRIRPDNTWD**********************DAVEEVMMTEAVVDGDGDGDQDVELSKCLVHLPRKWHSDNLKKFLADHGILYKSAKKKKGMTVGFVKFESVEQLKNAVEELEGISIGNKTLKVANVVPRSFDKNIKSPMTL***************************DGNGNDEGLAGDGSGLKVKSARDVVTPLAHMSYSVQLEHKKNSIAQMLKKLTRNARKACPNGVSLPEWIMKSREIGGLPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKPTVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGRSPGKPLDVENLEVNISEVNISEVMLIAQVSSATFDDAVVNSEFERLAKAFAAGATASSPSLPLTALVIQDHQGVSNVAPADAPLRLLSIPKA*********VVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDVMGSLLKDYLNPLR**********NKEITIAE*******************PENDIADSN*********************NSLAQPFKNVVAIVDPPRGGLHPTVIKILRTHARLQRLLHIM
********************************************DVT****************************SLHPLHKTSLCSYFRKVGTCC*GSTCR*****EELRIRPDNTWDPTSERAKKARKLEDGDKCEAKEDAVEEVMMTEAVVDGDGDGDQDVELSKCLVHLPRKWHSDNLKKFLADHGILYKSAKKKKGMTVGFVKFESVEQLKNAVEELEGISIGNKTLKVANVVPRSFDKNIKSPMTLSGNAKQASESAVPGELAEAHASSNGHEDGNGNDEGLAGDGSGLKVKSARDVVTPLAHMSYSVQLEHKKNSIAQMLKKLTRNARKACPNGVSLPEWIMKSREIGGLPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKPTVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGRSPGKPLDVENLEVNISEVNISEVMLIAQVSSATFDDAVVNSEFERLAKAFAAGATASSPSLPLTALVIQDHQGVSNVAPADAPLRLLSIPKADGEPEESNDVVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDVMGSLLKDYLNPLREEDEHASEGSNKEITIAEEKDSSRDNVPENEGCSGQDPENDIADSNCPEGSGKEPQSQLQKDCTSEGNSLAQPFKNVVAIVDPPRGGLHPTVIKILRTHARLQRLLHIM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASFPTETLNLPPPINGQDSTSHNEPLQNADDEQIQPSIPQSTDDVTTTAAEKRKREDVATEGPQSESAEPSPSPSLHPLHKTSLCSYFRKVGTCCHGSTCRYAHGEEELRIRPDNTWDPTSERAKKARKLEDGDKCEAKEDAVEEVMMTEAVVDGDGDGDQDVELSKCLVHLPRKWHSDNLKKFLADHGILYKSAKKKKGMTVGFVKFESVEQLKNAVEELEGISIGNKTLKVANVVPRSFDKNIKSPMTLSGNAKQASESAVPGELAEAHASSNGHEDGNGNDEGLAGDGSGLKVKSARDVVTPLAHMSYSVQLEHKKNSIAQMLKKLTRNARKACPNGVSLPEWIMKSREIGGLPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKPTVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGRSPGKPLDVENLEVNISEVNISEVMLIAQVSSATFDDAVVNSEFERLAKAFAAGATASSPSLPLTALVIQDHQGVSNVAPADAPLRLLSIPKADGEPEESNDVVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDVMGSLLKDYLNPLREEDEHASEGSNKEITIAEEKDSSRDNVPENEGCSGQDPENDIADSNCPEGSGKEPQSQLQKDCTSEGNSLAQPFKNVVAIVDPPRGGLHPTVIKILRTHARLQRLLHIM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query783 2.2.26 [Sep-21-2011]
Q8L7S3809 Zinc finger CCCH domain-c yes no 0.871 0.843 0.552 0.0
Q8IZ69625 tRNA (uracil-5-)-methyltr yes no 0.533 0.668 0.31 2e-47
Q96GJ1504 tRNA (uracil(54)-C(5))-me no no 0.415 0.644 0.336 1e-41
Q5RFM7486 tRNA (uracil(54)-C(5))-me no no 0.415 0.668 0.345 1e-41
Q8BQJ6493 tRNA (uracil(54)-C(5))-me no no 0.413 0.657 0.324 8e-39
Q8BNV1574 tRNA (uracil-5-)-methyltr no no 0.429 0.585 0.331 2e-38
A4QP75480 tRNA (uracil(54)-C(5))-me no no 0.397 0.647 0.284 2e-29
Q74I68450 Uncharacterized RNA methy yes no 0.358 0.624 0.278 9e-26
Q8R918452 Uncharacterized RNA methy yes no 0.361 0.626 0.283 7e-22
Q8DUV4451 Uncharacterized RNA methy yes no 0.389 0.676 0.256 2e-20
>sp|Q8L7S3|C3H24_ARATH Zinc finger CCCH domain-containing protein 24 OS=Arabidopsis thaliana GN=At2g28450 PE=2 SV=1 Back     alignment and function desciption
 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/778 (55%), Positives = 533/778 (68%), Gaps = 96/778 (12%)

Query: 26  PLQNADDEQIQPSIPQSTDDVTTTAAEKRKR--EDVATEGPQSESAEPSPSPSLHPLHKT 83
           P++ +  +++  S   +TD++     EKRKR  ED  T    S++   +PSP      KT
Sbjct: 28  PMETSSIDELPSSDSNATDNIEA-VGEKRKRADEDEKTNLESSDTKITTPSP----WWKT 82

Query: 84  SLCSYFRKVGTCCHGSTCRYAHGEEELRIRPDNTWDPTSERAKKARKLEDGDKCEAKEDA 143
           SLCSYFR+  +C HG+ C+YAHGE ELR++PDNTWDPTSER KKA+ ++     E +E  
Sbjct: 83  SLCSYFRREASCSHGNECKYAHGEAELRMKPDNTWDPTSERGKKAKAMK---MSEHEEKE 139

Query: 144 VEEVMMTEAV---VDGDGDGD-----QDVELSKCLVHLPRKWHSDNLKKFLADHGILYKS 195
            +EV+ TE +   +DGD  G       D+ LSKCLVHLP KW SD LKKFL + G+LYKS
Sbjct: 140 EDEVLFTEQMMESIDGDEGGGGSVSVVDLSLSKCLVHLPNKWQSDELKKFLGEQGVLYKS 199

Query: 196 AKKKKGMTVGFVKFESVEQLKNAVEELEGISIGNKTLKVANVVPRSFDKNIKSPMTLSGN 255
           AKK++GM VGFV FE+ EQL++ VE L+G ++ +  LK+A+V+PR+FDKN         +
Sbjct: 200 AKKRRGMIVGFVTFENAEQLQSGVEILDGKTVNSSNLKIADVLPRTFDKN---------D 250

Query: 256 AKQASESAVPGELAEAHASSNGHEDGNGNDEGLAGDGSGLKVKSARDVVTPLAHMSYSVQ 315
           A+++                                     VKSARD VTPLA++SY+ Q
Sbjct: 251 ARKS-------------------------------------VKSARDAVTPLAYLSYADQ 273

Query: 316 LEHKKNSIAQMLKKLTRNARKACPNGVSLPEWIMKSREIGGLPCKLEGILGSPLVNGYRN 375
           LE KK SI QMLKKL RNARKACPNG SLP+W++ SR+ GGL C LEGI+ SP+ NGYRN
Sbjct: 274 LEQKKTSIGQMLKKLARNARKACPNGNSLPQWVLTSRDRGGLACNLEGIIESPITNGYRN 333

Query: 376 KCEFSVGYSLQAKPTVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLP 435
           KCEFSVG SLQ KPTVGF LG+F  GVTAVEEPVDCPNVS+IA +YASIFQ+F++ S   
Sbjct: 334 KCEFSVGLSLQGKPTVGFSLGSFCAGVTAVEEPVDCPNVSKIASQYASIFQKFIENSKFQ 393

Query: 436 VWNRFKNSGFWRQLTVREGRSPGKPLDVENLEVNISEVNISEVMLIAQVSSATFDDAVVN 495
           VWNRF++SGFWRQLTVREGR PG      N E  I+   I+EVML+ QV     D+A V 
Sbjct: 394 VWNRFQHSGFWRQLTVREGRKPGV---FSNDEDAITR--IAEVMLMVQVCLTGSDEAEVA 448

Query: 496 SEFERLAKAFAAGATASSPSLPLTALVIQDHQGVSNVAPADAPLRLLSIPKADG---EPE 552
           +EFE LAKAFA GA ASSP+LPLT LV+Q+H G+SNVAP DAPL++L+IP +D    + +
Sbjct: 449 TEFEELAKAFAEGARASSPTLPLTVLVVQNHSGISNVAPPDAPLQVLAIPISDNGTDQEQ 508

Query: 553 ESNDVVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLFDVCCGT 612
            +N + EARIHD I+NLRF ISPTAFFQVNT+ AEKLYS+ GDWADLGPDTLLFDVCCGT
Sbjct: 509 TTNVLTEARIHDHINNLRFSISPTAFFQVNTVTAEKLYSIAGDWADLGPDTLLFDVCCGT 568

Query: 613 GTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDVMGSLLKDYLNP 672
           GTIGLTLAHRVGMVIGIEMNASAV+DA RNA INGI NC+F+C+KAEDVM SLLK YL+ 
Sbjct: 569 GTIGLTLAHRVGMVIGIEMNASAVADAERNATINGISNCKFICSKAEDVMSSLLKQYLDV 628

Query: 673 LREED----EHASEGSNKEITIAEEKDSSRDNVPENEGCSGQDPENDIADSNCPEGSGK- 727
            + E+     +A++  NK+I   EE  +S                  +AD N P  + + 
Sbjct: 629 TQMEEAKPLSNANDDLNKQIPSTEEMTNSE----------------HVADQNLPPSNTQV 672

Query: 728 -EPQSQLQKDCTS-EGNSLAQP-FKNVVAIVDPPRGGLHPTVIKILRTHARLQRLLHI 782
            E Q   QKD +S E     +P FKNVVAIVDPPR GLHP VIK LRTH RL+RL++I
Sbjct: 673 EELQDNEQKDSSSLEPEKTTKPQFKNVVAIVDPPRSGLHPAVIKALRTHPRLKRLVYI 730

Arabidopsis thaliana (taxid: 3702)
>sp|Q8IZ69|TRM2A_HUMAN tRNA (uracil-5-)-methyltransferase homolog A OS=Homo sapiens GN=TRMT2A PE=1 SV=2 Back     alignment and function description
>sp|Q96GJ1|TRM2_HUMAN tRNA (uracil(54)-C(5))-methyltransferase homolog OS=Homo sapiens GN=TRMT2B PE=2 SV=1 Back     alignment and function description
>sp|Q5RFM7|TRM2_PONAB tRNA (uracil(54)-C(5))-methyltransferase homolog OS=Pongo abelii GN=TRMT2B PE=2 SV=1 Back     alignment and function description
>sp|Q8BQJ6|TRM2_MOUSE tRNA (uracil(54)-C(5))-methyltransferase homolog OS=Mus musculus GN=Trmt2b PE=2 SV=1 Back     alignment and function description
>sp|Q8BNV1|TRM2A_MOUSE tRNA (uracil-5-)-methyltransferase homolog A OS=Mus musculus GN=Trmt2a PE=2 SV=1 Back     alignment and function description
>sp|A4QP75|TRM2B_DANRE tRNA (uracil(54)-C(5))-methyltransferase homolog-B OS=Danio rerio GN=trmt2b PE=2 SV=2 Back     alignment and function description
>sp|Q74I68|Y1698_LACJO Uncharacterized RNA methyltransferase LJ_1698 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=LJ_1698 PE=3 SV=1 Back     alignment and function description
>sp|Q8R918|Y1812_THETN Uncharacterized RNA methyltransferase TTE1812 OS=Thermoanaerobacter tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1812 PE=3 SV=1 Back     alignment and function description
>sp|Q8DUV4|Y788_STRMU Uncharacterized RNA methyltransferase SMU_788 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=SMU_788 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query783
359478697843 PREDICTED: zinc finger CCCH domain-conta 0.960 0.892 0.644 0.0
224106744830 predicted protein [Populus trichocarpa] 0.936 0.883 0.665 0.0
255578870863 RNA m5u methyltransferase, putative [Ric 0.886 0.804 0.665 0.0
297746249788 unnamed protein product [Vitis vinifera] 0.891 0.885 0.626 0.0
356544604 888 PREDICTED: zinc finger CCCH domain-conta 0.919 0.810 0.593 0.0
356541487833 PREDICTED: zinc finger CCCH domain-conta 0.901 0.847 0.611 0.0
449502491 889 PREDICTED: zinc finger CCCH domain-conta 0.945 0.832 0.585 0.0
449456002 889 PREDICTED: zinc finger CCCH domain-conta 0.946 0.833 0.582 0.0
357472221850 Zinc finger CCCH domain-containing prote 0.909 0.837 0.599 0.0
30683900809 zinc finger CCCH domain-containing prote 0.871 0.843 0.552 0.0
>gi|359478697|ref|XP_002282314.2| PREDICTED: zinc finger CCCH domain-containing protein 24-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  974 bits (2519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/794 (64%), Positives = 598/794 (75%), Gaps = 42/794 (5%)

Query: 1   MASFP------TETLNLPPPINGQDSTSHNEPLQNADDEQIQPSIPQSTDDVTTTAAEKR 54
           MAS P       +TLN  P ING D+     P ++  DE+++PS+PQSTD + +   EKR
Sbjct: 1   MASSPEDQTSAKQTLN--PSINGNDAPC--PPQEHVGDEELKPSVPQSTDVIES--GEKR 54

Query: 55  KREDVATEGPQSESAEPSPSPSLHPLHKTSLCSYFRK-VGTCCHGSTCRYAHGEEELRIR 113
           KR D A     S++         HPL KTSLCSYFR   G+C HG  CRYAHGEEELR R
Sbjct: 55  KRSDPA----DSDNCR-------HPLWKTSLCSYFRSHSGSCSHGDACRYAHGEEELRQR 103

Query: 114 PDNTWDPTSERAKKARKLEDGDKCEAKEDAVEEVMMTEAVVDGDGDGDQDVELSKCLVHL 173
           PDNTWDPTSERAKK  K E G+KC++KED   +VMMTEAVVD D     D  LSKCL+HL
Sbjct: 104 PDNTWDPTSERAKKLLKSESGEKCDSKED---DVMMTEAVVDDDC---ADPGLSKCLLHL 157

Query: 174 PRKWHSDNLKKFLADHGILYKSAKKKKGMTVGFVKFESVEQLKNAVEELEGISIGNKTLK 233
           P KWHSD L+ FL   G++YKSAKKKKGM +GFV FES EQLKNA+EELEG SIGNK LK
Sbjct: 158 PPKWHSDQLRDFLGQQGVIYKSAKKKKGMMIGFVTFESAEQLKNAMEELEGKSIGNKNLK 217

Query: 234 VANVVPRSFDKNIKSPMTLSGNAKQASESAVPGELAEAHASSNGHEDGNGNDEGLAGDGS 293
           V +++PRSF+K   S + L  + ++  E+A+ G+  +   SS G EDG+   +  A D S
Sbjct: 218 VGDILPRSFEKKNNSALPLHQSTQKNMETALGGDDTDVSMSSFGLEDGDAVCDSSASD-S 276

Query: 294 GLKVKSARDVVTPLAHMSYSVQLEHKKNSIAQMLKKLTRNARKACPNGVSLPEWIMKSRE 353
            LK +SARDV TPLAH++Y+ QLEHKKNS+ Q LKKLTRNARKACPNGVSLPEWI+KSRE
Sbjct: 277 VLKARSARDVATPLAHLTYTDQLEHKKNSLMQTLKKLTRNARKACPNGVSLPEWILKSRE 336

Query: 354 IGGLPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKPTVGFMLGNFREGVTAVEEPVDCPN 413
           IGGLPCK EGIL SPLVNGYRNKCEFSVGYSLQ KPTVGFMLGNFREG+TAVEEP DCPN
Sbjct: 337 IGGLPCKFEGILESPLVNGYRNKCEFSVGYSLQGKPTVGFMLGNFREGITAVEEPADCPN 396

Query: 414 VSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGRSPGKPLDVENLEVNISEV 473
           VS IA +YA+IFQEFLQ S LP+WNRF N+GFWRQLTVREGR PGK       E  ISE 
Sbjct: 397 VSMIARRYATIFQEFLQHSGLPLWNRFNNTGFWRQLTVREGRKPGKA-----AEAKISEP 451

Query: 474 NISEVMLIAQVSSATFDDAVVNSEFERLAKAFAAGATASSPSLPLTALVIQDHQGVSNVA 533
           +ISEV+++ QV S   DD ++N EFERLA+AF  GATASSP LPLTALV+QDH+G+SNVA
Sbjct: 452 SISEVLVMVQVCSKGIDDEILNGEFERLAQAFTMGATASSP-LPLTALVVQDHKGISNVA 510

Query: 534 PADAPLRLLSIPK--ADGEPEESNDVVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYS 591
            ADAPLR L IPK  +D  P+    +VEARIHD ISNLRFCISPTAFFQVNTLAAEKLYS
Sbjct: 511 SADAPLRPLPIPKEGSDSGPDAGGQIVEARIHDYISNLRFCISPTAFFQVNTLAAEKLYS 570

Query: 592 LGGDWADLGPDTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNC 651
           L GDWA LGPDTLLFDVCCGTGTIGLTLAHRVGMV+GIEMNASAVSDA RNAE+NGIKNC
Sbjct: 571 LAGDWAGLGPDTLLFDVCCGTGTIGLTLAHRVGMVVGIEMNASAVSDAQRNAELNGIKNC 630

Query: 652 RFVCAKAEDVMGSLLKDYLNPLREEDE--HASEGSNKEITIAEEKDSSRDNVPENEGCSG 709
           RFVCAKAEDVMGSLLK+YL+  + ++E    S+  +K I+ +E+K  S +N    EG S 
Sbjct: 631 RFVCAKAEDVMGSLLKEYLSVPQRQNEVPDFSQSDDKVISNSEDKMESINNALNPEGSSS 690

Query: 710 QDPENDIADSNCPEGSGKEPQSQLQKDCTS-EGNSLAQPFKNVVAIVDPPRGGLHPTVIK 768
            + E+    S C E   +E +++L   C+S +GN   + FKN VAIVDPPRGGLHP VIK
Sbjct: 691 HELESGKGASGCLENVQRESKNELHNGCSSKDGNISVRQFKNFVAIVDPPRGGLHPIVIK 750

Query: 769 ILRTHARLQRLLHI 782
            LRTHA L+RL++I
Sbjct: 751 ALRTHACLRRLVYI 764

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106744|ref|XP_002314271.1| predicted protein [Populus trichocarpa] gi|222850679|gb|EEE88226.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255578870|ref|XP_002530289.1| RNA m5u methyltransferase, putative [Ricinus communis] gi|223530187|gb|EEF32096.1| RNA m5u methyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297746249|emb|CBI16305.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356544604|ref|XP_003540739.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like [Glycine max] Back     alignment and taxonomy information
>gi|356541487|ref|XP_003539207.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like [Glycine max] Back     alignment and taxonomy information
>gi|449502491|ref|XP_004161655.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449456002|ref|XP_004145739.1| PREDICTED: zinc finger CCCH domain-containing protein 24-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|357472221|ref|XP_003606395.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355507450|gb|AES88592.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|30683900|ref|NP_180412.2| zinc finger CCCH domain-containing protein 24 [Arabidopsis thaliana] gi|75154217|sp|Q8L7S3.1|C3H24_ARATH RecName: Full=Zinc finger CCCH domain-containing protein 24; Short=AtC3H24 gi|22135822|gb|AAM91097.1| At2g28450/T1B3.3 [Arabidopsis thaliana] gi|25090447|gb|AAN72304.1| At2g28450/T1B3.3 [Arabidopsis thaliana] gi|330253030|gb|AEC08124.1| zinc finger CCCH domain-containing protein 24 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query783
TAIR|locus:2056553809 AT2G28450 [Arabidopsis thalian 0.598 0.579 0.622 3.5e-202
ZFIN|ZDB-GENE-030131-6876619 trmt2a "trm2 tRNA methyltransf 0.145 0.184 0.535 9.1e-54
DICTYBASE|DDB_G0293244646 DDB_G0293244 "tRNA (uracil-5-) 0.172 0.208 0.429 3.4e-53
UNIPROTKB|F1P0L5615 TRMT2A "Uncharacterized protei 0.134 0.170 0.523 1.1e-52
UNIPROTKB|F1PQ26626 TRMT2A "Uncharacterized protei 0.153 0.191 0.512 8.1e-48
UNIPROTKB|Q8IZ69625 TRMT2A "tRNA (uracil-5-)-methy 0.153 0.192 0.495 1.4e-47
UNIPROTKB|F1RHM9620 TRMT2A "Uncharacterized protei 0.154 0.195 0.467 3.2e-45
UNIPROTKB|F1M569614 Trmt2a "Protein Trmt2a" [Rattu 0.154 0.197 0.475 9.4e-45
RGD|1310418615 Trmt2a "tRNA methyltransferase 0.154 0.196 0.475 9.5e-45
UNIPROTKB|D4A993627 Trmt2a "Protein Trmt2a" [Rattu 0.154 0.192 0.475 1.1e-44
TAIR|locus:2056553 AT2G28450 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1490 (529.6 bits), Expect = 3.5e-202, Sum P(2) = 3.5e-202
 Identities = 307/493 (62%), Positives = 362/493 (73%)

Query:   297 VKSARDVVTPLAHMSYSVQLEHKKNSIAQMLKKLTRNARKACPNGVSLPEWIMKSREIGG 356
             VKSARD VTPLA++SY+ QLE KK SI QMLKKL RNARKACPNG SLP+W++ SR+ GG
Sbjct:   255 VKSARDAVTPLAYLSYADQLEQKKTSIGQMLKKLARNARKACPNGNSLPQWVLTSRDRGG 314

Query:   357 LPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKPTVGFMLGNFREGVTAVEEPVDCPNVSE 416
             L C LEGI+ SP+ NGYRNKCEFSVG SLQ KPTVGF LG+F  GVTAVEEPVDCPNVS+
Sbjct:   315 LACNLEGIIESPITNGYRNKCEFSVGLSLQGKPTVGFSLGSFCAGVTAVEEPVDCPNVSK 374

Query:   417 IACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGRSPGKPLDVENLEVNISEVNIS 476
             IA +YASIFQ+F++ S   VWNRF++SGFWRQLTVREGR PG      N E  I+   I+
Sbjct:   375 IASQYASIFQKFIENSKFQVWNRFQHSGFWRQLTVREGRKPGV---FSNDEDAITR--IA 429

Query:   477 EVMLIAQVSSATFDDAVVNSEFERLXXXXXXXXXXSSPSLPLTALVIQDHQGVSNVAPAD 536
             EVML+ QV     D+A V +EFE L          SSP+LPLT LV+Q+H G+SNVAP D
Sbjct:   430 EVMLMVQVCLTGSDEAEVATEFEELAKAFAEGARASSPTLPLTVLVVQNHSGISNVAPPD 489

Query:   537 APLRLLSIPKAD-GEPEE--SNDVVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLG 593
             APL++L+IP +D G  +E  +N + EARIHD I+NLRF ISPTAFFQVNT+ AEKLYS+ 
Sbjct:   490 APLQVLAIPISDNGTDQEQTTNVLTEARIHDHINNLRFSISPTAFFQVNTVTAEKLYSIA 549

Query:   594 GDWADLGPDTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRF 653
             GDWADLGPDTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAV+DA RNA INGI NC+F
Sbjct:   550 GDWADLGPDTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAVADAERNATINGISNCKF 609

Query:   654 VCAKAEDVMGSLLKDYLNPLREEDEHASEGSNKEITIAEEKDSSRDNVPENEGCSGQDPE 713
             +C+KAEDVM SLLK YL+  + E+      +N         D     +P  E  +  +  
Sbjct:   610 ICSKAEDVMSSLLKQYLDVTQMEEAKPLSNAN---------DDLNKQIPSTEEMTNSE-- 658

Query:   714 NDIADSNCPEGSGK--EPQSQLQKDCTS-EGNSLAQP-FKNVVAIVDPPRGGLHPTVIKI 769
               +AD N P  + +  E Q   QKD +S E     +P FKNVVAIVDPPR GLHP VIK 
Sbjct:   659 -HVADQNLPPSNTQVEELQDNEQKDSSSLEPEKTTKPQFKNVVAIVDPPRSGLHPAVIKA 717

Query:   770 LRTHARLQRLLHI 782
             LRTH RL+RL++I
Sbjct:   718 LRTHPRLKRLVYI 730
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006396 "RNA processing" evidence=IEA
GO:0008173 "RNA methyltransferase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0000741 "karyogamy" evidence=RCA
GO:0006606 "protein import into nucleus" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
ZFIN|ZDB-GENE-030131-6876 trmt2a "trm2 tRNA methyltransferase 2 homolog A (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0293244 DDB_G0293244 "tRNA (uracil-5-)-methyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0L5 TRMT2A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PQ26 TRMT2A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IZ69 TRMT2A "tRNA (uracil-5-)-methyltransferase homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RHM9 TRMT2A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1M569 Trmt2a "Protein Trmt2a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1310418 Trmt2a "tRNA methyltransferase 2 homolog A (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A993 Trmt2a "Protein Trmt2a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8L7S3C3H24_ARATHNo assigned EC number0.55260.87100.8430yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query783
COG2265432 COG2265, TrmA, SAM-dependent methyltransferases re 8e-42
TIGR00479431 TIGR00479, rumA, 23S rRNA (uracil-5-)-methyltransf 6e-27
PRK03522315 PRK03522, rumB, 23S rRNA methyluridine methyltrans 5e-12
TIGR02085374 TIGR02085, meth_trns_rumB, 23S rRNA (uracil-5-)-me 1e-10
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 4e-10
PRK13168443 PRK13168, rumA, 23S rRNA m(5)U1939 methyltransfera 3e-09
TIGR03534251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) met 2e-08
COG2890280 COG2890, HemK, Methylase of polypeptide chain rele 2e-07
COG2242187 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme 3e-07
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-06
pfam0064227 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t 2e-06
smart0036073 smart00360, RRM, RNA recognition motif 2e-06
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-depen 2e-06
PRK09328275 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-meth 3e-06
pfam12847104 pfam12847, Methyltransf_18, Methyltransferase doma 2e-05
pfam0007670 pfam00076, RRM_1, RNA recognition motif 3e-05
pfam05175170 pfam05175, MTS, Methyltransferase small domain 5e-05
pfam1364997 pfam13649, Methyltransf_25, Methyltransferase doma 1e-04
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Pr 1e-04
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-04
TIGR02469124 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransfer 2e-04
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 2e-04
pfam01209233 pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransf 2e-04
cd1243979 cd12439, RRM_TRMT2A, RNA recognition motif in tRNA 3e-04
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 3e-04
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 5e-04
smart0035627 smart00356, ZnF_C3H1, zinc finger 5e-04
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 5e-04
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 6e-04
PRK00216239 PRK00216, ubiE, ubiquinone/menaquinone biosynthesi 8e-04
TIGR00536284 TIGR00536, hemK_fam, HemK family putative methylas 0.001
PRK05031362 PRK05031, PRK05031, tRNA (uracil-5-)-methyltransfe 0.001
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 0.001
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 0.001
pfam1389356 pfam13893, RRM_5, RNA recognition motif 0.002
COG4123248 COG4123, COG4123, Predicted O-methyltransferase [G 0.002
pfam05958353 pfam05958, tRNA_U5-meth_tr, tRNA (Uracil-5-)-methy 0.002
TIGR02143353 TIGR02143, trmA_only, tRNA (uracil-5-)-methyltrans 0.002
COG2813300 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Trans 0.003
TIGR01983224 TIGR01983, UbiG, ubiquinone biosynthesis O-methylt 0.003
COG2226238 COG2226, UbiE, Methylase involved in ubiquinone/me 0.003
>gnl|CDD|225174 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  158 bits (401), Expect = 8e-42
 Identities = 96/363 (26%), Positives = 146/363 (40%), Gaps = 81/363 (22%)

Query: 307 LAHMSYSVQLEHKKNSIAQMLKKLTRNARKACPNGVSLPEWIMKSREIGGLPCKLEGILG 366
           L H+SY  QLE K+  + ++LK+                        IGG   +++  +G
Sbjct: 80  LQHLSYEAQLEFKREQLKELLKR------------------------IGGSEVEIDPTVG 115

Query: 367 SPLVNGYRNKCEFSVGYSLQAKPTVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQ 426
                GYRN+  FSV  S + +   GF    FR+G   + +  +CP     + +   + +
Sbjct: 116 MSPPWGYRNRARFSVRGSGKGQLLAGF----FRQGSHEIVDIDECPVFPPRSNEILPLLR 171

Query: 427 EFLQQSDLPVWNRFKNSGFWRQLTVREGRSPGKPLDVENLEVNISEVNISEVMLIAQVSS 486
           E L +  LP +N  K  G  R + +REG+                     EVM+      
Sbjct: 172 ELLAKLGLPPYNEKKKKGILRLIVLREGQ---------------------EVMVR----L 206

Query: 487 ATFDDAVVNSEFERLAKAFAAGATASSPSLPLTALVIQDHQGVSNVAPADAPLRLLSIPK 546
            T     +      L +AF                  +    V N+  A   +       
Sbjct: 207 VTKHLPELEQALRELLEAFP-----------------EIKGIVQNINRAKTNVI------ 243

Query: 547 ADGEPEESNDVVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLF 606
            +G+ E +   +E+        + F ISP +FFQVN   AEKLY    +W +L     + 
Sbjct: 244 -EGDEEITLYGLESIREG----VSFQISPRSFFQVNPAVAEKLYETALEWLELAGGERVL 298

Query: 607 DVCCGTGTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDVMGSLL 666
           D+ CG GT GL LA RV  V G+E++  AV  A  NA  NGI N  F+   AE+   +  
Sbjct: 299 DLYCGVGTFGLPLAKRVKKVHGVEISPEAVEAAQENAAANGIDNVEFIAGDAEEFTPAWW 358

Query: 667 KDY 669
           + Y
Sbjct: 359 EGY 361

Length = 432
>gnl|CDD|129571 TIGR00479, rumA, 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>gnl|CDD|235128 PRK03522, rumB, 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|131140 TIGR02085, meth_trns_rumB, 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|237291 PRK13168, rumA, 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|234248 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>gnl|CDD|225443 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|225151 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|236467 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|203189 pfam05175, MTS, Methyltransferase small domain Back     alignment and domain information
>gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|233880 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|110227 pfam01209, Ubie_methyltran, ubiE/COQ5 methyltransferase family Back     alignment and domain information
>gnl|CDD|240885 cd12439, RRM_TRMT2A, RNA recognition motif in tRNA (uracil-5-)-methyltransferase homolog A (TRMT2A) and similar proteins Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|234689 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|129627 TIGR00536, hemK_fam, HemK family putative methylases Back     alignment and domain information
>gnl|CDD|235332 PRK05031, PRK05031, tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|226608 COG4123, COG4123, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|114667 pfam05958, tRNA_U5-meth_tr, tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>gnl|CDD|131198 TIGR02143, trmA_only, tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>gnl|CDD|225370 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|233668 TIGR01983, UbiG, ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>gnl|CDD|225136 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 783
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 100.0
COG2265432 TrmA SAM-dependent methyltransferases related to t 100.0
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 100.0
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 100.0
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 100.0
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 100.0
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 100.0
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 100.0
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 100.0
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 99.64
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 99.52
PLN03213 759 repressor of silencing 3; Provisional 99.41
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.39
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.38
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.36
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.35
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 99.31
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.3
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.28
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.28
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 99.25
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.25
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.25
COG2890280 HemK Methylase of polypeptide chain release factor 99.24
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.21
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.19
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.17
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.17
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.16
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.15
COG0742187 N6-adenine-specific methylase [DNA replication, re 99.13
COG2263198 Predicted RNA methylase [Translation, ribosomal st 99.13
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.12
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 99.12
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 99.12
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.11
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 99.1
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 99.08
PLN03120260 nucleic acid binding protein; Provisional 99.05
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.05
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.04
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 99.03
KOG0122270 consensus Translation initiation factor 3, subunit 99.02
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 99.01
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.0
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.99
PRK14902444 16S rRNA methyltransferase B; Provisional 98.98
PLN02672 1082 methionine S-methyltransferase 98.97
PRK14901434 16S rRNA methyltransferase B; Provisional 98.97
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 98.97
TIGR01645612 half-pint poly-U binding splicing factor, half-pin 98.96
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.96
smart0036272 RRM_2 RNA recognition motif. 98.95
COG4123248 Predicted O-methyltransferase [General function pr 98.94
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.94
smart0036071 RRM RNA recognition motif. 98.91
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.89
PTZ00338294 dimethyladenosine transferase-like protein; Provis 98.89
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.89
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.88
PRK14903431 16S rRNA methyltransferase B; Provisional 98.87
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.87
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.87
PRK07402196 precorrin-6B methylase; Provisional 98.87
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 98.86
PRK14967223 putative methyltransferase; Provisional 98.85
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 98.85
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 98.85
PLN03121243 nucleic acid binding protein; Provisional 98.84
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 98.84
KOG2904328 consensus Predicted methyltransferase [General fun 98.83
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 98.82
PRK10901427 16S rRNA methyltransferase B; Provisional 98.81
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.81
PRK14904445 16S rRNA methyltransferase B; Provisional 98.81
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.81
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.79
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.79
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.78
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.78
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.78
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.77
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 98.77
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 98.76
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.76
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.75
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.75
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.74
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.74
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 98.74
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 98.74
COG2520341 Predicted methyltransferase [General function pred 98.73
KOG0108435 consensus mRNA cleavage and polyadenylation factor 98.72
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 98.72
KOG3420185 consensus Predicted RNA methylase [Translation, ri 98.71
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.71
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.7
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.69
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.68
smart0036170 RRM_1 RNA recognition motif. 98.67
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 98.65
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.64
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 98.64
KOG4207256 consensus Predicted splicing factor, SR protein su 98.64
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.63
PRK12335287 tellurite resistance protein TehB; Provisional 98.62
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 98.61
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.61
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 98.61
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.6
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 98.6
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.6
PRK11207197 tellurite resistance protein TehB; Provisional 98.59
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 98.59
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.59
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.59
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 98.57
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 98.57
KOG2730263 consensus Methylase [General function prediction o 98.56
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.55
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 98.55
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 98.55
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 98.54
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.54
PRK14968188 putative methyltransferase; Provisional 98.53
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 98.52
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 98.52
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.51
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 98.5
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.5
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.5
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 98.47
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 98.46
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 98.46
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.45
KOG0123369 consensus Polyadenylate-binding protein (RRM super 98.45
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.44
PLN02244340 tocopherol O-methyltransferase 98.44
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.43
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.41
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.39
KOG0114124 consensus Predicted RNA-binding protein (RRM super 98.38
COG1041347 Predicted DNA modification methylase [DNA replicat 98.38
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 98.37
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 98.37
PHA03412241 putative methyltransferase; Provisional 98.36
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 98.36
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 98.36
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.36
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.36
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.35
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.34
KOG0126219 consensus Predicted RNA-binding protein (RRM super 98.34
PLN02585315 magnesium protoporphyrin IX methyltransferase 98.33
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 98.32
PHA03411279 putative methyltransferase; Provisional 98.32
PLN02476278 O-methyltransferase 98.32
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.31
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.3
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.3
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.3
PRK10742250 putative methyltransferase; Provisional 98.28
KOG0121153 consensus Nuclear cap-binding protein complex, sub 98.27
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.27
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.26
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 98.26
PLN02233261 ubiquinone biosynthesis methyltransferase 98.25
PRK04457262 spermidine synthase; Provisional 98.24
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 98.23
PRK04266226 fibrillarin; Provisional 98.22
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.2
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.18
KOG0123369 consensus Polyadenylate-binding protein (RRM super 98.18
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.14
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.14
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.12
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.12
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.11
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 98.11
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 98.1
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.08
KOG1271227 consensus Methyltransferases [General function pre 98.07
KOG1270282 consensus Methyltransferases [Coenzyme transport a 98.07
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.07
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.04
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.04
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 98.04
PRK10258251 biotin biosynthesis protein BioC; Provisional 97.98
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 97.98
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 97.97
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 97.97
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 97.96
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 97.95
PRK00811283 spermidine synthase; Provisional 97.93
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 97.92
TIGR00438188 rrmJ cell division protein FtsJ. 97.92
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 97.92
COG4076252 Predicted RNA methylase [General function predicti 97.91
PRK03612521 spermidine synthase; Provisional 97.91
COG2521287 Predicted archaeal methyltransferase [General func 97.9
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.9
TIGR00452314 methyltransferase, putative. Known examples to dat 97.89
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 97.89
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 97.89
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 97.88
PRK08317241 hypothetical protein; Provisional 97.87
PLN03075296 nicotianamine synthase; Provisional 97.86
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 97.86
PLN02336 475 phosphoethanolamine N-methyltransferase 97.86
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 97.86
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 97.85
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 97.85
PLN02366308 spermidine synthase 97.84
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 97.83
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 97.83
PRK01581374 speE spermidine synthase; Validated 97.83
PLN02336475 phosphoethanolamine N-methyltransferase 97.82
PRK13255218 thiopurine S-methyltransferase; Reviewed 97.82
TIGR03438301 probable methyltransferase. This model represents 97.82
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 97.81
PRK05785226 hypothetical protein; Provisional 97.81
smart0035627 ZnF_C3H1 zinc finger. 97.8
KOG1457284 consensus RNA binding protein (contains RRM repeat 97.78
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 97.78
PRK04148134 hypothetical protein; Provisional 97.77
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.77
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 97.77
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 97.75
PTZ00146293 fibrillarin; Provisional 97.75
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 97.75
COG4106257 Tam Trans-aconitate methyltransferase [General fun 97.75
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 97.73
KOG1499 346 consensus Protein arginine N-methyltransferase PRM 97.73
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 97.71
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 97.71
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 97.69
PRK06202232 hypothetical protein; Provisional 97.68
PLN02490340 MPBQ/MSBQ methyltransferase 97.68
KOG0533243 consensus RRM motif-containing protein [RNA proces 97.65
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 97.65
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 97.65
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 97.65
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 97.64
PRK06922677 hypothetical protein; Provisional 97.64
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 97.63
KOG4661940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 97.61
PLN02589247 caffeoyl-CoA O-methyltransferase 97.6
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 97.58
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 97.57
KOG0226290 consensus RNA-binding proteins [General function p 97.57
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.55
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 97.54
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 97.51
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 97.5
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 97.49
COG4122219 Predicted O-methyltransferase [General function pr 97.46
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 97.45
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 97.44
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 97.41
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 97.4
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 97.39
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 97.34
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.32
PF13679141 Methyltransf_32: Methyltransferase domain 97.31
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 97.29
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 97.27
KOG1227351 consensus Putative methyltransferase [General func 97.24
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 97.23
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 97.23
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 97.23
COG4976287 Predicted methyltransferase (contains TPR repeat) 97.23
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 97.22
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 97.18
PRK13256226 thiopurine S-methyltransferase; Reviewed 97.15
KOG0151877 consensus Predicted splicing regulator, contains R 97.11
KOG2078495 consensus tRNA modification enzyme [RNA processing 97.1
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 97.1
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 97.05
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 97.05
PLN02823336 spermine synthase 96.97
KOG1548382 consensus Transcription elongation factor TAT-SF1 96.91
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 96.86
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 96.84
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 96.83
COG3897218 Predicted methyltransferase [General function pred 96.76
KOG1663237 consensus O-methyltransferase [Secondary metabolit 96.54
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 96.53
PRK11524284 putative methyltransferase; Provisional 96.5
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 96.48
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 96.45
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 96.44
KOG2899288 consensus Predicted methyltransferase [General fun 96.42
KOG2185486 consensus Predicted RNA-processing protein, contai 96.4
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 96.4
TIGR00006 305 S-adenosyl-methyltransferase MraW. Genetics paper 96.37
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 96.37
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 96.3
KOG3010261 consensus Methyltransferase [General function pred 96.26
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 96.23
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 96.22
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 96.2
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 96.2
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 96.18
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 96.1
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 96.08
PRK13699227 putative methylase; Provisional 96.07
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 95.98
KOG4300252 consensus Predicted methyltransferase [General fun 95.9
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 95.84
KOG1457284 consensus RNA binding protein (contains RRM repeat 95.81
KOG4211510 consensus Splicing factor hnRNP-F and related RNA- 95.77
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 95.69
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 95.66
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 95.63
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 95.58
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 95.52
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 95.51
COG0421282 SpeE Spermidine synthase [Amino acid transport and 95.4
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 95.29
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 95.27
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 95.04
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 95.03
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 95.0
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 94.77
KOG1995351 consensus Conserved Zn-finger protein [General fun 94.72
PHA01634156 hypothetical protein 94.66
KOG2671421 consensus Putative RNA methylase [Replication, rec 94.66
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 94.6
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 94.59
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 94.56
KOG1548382 consensus Transcription elongation factor TAT-SF1 94.4
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 94.3
COG5175480 MOT2 Transcriptional repressor [Transcription] 94.15
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 94.14
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 94.0
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 93.85
KOG4660549 consensus Protein Mei2, essential for commitment t 93.8
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 93.79
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 93.68
KOG4058199 consensus Uncharacterized conserved protein [Funct 93.52
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 93.41
KOG2361264 consensus Predicted methyltransferase [General fun 93.3
KOG3152278 consensus TBP-binding protein, activator of basal 93.3
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 93.23
KOG2360413 consensus Proliferation-associated nucleolar prote 93.16
COG0275 314 Predicted S-adenosylmethionine-dependent methyltra 93.14
KOG1501 636 consensus Arginine N-methyltransferase [General fu 92.99
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 92.96
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 92.5
TIGR00675 315 dcm DNA-methyltransferase (dcm). All proteins in t 92.47
PF07091251 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 92.19
KOG2314698 consensus Translation initiation factor 3, subunit 92.16
COG4262508 Predicted spermidine synthase with an N-terminal m 91.97
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 91.66
KOG4210285 consensus Nuclear localization sequence binding pr 91.62
KOG3115249 consensus Methyltransferase-like protein [General 91.54
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 91.44
PF01795 310 Methyltransf_5: MraW methylase family; InterPro: I 91.42
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 91.35
KOG1595528 consensus CCCH-type Zn-finger protein [General fun 90.85
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 90.82
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 90.81
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 90.75
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 90.73
COG2384226 Predicted SAM-dependent methyltransferase [General 90.21
KOG1763343 consensus Uncharacterized conserved protein, conta 89.8
COG0863302 DNA modification methylase [DNA replication, recom 89.69
COG0286 489 HsdM Type I restriction-modification system methyl 89.34
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 89.29
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 89.17
COG1568354 Predicted methyltransferases [General function pre 89.11
COG2961279 ComJ Protein involved in catabolism of external DN 88.95
PRK00536262 speE spermidine synthase; Provisional 88.89
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 88.79
COG5252299 Uncharacterized conserved protein, contains CCCH-t 88.7
PRK10458 467 DNA cytosine methylase; Provisional 88.27
PF02086260 MethyltransfD12: D12 class N6 adenine-specific DNA 88.07
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 87.97
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 87.53
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 87.45
KOG1040325 consensus Polyadenylation factor I complex, subuni 87.05
KOG1595528 consensus CCCH-type Zn-finger protein [General fun 87.01
PF04378245 RsmJ: Ribosomal RNA small subunit methyltransferas 86.74
PRK10611287 chemotaxis methyltransferase CheR; Provisional 86.7
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 86.2
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 86.01
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 84.84
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 84.61
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, 84.48
PF07279218 DUF1442: Protein of unknown function (DUF1442); In 84.43
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 84.18
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 84.09
KOG4660549 consensus Protein Mei2, essential for commitment t 83.97
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 83.57
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 83.25
KOG2494331 consensus C3H1-type Zn-finger protein [Transcripti 82.42
KOG2591684 consensus c-Mpl binding protein, contains La domai 82.34
KOG0821326 consensus Predicted ribosomal RNA adenine dimethyl 81.97
KOG1253 525 consensus tRNA methyltransferase [Translation, rib 81.96
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 81.82
KOG2651 476 consensus rRNA adenine N-6-methyltransferase [RNA 81.55
PF07757112 AdoMet_MTase: Predicted AdoMet-dependent methyltra 81.55
COG5152259 Uncharacterized conserved protein, contains RING a 81.19
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 80.73
KOG0129520 consensus Predicted RNA-binding protein (RRM super 80.32
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=4.9e-69  Score=592.91  Aligned_cols=459  Identities=38%  Similarity=0.536  Sum_probs=375.5

Q ss_pred             EEEeCCCcccCHHHHHHHhhhccceee-EeeccCCccEEEEEeCCHHHHHHHHHHHcCCccCCceeEEEecCCCCccccc
Q 003969          168 KCLVHLPRKWHSDNLKKFLADHGILYK-SAKKKKGMTVGFVKFESVEQLKNAVEELEGISIGNKTLKVANVVPRSFDKNI  246 (783)
Q Consensus       168 i~V~nLp~~~~~~~Lkklf~~~~v~~~-~i~~~r~~gfgFVtF~s~Eea~kAIe~LnG~~~~Gr~L~V~~A~pr~~~k~~  246 (783)
                      +-..++|.......+++-+........ +.+......+++++|++++.+.+|+..++|..|+|..++|..+......+.+
T Consensus        28 ~~~e~~~~~~~q~~~~k~~~~~~~~~~s~tk~~~~~~~~~~~~et~~~~~ka~~~v~g~~~k~~~~~~~~~~~~~~~~~~  107 (534)
T KOG2187|consen   28 ISIEMIPTFIGQKQLNKVLLKILRDVKSKTKLPKMPKYAYVTFETPSDAGKAINLVDGLLYKGFILRVQLGATEVGSLRR  107 (534)
T ss_pred             cceeccCchhhhhHHHhhhhhhcccccccCCCCCCCCceEEEEeccchhhhHHHHHhhhhhhcchhhhhhcccccccccc
Confidence            445566777777777666665422222 2222334589999999999999999999999999999998777554333322


Q ss_pred             CCccccccccccccccCCCchhhhhcccCCCCCCCCCCCCCCCCCCCCccccccccccccCCCCChHHHHHHHHHHHHHH
Q 003969          247 KSPMTLSGNAKQASESAVPGELAEAHASSNGHEDGNGNDEGLAGDGSGLKVKSARDVVTPLAHMSYSVQLEHKKNSIAQM  326 (783)
Q Consensus       247 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vcpLqhl~YeeQL~~K~~~v~~~  326 (783)
                      +.        ..      +|                        ..+....+.++++|+|||.++|.+||+.|++....+
T Consensus       108 ~~--------~~------~~------------------------~~~~~~~r~~~~~Vtpl~~~Sy~~qL~lk~~~~~~v  149 (534)
T KOG2187|consen  108 RK--------SQ------PG------------------------PTEPPQQRTARDVVTPLEYLSYGEQLELKQLSQEAV  149 (534)
T ss_pred             cc--------cC------CC------------------------cCccccchhhhhhcceeeeeccccchhhhhccHHHH
Confidence            11        00      00                        114456677899999999999999999999999999


Q ss_pred             HHHHhhhhhccCCCCCCchhhhhhhcccCCCCccccccccCCCCccceeeEEEEEEeecCCcc-eEeeeccccCCCccee
Q 003969          327 LKKLTRNARKACPNGVSLPEWIMKSREIGGLPCKLEGILGSPLVNGYRNKCEFSVGYSLQAKP-TVGFMLGNFREGVTAV  405 (783)
Q Consensus       327 L~ri~~~~~~~~~~~~~~~~w~~~~~~~~~l~~~l~~Ii~SP~~~gYRNK~eftvg~~~~G~~-~vGF~~g~~~~gs~~V  405 (783)
                      |+++.+.+......   ...|+..  .+....|.|++|+|||.+.||||||+|++|...+|+. ++||++|+|..|.+.+
T Consensus       150 l~kl~~~~~~li~~---kv~~~~~--~~~~~d~~Le~I~pSp~~~~yrnKceFsvg~~~~g~~~~vgf~lg~~~~g~~~~  224 (534)
T KOG2187|consen  150 LQKLERLIGDLIRA---KVAFLGP--QYHLHDRVLEVIIPSPIQNGYRNKCEFSVGQLLDGEDDTVGFVLGRFSKGAFAV  224 (534)
T ss_pred             HHHHHHHHHHHHhh---eeecccc--cchhhcccccccccCccccCchhcceeeccccccCCcCceeeeeeeeecCceEE
Confidence            99988743222111   1123222  2223356899999999999999999999998888997 9999999999999999


Q ss_pred             eCCCCCcCCCHHHHHHHHHHHHHHHhCCCCcccccccCCcceEEEEeecCCCCCCCccccceecccccccceEEEEEEec
Q 003969          406 EEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGRSPGKPLDVENLEVNISEVNISEVMLIAQVS  485 (783)
Q Consensus       406 v~~~~C~iis~~l~~i~~~~~~~l~~s~l~~yd~~~~~G~wR~L~VR~s~~~~~~~~~~~~~~~~~~~~~gevmliv~v~  485 (783)
                      +.+.+|+++++.+..+++.||.|++++++.||+.+.+.||||+|+||+..                   .|..|+|+.+.
T Consensus       225 ~~pvd~~llp~~~~~V~s~~Q~f~R~t~l~P~~~~~~~G~wk~LtVRt~~-------------------~~~~~~il~i~  285 (534)
T KOG2187|consen  225 VAPVDVKLLPEIMSQVASAVQEFYRETKLSPYDDFPKGGFWKQLTVRTEF-------------------RGGAMAILTIH  285 (534)
T ss_pred             eccccccccChHHHHHHHHHHHHHhcCCCccccccCCCCceeeeEEEecc-------------------cCceEEEEEEE
Confidence            99999999999999999999999999999999999999999999999543                   24678888888


Q ss_pred             CCCcchhhhhHHHHHHHHHHHhccccCCCCCCceEEEEEccCCCccccCCCCCceeccCCCCCCCCCccccccccceEEe
Q 003969          486 SATFDDAVVNSEFERLAKAFAAGATASSPSLPLTALVIQDHQGVSNVAPADAPLRLLSIPKADGEPEESNDVVEARIHDS  565 (783)
Q Consensus       486 ~~~l~~~~~~~~~~~L~~~~~~~~~~~~p~~~v~sl~~q~~~~~sn~~~~d~~~~~l~~~~~~g~~~~~~l~G~~~I~E~  565 (783)
                      +..+..+++.++...+.+.|..+++..+   .+..+|||.+.+.++. +.+.++.              ++.|+.+|+|.
T Consensus       286 ~~~l~~e~l~e~~~ki~~~f~~~~~~a~---~l~~l~~q~~~~ts~~-~~~~~~~--------------l~~~~~~I~E~  347 (534)
T KOG2187|consen  286 PCKLATEELTELKKKIEQRFLSGPGFAS---GLRVLYLQESGHTSDG-QEGKPLQ--------------LVGGDPYITES  347 (534)
T ss_pred             eecccHHHHHHHHHHHHHHHhccccccc---ceeEEEEecccccccC-CCCCCeE--------------EEccccEEEee
Confidence            8888877888888889999987665433   2667999998777654 3333332              23478899999


Q ss_pred             eCCeEEEECCCccccCCHHHHHHHHHHHhhhccCCCCCeEEEecCCcCHHHHHHhhhCCEEEEEeCCHHHHHHHHHHHHH
Q 003969          566 ISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEI  645 (783)
Q Consensus       566 i~gl~f~isp~sFfQvN~~~ae~L~~~i~~~l~~~~g~~VLDLgCGtGti~l~LA~~~~~VigVE~s~~AIe~Ak~Na~~  645 (783)
                      |+|++|+|||++|||+|+.+++.||+.|.+|+++..++.+||+|||||+||+++|+.+++|+|||++++||++|++||+.
T Consensus       348 l~~ltF~iSp~AFFQ~Nt~~aevLys~i~e~~~l~~~k~llDv~CGTG~iglala~~~~~ViGvEi~~~aV~dA~~nA~~  427 (534)
T KOG2187|consen  348 LLGLTFRISPGAFFQTNTSAAEVLYSTIGEWAGLPADKTLLDVCCGTGTIGLALARGVKRVIGVEISPDAVEDAEKNAQI  427 (534)
T ss_pred             cCCeEEEECCchhhccCcHHHHHHHHHHHHHhCCCCCcEEEEEeecCCceehhhhccccceeeeecChhhcchhhhcchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCcEEEEEccHHHHHHHHHhhhcCCCcccccccccCCchhhhhhhhccCCCCCCCCCCCCCCCCCCCCccCCCCCCCC
Q 003969          646 NGIKNCRFVCAKAEDVMGSLLKDYLNPLREEDEHASEGSNKEITIAEEKDSSRDNVPENEGCSGQDPENDIADSNCPEGS  725 (783)
Q Consensus       646 ngl~nv~f~~gDaed~l~~l~~~~~d~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  725 (783)
                      ||++|++|++|.+++.++.+.....|                                                      
T Consensus       428 NgisNa~Fi~gqaE~~~~sl~~~~~~------------------------------------------------------  453 (534)
T KOG2187|consen  428 NGISNATFIVGQAEDLFPSLLTPCCD------------------------------------------------------  453 (534)
T ss_pred             cCccceeeeecchhhccchhcccCCC------------------------------------------------------
Confidence            99999999999999998876543210                                                      


Q ss_pred             CCCCccccccccccCCCCCCCCCCceEEEECCCCCCCcHHHHHHHHhccCCCcEEEe
Q 003969          726 GKEPQSQLQKDCTSEGNSLAQPFKNVVAIVDPPRGGLHPTVIKILRTHARLQRLLHI  782 (783)
Q Consensus       726 ~~~~~~~~~~~~~~~~~~~~~~f~~~v~ivDPPR~Gl~~~vi~~lr~~~~~~rlvYV  782 (783)
                                      +      .+.|||+||||.|||..||++||++++++|||||
T Consensus       454 ----------------~------~~~v~iiDPpR~Glh~~~ik~l~~~~~~~rlvyv  488 (534)
T KOG2187|consen  454 ----------------S------ETLVAIIDPPRKGLHMKVIKALRAYKNPRRLVYV  488 (534)
T ss_pred             ----------------C------CceEEEECCCcccccHHHHHHHHhccCccceEEE
Confidence                            0      2369999999999999999999999999999998

>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>KOG1227 consensus Putative methyltransferase [General function prediction only] Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>KOG4058 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG2360 consensus Proliferation-associated nucleolar protein (NOL1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1501 consensus Arginine N-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR00675 dcm DNA-methyltransferase (dcm) Back     alignment and domain information
>PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] Back     alignment and domain information
>COG0863 DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>COG2961 ComJ Protein involved in catabolism of external DNA [General function prediction only] Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK10458 DNA cytosine methylase; Provisional Back     alignment and domain information
>PF02086 MethyltransfD12: D12 class N6 adenine-specific DNA methyltransferase; InterPro: IPR012327 In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF04378 RsmJ: Ribosomal RNA small subunit methyltransferase D, RsmJ; InterPro: IPR007473 This is a bacterial protein of unknown function, possibly secreted Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0821 consensus Predicted ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2651 consensus rRNA adenine N-6-methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query783
2bh2_A433 Crystal Structure Of E. Coli 5-Methyluridine Methyl 3e-10
1uwv_A433 Crystal Structure Of Ruma, The Iron-Sulfur Cluster 6e-10
2vs1_A425 The Crystal Structure Of Pyrococcus Abyssi Trna (Ur 9e-06
2jjq_A425 The Crystal Structure Of Pyrococcus Abyssi Trna (Ur 9e-06
2yxd_A183 Crystal Structure Of Cobalamin Biosynthesis Precorr 9e-04
>pdb|2BH2|A Chain A, Crystal Structure Of E. Coli 5-Methyluridine Methyltransferase Ruma In Complex With Ribosomal Rna Substrate And S-Adenosylhomocysteine. Length = 433 Back     alignment and structure 
Iteration: 1

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 49/91 (53%), Gaps = 1/91 (1%)
Query: 563 HDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLFDVCCGTGTIGLTLAHR 622
           +DS + LR   SP  F QVN    +K+ +   +W D+ P+  + D+ CG G   L LA +
Sbjct: 249 YDS-NGLRLTFSPRDFIQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPLATQ 307
Query: 623 VGMVIGIEMNASAVSDAHRNAEINGIKNCRF 653
              V+G+E   + V    +NA +NG++N  F
Sbjct: 308 AASVVGVEGVPALVEKGQQNARLNGLQNVTF 338
>pdb|1UWV|A Chain A, Crystal Structure Of Ruma, The Iron-Sulfur Cluster Containing E. Coli 23s Ribosomal Rna 5-Methyluridine Methyltransferase Length = 433 Back     alignment and structure
>pdb|2VS1|A Chain A, The Crystal Structure Of Pyrococcus Abyssi Trna (Uracil-54, C5)-Methyltransferase In Complex With S-Adenosyl-L- Homocysteine Length = 425 Back     alignment and structure
>pdb|2JJQ|A Chain A, The Crystal Structure Of Pyrococcus Abyssi Trna (Uracil-54, C5)-Methyltransferase In Complex With S-Adenosyl-L- Homocysteine Length = 425 Back     alignment and structure
>pdb|2YXD|A Chain A, Crystal Structure Of Cobalamin Biosynthesis Precorrin 8w Decarboxylase (Cbit) Length = 183 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query783
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 2e-54
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 1e-42
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 1e-41
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 3e-22
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 2e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
1xxl_A239 YCGJ protein; structural genomics, protein structu 9e-12
1vl5_A260 Unknown conserved protein BH2331; putative methylt 3e-11
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 1e-10
3dh0_A219 SAM dependent methyltransferase; cystal structure, 1e-09
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 1e-09
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 4e-09
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 5e-09
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 3e-08
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 7e-09
3f4k_A257 Putative methyltransferase; structural genomics, P 1e-08
3lpm_A259 Putative methyltransferase; structural genomics, p 1e-08
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 1e-08
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 4e-08
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 9e-08
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 1e-07
3ll7_A 410 Putative methyltransferase; methytransferase, stru 1e-07
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 1e-07
3gu3_A284 Methyltransferase; alpha-beta protein, structural 3e-07
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 3e-07
3ocj_A305 Putative exported protein; structural genomics, PS 3e-07
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 6e-07
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 9e-07
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 1e-06
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 1e-06
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 1e-06
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 2e-06
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 2e-06
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 3e-06
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 3e-06
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 4e-06
2b3t_A276 Protein methyltransferase HEMK; translation termin 5e-06
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 6e-06
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 8e-06
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 8e-06
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 9e-06
1x5o_A114 RNA binding motif, single-stranded interacting pro 9e-06
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 9e-06
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 1e-05
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-05
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-05
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 2e-05
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 2e-05
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 2e-05
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 3e-05
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-05
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 3e-05
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 3e-05
3i9f_A170 Putative type 11 methyltransferase; structural gen 3e-05
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 4e-05
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 4e-05
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 5e-05
2rhk_C72 Cleavage and polyadenylation specificity factor su 5e-05
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 6e-05
3ege_A261 Putative methyltransferase from antibiotic biosyn 6e-05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 6e-05
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 6e-05
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 6e-05
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 9e-05
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-04
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 9e-05
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 1e-04
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-04
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 1e-04
3dtn_A234 Putative methyltransferase MM_2633; structural gen 1e-04
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 2e-04
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 2e-04
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-04
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-04
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 2e-04
3m33_A226 Uncharacterized protein; structural genomics, PSI- 2e-04
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 3e-04
1wzn_A252 SAM-dependent methyltransferase; structural genomi 3e-04
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 3e-04
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-04
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-04
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 4e-04
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 4e-04
1x5p_A97 Negative elongation factor E; structure genomics, 4e-04
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 4e-04
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 4e-04
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-04
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-04
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 5e-04
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 5e-04
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 5e-04
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 8e-04
2dis_A109 Unnamed protein product; structural genomics, RRM 6e-04
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 6e-04
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 7e-04
1vlm_A219 SAM-dependent methyltransferase; possible histamin 7e-04
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 7e-04
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 8e-04
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 8e-04
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 8e-04
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Length = 425 Back     alignment and structure
 Score =  192 bits (491), Expect = 2e-54
 Identities = 70/361 (19%), Positives = 127/361 (35%), Gaps = 104/361 (28%)

Query: 306 PLAHMSYSVQLEHKKNSIAQMLKKLTRNARKACPNGVSLPEWIMKSREIGGLPCKLEGIL 365
            L H++Y  QLE K+  +                            + I G   +   ++
Sbjct: 91  TLQHLNYDYQLEFKRKKL----------------------------KRILGFEVE---VV 119

Query: 366 GSPLVNGYRNKCEFSVGYSLQAKPTVGFMLGNFREG----VTAVEEPVDCPNVSEIACKY 421
            SP + G+RN+ + ++      K  +GF       G    +  ++   +CP   + + + 
Sbjct: 120 PSPKIFGHRNRIDLAIT-----KDGIGF----RERGKWWKIVDID---ECPVFGKTSREA 167

Query: 422 ASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGRSPGKPLDVENLEVNISEVNISEVMLI 481
               +EF+++  + VWN  K+ GF R + +REG+                     EVM+ 
Sbjct: 168 IERLKEFIEEEKISVWNIKKDEGFLRYMVLREGKFTE------------------EVMVN 209

Query: 482 AQVSSATFDDAVVNSEFERLAKAFAAGATASSPSLPLTALVIQDHQGVSNVAPADAPLRL 541
                    D                            ++    ++  S+V+  D  +  
Sbjct: 210 FVTKEGNLPDP------TNYFD--------------FDSIYWSVNRSKSDVSYGD--IER 247

Query: 542 LSIPKADGEPEESNDVVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGP 601
                  G+           I + + ++ + I P +FFQ N+  A  L       ++L  
Sbjct: 248 FW-----GKE---------FIRERLDDVDYLIHPNSFFQTNSYQAVNLVRK---VSELVE 290

Query: 602 DTLLFDVCCGTGTIGLTLAHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDV 661
              + D+  G GT G+ LA R   V G + N  A+  A RN EIN +     V +  E  
Sbjct: 291 GEKILDMYSGVGTFGIYLAKRGFNVKGFDSNEFAIEMARRNVEINNVDAEFEVASDREVS 350

Query: 662 M 662
           +
Sbjct: 351 V 351
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Length = 433 Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Length = 369 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Length = 241 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Length = 183 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Length = 260 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Length = 204 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Length = 185 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Length = 194 Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Length = 410 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Length = 382 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Length = 297 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Length = 279 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Length = 298 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Length = 354 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Length = 276 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Length = 381 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Length = 258 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Length = 336 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Length = 225 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} Length = 204 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Length = 284 Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Length = 72 Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Length = 343 Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Length = 393 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Length = 375 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Length = 226 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Length = 396 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Length = 396 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Length = 218 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Length = 243 Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Length = 258 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query783
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 100.0
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 100.0
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 100.0
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.9
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.89
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.89
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.89
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.64
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.63
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.6
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.57
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.56
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.55
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.53
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.53
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.52
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.52
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.52
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.52
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.5
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.5
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.49
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.49
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.49
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.49
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.49
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.49
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.48
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.48
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.48
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.48
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.48
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.48
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.48
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.48
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.48
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.48
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.48
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.48
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.47
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.47
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.46
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.46
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.46
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.46
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.46
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.46
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.46
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.46
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.46
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.46
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.46
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.45
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.45
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.45
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.45
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.45
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.45
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.45
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.45
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.45
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.45
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.45
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.45
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.45
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.45
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.45
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.45
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.44
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.44
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.43
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.43
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.43
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.43
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.43
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.43
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.43
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.43
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.43
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.43
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.43
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.43
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.42
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.42
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.42
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.42
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.42
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.42
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.42
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 99.42
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.42
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.42
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.42
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.42
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.41
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.41
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.41
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.41
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.41
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.41
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.41
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.41
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.41
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.41
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.41
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.4
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.4
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.4
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.4
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.4
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.4
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.4
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.4
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.4
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.39
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.39
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.39
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.39
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.39
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.39
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.39
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.39
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.39
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.38
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.38
2div_A99 TRNA selenocysteine associated protein; structural 99.38
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.38
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.38
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.38
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.38
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.37
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.37
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.37
2dis_A109 Unnamed protein product; structural genomics, RRM 99.37
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.37
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.37
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.37
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.37
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.37
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.36
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.36
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.36
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.36
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.36
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.36
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.36
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.36
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.35
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.35
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.35
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.35
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.34
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.34
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.34
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.34
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.34
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.33
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.33
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.33
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.33
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.33
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.33
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.33
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.33
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.32
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.32
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.31
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.31
1x5p_A97 Negative elongation factor E; structure genomics, 99.3
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 98.97
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.29
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.29
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.27
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.24
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.24
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.24
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.24
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.23
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.23
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.23
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.23
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.23
3ll7_A 410 Putative methyltransferase; methytransferase, stru 99.23
2h00_A254 Methyltransferase 10 domain containing protein; st 99.22
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.22
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.22
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.22
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.21
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.21
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.2
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.2
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.2
3k6r_A278 Putative transferase PH0793; structural genomics, 99.2
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.2
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.18
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.18
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.17
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.17
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.17
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.16
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.16
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.16
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.15
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 99.15
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.15
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.15
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.15
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.14
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.13
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.13
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.12
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.12
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.12
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 99.11
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.11
1ne2_A200 Hypothetical protein TA1320; structural genomics, 99.1
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.1
3lpm_A259 Putative methyltransferase; structural genomics, p 99.1
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 99.1
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.09
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.09
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.08
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 99.08
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.08
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.08
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.07
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.06
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 99.06
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.06
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.05
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.05
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 99.05
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.05
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.04
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.04
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.04
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.03
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 99.03
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.03
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.02
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.02
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.01
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 99.01
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.0
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.99
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.99
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 98.97
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 98.97
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 98.96
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 98.96
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.96
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 98.95
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 98.95
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.94
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.93
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 98.93
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 98.93
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 98.92
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 98.92
2avd_A229 Catechol-O-methyltransferase; structural genomics, 98.92
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.91
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 98.91
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.91
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.9
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 98.9
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.89
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.88
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 98.87
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.87
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.87
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.87
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.86
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.86
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 98.86
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 98.85
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.84
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.83
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.82
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 98.8
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.79
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 98.79
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 98.78
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.78
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.78
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.78
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.78
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.77
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.76
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.75
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.73
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.72
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.72
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.71
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.71
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 98.71
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 98.7
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.69
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.68
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.68
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.67
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.67
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.67
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 98.67
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 98.66
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 98.66
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.66
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 98.66
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.65
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 98.65
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.65
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 98.64
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.63
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 98.63
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.63
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.62
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 98.61
3fut_A271 Dimethyladenosine transferase; methyltransferase, 98.6
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.6
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.6
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.6
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.6
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.59
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.59
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.59
1vl5_A260 Unknown conserved protein BH2331; putative methylt 98.58
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.58
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.58
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 98.57
2b25_A336 Hypothetical protein; structural genomics, methyl 98.57
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.56
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 98.56
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.56
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.55
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.52
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.52
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.52
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.52
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.51
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.51
3f4k_A257 Putative methyltransferase; structural genomics, P 98.51
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.51
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 98.51
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.49
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.48
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.48
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 98.48
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 98.48
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.48
2o07_A304 Spermidine synthase; structural genomics, structur 98.47
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.46
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.46
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 98.45
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.45
2pt6_A321 Spermidine synthase; transferase, structural genom 98.45
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.45
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.45
2fyt_A340 Protein arginine N-methyltransferase 3; structural 98.43
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.42
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.42
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.42
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.42
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.42
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.41
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.41
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.41
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.4
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.4
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.38
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.37
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.36
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.36
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.36
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.35
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.35
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.35
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.35
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 98.35
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.34
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.34
2i7c_A283 Spermidine synthase; transferase, structural genom 98.33
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 98.33
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.32
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.32
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.31
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.31
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.31
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 98.31
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.31
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.3
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.29
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.29
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.27
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 98.27
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.27
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.26
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.23
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.22
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.22
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.22
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.22
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.21
3gu3_A284 Methyltransferase; alpha-beta protein, structural 98.21
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.21
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.19
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.19
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.19
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.19
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.19
3lcc_A235 Putative methyl chloride transferase; halide methy 98.18
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.18
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.17
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.16
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.15
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.15
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.14
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.14
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.13
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.13
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.12
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 98.12
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.09
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.09
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.08
2zig_A297 TTHA0409, putative modification methylase; methylt 98.07
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 98.07
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.07
2oo3_A283 Protein involved in catabolism of external DNA; st 98.06
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.06
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.06
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.05
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.05
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.05
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.05
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 98.04
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.04
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.04
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 98.04
3ocj_A305 Putative exported protein; structural genomics, PS 98.03
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 98.03
3lkd_A 542 Type I restriction-modification system methyltrans 98.03
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.01
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 97.98
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 97.98
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 97.95
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 97.9
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 97.88
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 97.88
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 97.88
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 97.88
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 97.87
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 97.86
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 97.86
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 97.84
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 97.81
2r3s_A335 Uncharacterized protein; methyltransferase domain, 97.81
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 97.76
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 97.76
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 97.75
2i62_A265 Nicotinamide N-methyltransferase; structural genom 97.73
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 97.69
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 97.68
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 97.67
3khk_A544 Type I restriction-modification system methylation 97.66
3cc8_A230 Putative methyltransferase; structural genomics, j 97.64
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 97.62
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 97.58
1vlm_A219 SAM-dependent methyltransferase; possible histamin 97.57
2cmg_A262 Spermidine synthase; transferase, putrescine amino 97.57
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 97.55
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 97.51
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 97.5
3dp7_A363 SAM-dependent methyltransferase; structural genomi 97.5
3ufb_A 530 Type I restriction-modification system methyltran 97.48
3giw_A277 Protein of unknown function DUF574; rossmann-fold 97.44
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 97.43
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 97.43
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 97.42
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 97.41
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 97.32
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 97.22
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 97.21
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 97.15
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 97.1
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 97.08
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.05
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 97.05
3sso_A419 Methyltransferase; macrolide, natural product, ros 97.04
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 97.03
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 97.03
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 96.98
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 96.96
3ua3_A 745 Protein arginine N-methyltransferase 5; TIM-barrel 96.95
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 96.91
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 96.78
2rhk_C72 Cleavage and polyadenylation specificity factor su 96.76
1i4w_A 353 Mitochondrial replication protein MTF1; mitochondr 96.7
3tka_A 347 Ribosomal RNA small subunit methyltransferase H; H 96.67
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 96.64
2c7p_A 327 Modification methylase HHAI; DNA methyltransferase 96.64
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
Probab=100.00  E-value=1e-44  Score=407.22  Aligned_cols=299  Identities=27%  Similarity=0.442  Sum_probs=243.5

Q ss_pred             ccccccCCCCChHHHHHHHHHHHHHHHHHHhhhhhccCCCCCCchhhhhhhcccCCCCccccccccCCCCccceeeEEEE
Q 003969          301 RDVVTPLAHMSYSVQLEHKKNSIAQMLKKLTRNARKACPNGVSLPEWIMKSREIGGLPCKLEGILGSPLVNGYRNKCEFS  380 (783)
Q Consensus       301 ~~~vcpLqhl~YeeQL~~K~~~v~~~L~ri~~~~~~~~~~~~~~~~w~~~~~~~~~l~~~l~~Ii~SP~~~gYRNK~eft  380 (783)
                      .|+||+||||+|++||++|++    +|+|+++                        +.  + ++++||.+||||||++|+
T Consensus        86 ~CGGC~lqh~~y~~Ql~~K~~----~l~r~~~------------------------~~--~-~~~~s~~~~~YRnk~~~~  134 (425)
T 2jjq_A           86 KCGGCTLQHLNYDYQLEFKRK----KLKRILG------------------------FE--V-EVVPSPKIFGHRNRIDLA  134 (425)
T ss_dssp             ----CTTTTBCHHHHHHHHHH----HHHHHHS------------------------SC--C-EEECCSCSSSCBCEEEEE
T ss_pred             CCCCccCcCCCHHHHHHHHHH----HHHHccC------------------------CC--C-ceecCCCcCCccceEEEE
Confidence            799999999999999999999    7888762                        21  3 688899999999999999


Q ss_pred             EEeecCCcceEeeeccccCCCc-ceeeCCCCCcCCCHHHHHHHHHHHHHHHhCCCCcccccccCCcceEEEEeecCCCCC
Q 003969          381 VGYSLQAKPTVGFMLGNFREGV-TAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGRSPGK  459 (783)
Q Consensus       381 vg~~~~G~~~vGF~~g~~~~gs-~~Vv~~~~C~iis~~l~~i~~~~~~~l~~s~l~~yd~~~~~G~wR~L~VR~s~~~~~  459 (783)
                      |+.   |+  +||+    ..++ |.|+++++|+++++.+++++..+++++...++++|+..++.|+||++++|.+..   
T Consensus       135 v~~---g~--~Gf~----~~~s~~~iv~i~~C~i~~~~~~~~~~~l~~~~~~~~~~~y~~~~~~g~lr~~~vr~~~~---  202 (425)
T 2jjq_A          135 ITK---DG--IGFR----ERGKWWKIVDIDECPVFGKTSREAIERLKEFIEEEKISVWNIKKDEGFLRYMVLREGKF---  202 (425)
T ss_dssp             EET---TE--EEEE----C--CTTSEEECSCBTTTBHHHHHHHHHHHHHHHHHTCCBBBTTTTBCSEEEEEEEECTT---
T ss_pred             ecC---CC--eEEe----eCCCCCcEEECcCCccCCHHHHHHHHHHHHHHHHcCCCccccccCCCcceEEEEEEccC---
Confidence            984   44  8996    6788 999999999999999999999999999999999999999999999999997532   


Q ss_pred             CCccccceecccccccceEEEEEEecCCCcchhhhhHHHHHHHHHHHhccccCCCCCCceEEEEEccCCCccccCCCCCc
Q 003969          460 PLDVENLEVNISEVNISEVMLIAQVSSATFDDAVVNSEFERLAKAFAAGATASSPSLPLTALVIQDHQGVSNVAPADAPL  539 (783)
Q Consensus       460 ~~~~~~~~~~~~~~~~gevmliv~v~~~~l~~~~~~~~~~~L~~~~~~~~~~~~p~~~v~sl~~q~~~~~sn~~~~d~~~  539 (783)
                                     +|++||++.......  ++       | +        ..+  .+.++|++......+...     
T Consensus       203 ---------------~g~~~v~l~~~~~~~--~~-------l-~--------~~~--~~~~i~~~~~~~~~~~~~-----  242 (425)
T 2jjq_A          203 ---------------TEEVMVNFVTKEGNL--PD-------P-T--------NYF--DFDSIYWSVNRSKSDVSY-----  242 (425)
T ss_dssp             ---------------TCCEEEEEEESSSCC--CC-------C-T--------TTC--CCSEEEEEECCSSSCCSC-----
T ss_pred             ---------------CCCEEEEEEeCchhH--HH-------H-h--------hcC--CeeEEEEEcCCCCCceec-----
Confidence                           257898876654311  11       1 0        112  257777764332211110     


Q ss_pred             eeccCCCCCCCCCccccccccceEEeeCCeEEEECCCccccCCHHHHHHHHHHHhhhccCCCCCeEEEecCCcCHHHHHH
Q 003969          540 RLLSIPKADGEPEESNDVVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLFDVCCGTGTIGLTL  619 (783)
Q Consensus       540 ~~l~~~~~~g~~~~~~l~G~~~I~E~i~gl~f~isp~sFfQvN~~~ae~L~~~i~~~l~~~~g~~VLDLgCGtGti~l~L  619 (783)
                               +  ....++|..+++|.++|++|+++|.+|||+|+.+++.|+.++.+   +.++.+|||+|||+|++++.|
T Consensus       243 ---------g--~~~~l~G~~~i~e~~~g~~f~~~~~~F~q~n~~~~e~l~~~~~~---~~~~~~VLDlgcG~G~~sl~l  308 (425)
T 2jjq_A          243 ---------G--DIERFWGKEFIRERLDDVDYLIHPNSFFQTNSYQAVNLVRKVSE---LVEGEKILDMYSGVGTFGIYL  308 (425)
T ss_dssp             ---------C--EEEEEEECSCEEEEETTEEEEECTTSCCCSBHHHHHHHHHHHHH---HCCSSEEEEETCTTTHHHHHH
T ss_pred             ---------c--eEEEEECCCeEEEEECCEEEEEccccccccCHHHHHHHHHHhhc---cCCCCEEEEeeccchHHHHHH
Confidence                     1  22356789999999999999999999999999999999999988   356789999999999999999


Q ss_pred             hhhCCEEEEEeCCHHHHHHHHHHHHHcCCCcEEEEEccHHHHHHHHHhhhcCCCcccccccccCCchhhhhhhhccCCCC
Q 003969          620 AHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDVMGSLLKDYLNPLREEDEHASEGSNKEITIAEEKDSSRD  699 (783)
Q Consensus       620 A~~~~~VigVE~s~~AIe~Ak~Na~~ngl~nv~f~~gDaed~l~~l~~~~~d~p~~~~~~~~~~~~~~~~~~~~~~~~~~  699 (783)
                      |+.+.+|+|||+++.|++.|++|+..|++. ++|+++|+.+++..                                   
T Consensus       309 a~~~~~V~gvD~s~~ai~~A~~n~~~ngl~-v~~~~~d~~~~~~~-----------------------------------  352 (425)
T 2jjq_A          309 AKRGFNVKGFDSNEFAIEMARRNVEINNVD-AEFEVASDREVSVK-----------------------------------  352 (425)
T ss_dssp             HHTTCEEEEEESCHHHHHHHHHHHHHHTCC-EEEEECCTTTCCCT-----------------------------------
T ss_pred             HHcCCEEEEEECCHHHHHHHHHHHHHcCCc-EEEEECChHHcCcc-----------------------------------
Confidence            999899999999999999999999999998 99999998753210                                   


Q ss_pred             CCCCCCCCCCCCCCCCccCCCCCCCCCCCCccccccccccCCCCCCCCCCceEEEECCCCCCCcHHHHHHHHhccCCCcE
Q 003969          700 NVPENEGCSGQDPENDIADSNCPEGSGKEPQSQLQKDCTSEGNSLAQPFKNVVAIVDPPRGGLHPTVIKILRTHARLQRL  779 (783)
Q Consensus       700 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~v~ivDPPR~Gl~~~vi~~lr~~~~~~rl  779 (783)
                                                                     .|  |++|+||||.|+++.++++|+.. ++.++
T Consensus       353 -----------------------------------------------~f--D~Vv~dPPr~g~~~~~~~~l~~l-~p~gi  382 (425)
T 2jjq_A          353 -----------------------------------------------GF--DTVIVDPPRAGLHPRLVKRLNRE-KPGVI  382 (425)
T ss_dssp             -----------------------------------------------TC--SEEEECCCTTCSCHHHHHHHHHH-CCSEE
T ss_pred             -----------------------------------------------CC--CEEEEcCCccchHHHHHHHHHhc-CCCcE
Confidence                                                           14  79999999999999999999986 89999


Q ss_pred             EEe
Q 003969          780 LHI  782 (783)
Q Consensus       780 vYV  782 (783)
                      |||
T Consensus       383 vyv  385 (425)
T 2jjq_A          383 VYV  385 (425)
T ss_dssp             EEE
T ss_pred             EEE
Confidence            998
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 783
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 6e-11
d1rgoa234 g.66.1.1 (A:187-220) Butyrate response factor 2 (T 6e-11
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 7e-11
d1uwva2358 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransf 2e-08
d1uwva2358 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransf 3e-04
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 1e-06
d1wxxa2318 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280 2e-06
d1u2za_406 c.66.1.31 (A:) Catalytic, N-terminal domain of his 1e-05
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-05
d2igta1309 c.66.1.51 (A:1-309) Putative methyltransferase Atu 7e-05
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 7e-05
d1vl5a_231 c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill 7e-05
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-04
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 1e-04
d1xxla_234 c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus 2e-04
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-04
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-04
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-04
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 3e-04
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 3e-04
d2fyta1311 c.66.1.6 (A:238-548) Protein arginine N-methyltran 3e-04
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 4e-04
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 4e-04
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 4e-04
d2as0a2324 c.66.1.51 (A:73-396) Hypothetical protein PH1915, 5e-04
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-04
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 5e-04
d2b25a1324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 5e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 6e-04
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 6e-04
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 8e-04
d2b78a2317 c.66.1.51 (A:69-385) Hypothetical protein SMu776, 0.001
d2frna1260 c.66.1.47 (A:19-278) Hypothetical protein PH0793 { 0.001
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 0.001
d1ne2a_197 c.66.1.32 (A:) Hypothetical protein Ta1320 {Archae 0.002
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 0.002
d1nkva_245 c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric 0.002
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 0.002
d1nw3a_328 c.66.1.31 (A:) Catalytic, N-terminal domain of his 0.002
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 0.003
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 0.003
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 0.003
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 0.003
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 0.004
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure

class: Small proteins
fold: CCCH zinc finger
superfamily: CCCH zinc finger
family: CCCH zinc finger
domain: Tristetraproline (ttp, tis11, nup475)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 55.5 bits (134), Expect = 6e-11
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 82  KTSLCSYFRKVGTCCHGSTCRYAHGEEELR 111
           KT LC  + + G C +G+ C++AHG  ELR
Sbjct: 8   KTELCRTYSESGRCRYGAKCQFAHGLGELR 37
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Length = 358 Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Length = 358 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Length = 318 Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Length = 309 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 324 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Length = 317 Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Length = 260 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 197 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query783
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 100.0
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.62
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.6
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.6
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.59
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.59
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.58
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.57
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.57
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.56
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.56
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.56
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.55
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.55
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.55
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.54
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.54
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.54
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.54
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.53
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.53
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.53
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.52
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.52
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.52
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.52
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.52
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.52
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.52
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.52
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.51
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.51
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.51
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.51
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.51
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.5
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.5
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.5
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.5
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.49
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.49
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.49
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.49
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 99.49
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.49
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.48
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.48
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.48
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.48
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.48
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.47
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.47
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.47
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.47
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.46
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.45
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.45
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.45
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.45
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.45
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.45
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.45
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.44
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.44
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.42
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.42
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.42
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.42
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.42
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.42
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.41
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.41
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.41
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.41
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.4
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.38
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.37
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.37
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.36
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.35
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.35
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.33
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.33
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.32
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.32
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.3
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.29
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.28
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 99.27
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.27
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.26
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.24
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.23
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 99.17
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 99.16
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.16
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.15
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.15
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 99.11
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.1
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.04
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.04
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.01
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 98.97
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 98.96
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.95
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.85
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.85
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.83
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.81
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.79
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.78
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 98.77
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.68
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.68
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 98.67
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 98.65
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.64
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.64
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.62
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.62
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.59
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 98.57
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.56
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.54
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.53
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.51
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.49
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.48
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.48
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.47
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.46
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.42
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.42
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.42
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.4
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 98.39
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 98.37
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.35
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.35
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.33
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.32
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 98.3
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.29
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.29
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.28
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.26
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.25
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.24
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.22
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 98.2
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.18
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.14
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.11
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 98.07
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.04
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.01
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 97.96
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 97.94
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 97.94
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 97.9
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 97.86
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 97.85
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 97.8
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 97.77
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 97.75
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 97.69
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 97.63
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 97.58
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 97.37
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 97.27
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 97.09
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.06
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 97.05
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 97.02
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 96.99
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 96.84
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 96.82
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 96.7
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 96.67
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 96.6
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 96.43
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 96.4
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 96.38
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 96.27
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 96.19
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 95.89
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 95.88
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 95.84
d1dcta_ 324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 95.39
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 95.13
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 94.8
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 94.62
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 94.41
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 94.26
d2c7pa1 327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 93.6
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 93.57
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 92.59
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 92.22
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 86.83
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 86.81
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 86.23
d2fc6a137 Target of EGR1 protein 1, TOE1 {Human (Homo sapien 86.03
d2oo3a1271 Uncharacterized protein LPG1296 {Legionella pneumo 85.21
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 85.09
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 84.64
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 84.49
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 83.2
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: (Uracil-5-)-methyltransferase
domain: rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2.2e-46  Score=407.87  Aligned_cols=301  Identities=21%  Similarity=0.353  Sum_probs=225.5

Q ss_pred             ccccccCCCCChHHHHHHHHHHHHHHHHHHhhhhhccCCCCCCchhhhhhhcccCCCCccccccccCCCCccceeeEEEE
Q 003969          301 RDVVTPLAHMSYSVQLEHKKNSIAQMLKKLTRNARKACPNGVSLPEWIMKSREIGGLPCKLEGILGSPLVNGYRNKCEFS  380 (783)
Q Consensus       301 ~~~vcpLqhl~YeeQL~~K~~~v~~~L~ri~~~~~~~~~~~~~~~~w~~~~~~~~~l~~~l~~Ii~SP~~~gYRNK~eft  380 (783)
                      .|+||+|||++|++||++|++.|.+++++                              .+.+++ ++.+||||||++|+
T Consensus        12 ~CGGC~~qh~~y~~Ql~~K~~~l~~~~~~------------------------------~~~~v~-~~~p~~YR~r~~~~   60 (358)
T d1uwva2          12 VCGGCQQQHASVDLQQRSKSAALARLMKH------------------------------DVSEVI-ADVPWGYRRRARLS   60 (358)
T ss_dssp             TBTTCSCTTBCHHHHHHHHHHHHHHHHTS------------------------------CCCEEE-CCCSSSCBSEEEEE
T ss_pred             cCcCchhcCCCHHHHHHHHHHHHHHhcCc------------------------------ccCccc-CCCCCCCcceEEEE
Confidence            69999999999999999999887665432                              112233 45579999999999


Q ss_pred             EEeec-CCcceEeeeccccCCCcceeeCCCCCcCCCHHHHHHHHHHHHHHHhCCCCcccccccCCcceEEEEeecCCCCC
Q 003969          381 VGYSL-QAKPTVGFMLGNFREGVTAVEEPVDCPNVSEIACKYASIFQEFLQQSDLPVWNRFKNSGFWRQLTVREGRSPGK  459 (783)
Q Consensus       381 vg~~~-~G~~~vGF~~g~~~~gs~~Vv~~~~C~iis~~l~~i~~~~~~~l~~s~l~~yd~~~~~G~wR~L~VR~s~~~~~  459 (783)
                      |++.. .++..+||+    +.++|.|+++++|+++++.+++++..++.++..     |+...+.|.|+   ++.+.    
T Consensus        61 v~~~~~~~~~~~Gf~----~~~s~~iV~i~~C~i~~~~i~~~l~~lr~~l~~-----~~~~~~~~~~~---~~~~~----  124 (358)
T d1uwva2          61 LNYLPKTQQLQMGFR----KAGSSDIVDVKQCPILAPQLEALLPKVRACLGS-----LQAMRHLGHVE---LVQAT----  124 (358)
T ss_dssp             EEEETTTTEEEEEEE----BTTSSCEEECSCCTTBCHHHHHHHHHHHHHHTT-----CGGGGGEEEEE---EEEET----
T ss_pred             eeEecCCCceEEEEE----ecCCceeeeccccccccHHHHHHHHHHHHhhhc-----ccccccceEEE---EEEec----
Confidence            98754 355789996    778999999999999999999999999998764     55555555444   33322    


Q ss_pred             CCccccceecccccccceEEEEEEecCCCcchhhhhHHHHHHHHHHHhccccCCCCCCceEEEEEccCCCccccCCCCCc
Q 003969          460 PLDVENLEVNISEVNISEVMLIAQVSSATFDDAVVNSEFERLAKAFAAGATASSPSLPLTALVIQDHQGVSNVAPADAPL  539 (783)
Q Consensus       460 ~~~~~~~~~~~~~~~~gevmliv~v~~~~l~~~~~~~~~~~L~~~~~~~~~~~~p~~~v~sl~~q~~~~~sn~~~~d~~~  539 (783)
                                     .|..|+++...+  .... .    ......+....        ....+++..         ....
T Consensus       125 ---------------~g~~~~l~~~~~--~~~~-~----~~~l~~~~~~~--------~~~~~~~~~---------~~~~  165 (358)
T d1uwva2         125 ---------------SGTLMILRHTAP--LSSA-D----REKLERFSHSE--------GLDLYLAPD---------SEIL  165 (358)
T ss_dssp             ---------------TEEEEEEEESSC--CCHH-H----HHHHHHHHHHH--------TCEEEEESS---------SSCC
T ss_pred             ---------------CCeEEEEEeccc--cCHH-H----HHHHHHhhhcc--------ceEEEEeec---------ceeE
Confidence                           145565544333  2221 1    11222222110        112222211         1111


Q ss_pred             eeccCCCCCCCCCccccccccceEEeeCCeEEEECCCccccCCHHHHHHHHHHHhhhccCCCCCeEEEecCCcCHHHHHH
Q 003969          540 RLLSIPKADGEPEESNDVVEARIHDSISNLRFCISPTAFFQVNTLAAEKLYSLGGDWADLGPDTLLFDVCCGTGTIGLTL  619 (783)
Q Consensus       540 ~~l~~~~~~g~~~~~~l~G~~~I~E~i~gl~f~isp~sFfQvN~~~ae~L~~~i~~~l~~~~g~~VLDLgCGtGti~l~L  619 (783)
                                    ..+.|..++++. +|++|+++|++|||+|+.+++.||+.+++++.+.++.+|||||||+|+||++|
T Consensus       166 --------------~~~~g~~~~~~~-~g~~~~i~p~sFfQ~N~~~~e~l~~~v~~~~~~~~~~~vlDLycG~G~fsl~L  230 (358)
T d1uwva2         166 --------------ETVSGEMPWYDS-NGLRLTFSPRDFIQVNAGVNQKMVARALEWLDVQPEDRVLDLFCGMGNFTLPL  230 (358)
T ss_dssp             --------------EEEECCCCEEEE-TTEEEECCSSSCCCSBHHHHHHHHHHHHHHHTCCTTCEEEEESCTTTTTHHHH
T ss_pred             --------------EeecCCceEEec-CCEEEEECCchhhccchhhhhHHHHHHHHhhccCCCceEEEecccccccchhc
Confidence                          123466666654 89999999999999999999999999999999888999999999999999999


Q ss_pred             hhhCCEEEEEeCCHHHHHHHHHHHHHcCCCcEEEEEccHHHHHHHHHhhhcCCCcccccccccCCchhhhhhhhccCCCC
Q 003969          620 AHRVGMVIGIEMNASAVSDAHRNAEINGIKNCRFVCAKAEDVMGSLLKDYLNPLREEDEHASEGSNKEITIAEEKDSSRD  699 (783)
Q Consensus       620 A~~~~~VigVE~s~~AIe~Ak~Na~~ngl~nv~f~~gDaed~l~~l~~~~~d~p~~~~~~~~~~~~~~~~~~~~~~~~~~  699 (783)
                      |+.+++|+|||++++||++|++|++.||+.|+.|+++++++.+......                               
T Consensus       231 a~~~~~V~gvE~~~~ai~~A~~na~~n~i~n~~~~~~~~~~~~~~~~~~-------------------------------  279 (358)
T d1uwva2         231 ATQAASVVGVEGVPALVEKGQQNARLNGLQNVTFYHENLEEDVTKQPWA-------------------------------  279 (358)
T ss_dssp             HTTSSEEEEEESCHHHHHHHHHHHHHTTCCSEEEEECCTTSCCSSSGGG-------------------------------
T ss_pred             cccccEEEeccCcHHHHHHHHHhHHhcccccceeeecchhhhhhhhhhh-------------------------------
Confidence            9999999999999999999999999999999999999988754322110                               


Q ss_pred             CCCCCCCCCCCCCCCCccCCCCCCCCCCCCccccccccccCCCCCCCCCCceEEEECCCCCCCcHHHHHHHHhccCCCcE
Q 003969          700 NVPENEGCSGQDPENDIADSNCPEGSGKEPQSQLQKDCTSEGNSLAQPFKNVVAIVDPPRGGLHPTVIKILRTHARLQRL  779 (783)
Q Consensus       700 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~v~ivDPPR~Gl~~~vi~~lr~~~~~~rl  779 (783)
                                                                   ...|  +++||||||+|++ +++++|... +++||
T Consensus       280 ---------------------------------------------~~~~--d~vilDPPR~G~~-~~~~~l~~~-~~~~i  310 (358)
T d1uwva2         280 ---------------------------------------------KNGF--DKVLLDPARAGAA-GVMQQIIKL-EPIRI  310 (358)
T ss_dssp             ---------------------------------------------TTCC--SEEEECCCTTCCH-HHHHHHHHH-CCSEE
T ss_pred             ---------------------------------------------hccC--ceEEeCCCCccHH-HHHHHHHHc-CCCEE
Confidence                                                         0123  7999999999998 589999987 89999


Q ss_pred             EEe
Q 003969          780 LHI  782 (783)
Q Consensus       780 vYV  782 (783)
                      |||
T Consensus       311 vYV  313 (358)
T d1uwva2         311 VYV  313 (358)
T ss_dssp             EEE
T ss_pred             EEE
Confidence            998
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oo3a1 c.66.1.59 (A:9-279) Uncharacterized protein LPG1296 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure