Citrus Sinensis ID: 004098

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770----
MSGSGTSRDEVIAKLIEMGFDDSDITEAVETVGPSFNDAIEYILNGSVRNSKGKSVSWSSKCVTENGKTLGKRTLSSANSLGQMRQASLLDHFQSGNRQKRGKRNVGDDVSVSGSVVSPSIVEEQKESYPGMDCNLKAESDSLAVSCPKEVEIGSDWEVKVNSLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCSKLSKHGVTACFLGSGQPDNKVEQKALRGMYSIIYVCPETVIRLIKPLQRLAESRGIALFAIDEVHCVSKWGHDFRPDYRRLSVLRENFGANNLKSLKFDIPLMALTATATIQVREDILKSLHMSKGTKFVLTSFFRPNLRFSVKHSKTSSRASYKKDFCQLIDIYTKKKKTGEKEKSAIPQDLDDQSDTSSSSSMSEESRISPNIGDGYYDDEDVGNSPMGKEMSVEFLENDSVDDWDVACGEFYGHSPHRDRDTDRSFERTDLLNKPAERLSMLQEPLEDGLTIIYVPTRKETLSIAKYLCGFGVKAAAYNASLPKSQLRRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWPQSLEAYYQEAGRAGRDGHLADCVLYANLSSMPTLLPSRRSEDQTKQAYRMLSDCFRYGMNTSCCRAKILVEYFGEDFSHEKCQLCDVCVDGPPEMKNLKEEANILMQVIAAYNEQSNSMDDDDGIYSGIKKQKFMDRPNLKMFVSKIREQSQKYLATDLLWWRGLARIMENKGYIREGDDRVCS
cccccccHHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHccccHHHHHccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccEEEEEEcccccccccccccccccccEEEEccHHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHccccEEEEEcccccccccccccHHHHcHHHHHHHHcccccccccccccEEEEcccccHHHHHHHHHHHccccccEEEcccccccccEEEEEEcccccHHHHHHcccccEEEEccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccHHHHHHHHHccccccccEEEEccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccEEEEEcccccccccccEEEEEEccccccHHHHHHHccccccccccccEEEccccccHHHHccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccEEEccccccccccccccccccccccccccHHHHHccHHHHHHHHHHHHHccccHHccccccc
cccccccHHHHHHHHHHccccHHHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccHHcccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHccccEEEEEcccccccHHEccHHHcccccEEEEcHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHHHHHccccEEEEEEcHHHHHcccccccHHHHHHHHHHHHccccccccccccccEEEEEEcccHHHHHHHHHHcccccccEEEEEccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHHHHcccccHHHHccccHHHHHHHHHHcccccEEEEEEEccccccccEEEEEEcccccccccHEEccccccccccccHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHccccEEEHcccccHHHHHHHHHHHHHcccEEEEEEEEEccccccccEEEEEEEcccccHHHHHHHcccccccccccEEEEEEcHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHcccccccEccccccccHHHHHHHHHHHHHHHHHHHccccEEccccccc
MSGSGTSRDEVIAKLIEmgfddsditeavetvgpsfnDAIEYILNgsvrnskgksvswsskcvtengktlgkRTLSSANSLGQMRQASLLdhfqsgnrqkrgkrnvgddvsvsgsvvspsiveeqkesypgmdcnlkaesdslavscpkeveigsDWEVKVNSLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLaatgsgkslcfqipalltGKVVVVISPLISLMHDqcsklskhgvtacflgsgqpdnKVEQKALRGMYSIIYVCPETVIRLIKPLQRLAESRGIALFAIDEVhcvskwghdfrpdyrrLSVLREnfgannlkslkfdiplmALTATATIQVREDILKSLhmskgtkfvltsffrpnlrfsvkhsktssrasykkDFCQLIDIYTKkkktgekeksaipqdlddqsdtsssssmseesrispnigdgyyddedvgnspmgkeMSVEFlendsvddwdvacgefyghsphrdrdtdrsfertdllnkpAERLSMLQepledgltiiyvptrKETLSIAKYLCGFGVkaaaynaslpksqlrRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWPQSLEAYYQEAgragrdghLADCVLYAnlssmptllpsrrsedQTKQAYRMLSDCFrygmntscCRAKILVEYfgedfshekcqlcdvcvdgppemknLKEEANILMQVIAAYNeqsnsmddddgiysgikkqkfmdrpnlkMFVSKIREQSQKYLATDLLWWRGLARIMEnkgyiregddrvcs
MSGSGTSRDEVIAKLIEMGFDDSDITEAVETVGPSFNDAIEYILNgsvrnskgksvswsskcvtengktlgkrtlSSANSLGQMRQASLLDHfqsgnrqkrgkrnvgddvsvsgsvvspsiveeqkesypGMDCNLKAESDSLAVSCPKEVEIGSDWEVKVNSLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCSKLSKHGVTACFLGSGQPDNKVEQKALRGMYSIIYVCPETVIRLIKPLQRLAESRGIALFAIDEVHCVSKWGHDFRPDYRRLSVLRENFGannlkslkfdiPLMALTATATIQVREDILKSLHMSKGTKFvltsffrpnlrfsvkhsktssrasykkdfcQLIDIytkkkktgekeksaipqdlddqsdtsssssmseesrispnigdgyydDEDVGNSPMGKEMSVEFLENDSVDDWDVACGEfyghsphrdrdtdrsFERTDLLNKPAERLSMLQEPLEDGLTIIYVPTRKETLSIAKYLCGFGVKAAAYNASLPKSQLRRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWPQSLEAYYQEAGRAGRDGHLADCVLYANLssmptllpsrrsedqTKQAYRMLSDCFRYGMNTSCCRAKILVEYFGEDFSHEKCQLCDVCVDGPPEMKNLKEEANILMQVIAAYNEqsnsmdddDGIYSGIKkqkfmdrpNLKMFVSKIREQSQKYLATDLLWWRGLARIMenkgyiregddrvcs
MSGSGTSRDEVIAKLIEMGFDDSDITEAVETVGPSFNDAIEYILNGSVRNSKGKSVSWSSKCVTENGKTLGKRTLSSANSLGQMRQASLLDHFQSGNRQKRGKRNvgddvsvsgsvvspsIVEEQKESYPGMDCNLKAESDSLAVSCPKEVEIGSDWEVKVNSLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCSKLSKHGVTACFLGSGQPDNKVEQKALRGMYSIIYVCPETVIRLIKPLQRLAESRGIALFAIDEVHCVSKWGHDFRPDYRRLSVLRENFGANNLKSLKFDIPLMALTATATIQVREDILKSLHMSKGTKFVLTSFFRPNLRFSVKHSKTSSRASYKKDFCQLIDIYtkkkktgekekSAIPQdlddqsdtsssssmseesrisPNIGDGYYDDEDVGNSPMGKEMSVEFLENDSVDDWDVACGEFYGHSPHRDRDTDRSFERTDLLNKPAERLSMLQEPLEDGLTIIYVPTRKETLSIAKYLCGFGVKAAAYNASLPKSQLRRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWPQSLEAYYQEAGRAGRDGHLADCVLYANLSSMPTLLPSRRSEDQTKQAYRMLSDCFRYGMNTSCCRAKILVEYFGEDFSHEKCQLCDVCVDGPPEMKNLKEEANILMQVIAAYNEQSNSMDDDDGIYSGIKKQKFMDRPNLKMFVSKIREQSQKYLATDLLWWRGLARIMENKGYIREGDDRVCS
**********VIAKLIEMGFDDSDITEAVETVGPSFNDAIEYILNGSV***********************************************************************************************AVSCPKEVEIGSDWEVKVNSLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCSKLSKHGVTACFLGSGQPDNKVEQKALRGMYSIIYVCPETVIRLIKPLQRLAESRGIALFAIDEVHCVSKWGHDFRPDYRRLSVLRENFGANNLKSLKFDIPLMALTATATIQVREDILKSLHMSKGTKFVLTSFFRPNLRFSVK********SYKKDFCQLIDIYT*************************************************************FLENDSVDDWDVACGEFYG********************************LEDGLTIIYVPTRKETLSIAKYLCGFGVKAAAYNASLPKSQLRRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWPQSLEAYYQEAGRAGRDGHLADCVLYANLS*****************AYRMLSDCFRYGMNTSCCRAKILVEYFGEDFSHEKCQLCDVCVDGPPEMKNLKEEANILMQVIAAYN***********IYSGIKKQKFMDRPNLKMFVSKIREQSQKYLATDLLWWRGLARIMENKGYI*********
**********VIAKLIEMGFDDSDITEAVETVGPSFNDAI**************************************************************************************************************************SLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCSKLSKHGVTACFLGSGQPDNKVEQKALRGMYSIIYVCPETVIRLIKPLQRLAESRGIALFAIDEVHCVSKWGHDFRPDYRRLSVLRENFGANNLKSLKFDIPLMALTATATIQVREDILKSLHMSKGTKFVLTSFFRPNLRFSVKHSKTSSRASYKKDFCQLIDIYTKKKKTGEKEKSAIPQDLDDQSDTSSSSSMSEESRISPNIGDGYYDDEDVGNSPMGKEMSVEFLENDSVDDWDVACGEFYGHSPHRDRDTDRSFERTDLLNKPAERLSMLQEPLEDGLTIIYVPTRKETLSIAKYLCGFGVKAAAYNASLPKSQLRRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWPQSLEAYYQEAGRAGRDGHLADCVLYANLSSMP******************LSDCFRYGMNTSCCRAKILVEYFGEDFSHEKCQLCDVCVDGPPEMKNLKEEANILMQVIAAYNEQSNSMDDDDGIYSGIKKQKFMDRPNLKMFVSKIREQSQKYLATDLLWWRGLARIMENKGYIREG*D****
********DEVIAKLIEMGFDDSDITEAVETVGPSFNDAIEYILNGSVR***********KCVTENGKTLGKRTLSSANSLGQMRQASLLDHFQSGN************VSVSGSVVSPSIVEEQKESYPGMDCNLKAESDSLAVSCPKEVEIGSDWEVKVNSLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCSKLSKHGVTACFLGSGQPDNKVEQKALRGMYSIIYVCPETVIRLIKPLQRLAESRGIALFAIDEVHCVSKWGHDFRPDYRRLSVLRENFGANNLKSLKFDIPLMALTATATIQVREDILKSLHMSKGTKFVLTSFFRPNLRFSV*********SYKKDFCQLIDIYTKKK********************************SPNIGDGYYDDEDVGNSPMGKEMSVEFLENDSVDDWDVACGEFYGHSP*********FERTDLLNKPAERLSMLQEPLEDGLTIIYVPTRKETLSIAKYLCGFGVKAAAYNASLPKSQLRRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWPQSLEAYYQEAGRAGRDGHLADCVLYANLSSMPTLLPSRRSEDQTKQAYRMLSDCFRYGMNTSCCRAKILVEYFGEDFSHEKCQLCDVCVDGPPEMKNLKEEANILMQVIAAYNEQSNSMDDDDGIYSGIKKQKFMDRPNLKMFVSKIREQSQKYLATDLLWWRGLARIMENKGYIREGDDRVCS
*****TSRDEVIAKLIEMGFDDSDITEAVETVGPSFNDAIEYILNG**********************************************************************************************************IGSDWEVKVNSLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCSKLSKHGVTACFLGSGQPDNKVEQKALRGMYSIIYVCPETVIRLIKPLQRLAESRGIALFAIDEVHCVSKWGHDFRPDYRRLSVLRENFGANNLKSLKFDIPLMALTATATIQVREDILKSLHMSKGTKFVLTSFFRPNLRFSVKHSKTSSRASYKKDFCQLIDIYTKKKKTGEKEKSAIPQDLDDQSDTSSSSSMSEESRISPNIGDGYYDDEDVGNSPMGKEMSVEFLENDSVDDWDVACGEFYGHSPHRDRDTDRSFERTDLLNKPAERLSMLQEPLEDGLTIIYVPTRKETLSIAKYLCGFGVKAAAYNASLPKSQLRRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWPQSLEAYYQEAGRAGRDGHLADCVLYANLSSMPTLLPSRRSEDQTKQAYRMLSDCFRYGMNTSCCRAKILVEYFGEDFSHEKCQLCDVCVDGPPEMKNLKEEANILMQVIAAYNEQSNSMDDDDGIYSGIKKQKFMDRPNLKMFVSKIREQSQKYLATDLLWWRGLARIMENKGYIREGD***C*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGSGTSRDEVIAKLIEMGFDDSDITEAVETVGPSFNDAIEYILNGSVRNSKGKSVSWSSKCVTENGKTLGKRTLSSANSLGQMRQASLLDHFQSGNRQKRGKRNVGDDVSVSGSVVSPSIVEEQKESYPGMDCNLKAESDSLAVSCPKEVEIGSDWEVKVNSLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCSKLSKHGVTACFLGSGQPDNKVEQKALRGMYSIIYVCPETVIRLIKPLQRLAESRGIALFAIDEVHCVSKWGHDFRPDYRRLSVLRENFGANNLKSLKFDIPLMALTATATIQVREDILKSLHMSKGTKFVLTSFFRPNLRFSVKHSKTSSRASYKKDFCQLIDIYTKKKKTGEKEKSAIPQDLDDQSDTSSSSSMSEESRISPNIGDGYYDDEDVGNSPMGKEMSVEFLENDSVDDWDVACGEFYGHSPHRDRDTDRSFERTDLLNKPAERLSMLQEPLEDGLTIIYVPTRKETLSIAKYLCGFGVKAAAYNASLPKSQLRRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWPQSLEAYYQEAGRAGRDGHLADCVLYANLSSMPTLLPSRRSEDQTKQAYRMLSDCFRYGMNTSCCRAKILVEYFGEDFSHEKCQLCDVCVDGPPExxxxxxxxxxxxxxxxxxxxxSNSMDDDDGIYSGIKKQKFMDRPNLKMFVSKIREQSQKYLATDLLWWRGLARIMENKGYIREGDDRVCS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query774 2.2.26 [Sep-21-2011]
Q9FT69858 ATP-dependent DNA helicas yes no 0.961 0.867 0.582 0.0
Q9DEY9 1364 Bloom syndrome protein ho N/A no 0.330 0.187 0.360 7e-43
O93530 1436 Werner syndrome ATP-depen N/A no 0.267 0.144 0.447 5e-41
Q14191 1432 Werner syndrome ATP-depen yes no 0.258 0.139 0.433 5e-41
Q9FT73705 Mediator of RNA polymeras no no 0.271 0.297 0.403 1e-40
O09053 1401 Werner syndrome ATP-depen yes no 0.257 0.142 0.445 1e-40
Q9FT72713 ATP-dependent DNA helicas no no 0.260 0.283 0.411 2e-40
P71359619 ATP-dependent DNA helicas yes no 0.259 0.324 0.421 1e-39
P54132 1417 Bloom syndrome protein OS no no 0.259 0.141 0.406 6e-39
O88700 1416 Bloom syndrome protein ho no no 0.259 0.141 0.406 7e-39
>sp|Q9FT69|RQSIM_ARATH ATP-dependent DNA helicase Q-like SIM OS=Arabidopsis thaliana GN=RECQSIM PE=2 SV=1 Back     alignment and function desciption
 Score =  856 bits (2212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/778 (58%), Positives = 568/778 (73%), Gaps = 34/778 (4%)

Query: 7   SRDEVIAKLIEMGFDDSDITEAVETVG-PSFNDAIEYILNGSVRNSKGKSVSWSSKCVTE 65
           S D+++ K++EMGF+  D  EAV+ VG  S +DA+EYIL G+ R    K  S    C + 
Sbjct: 4   SSDQLVMKIVEMGFEKLDALEAVKAVGGKSCDDAVEYILKGNHRTGGFKPASLL--CSSG 61

Query: 66  NGKTLGKRTL-SSANSLGQMRQASLLDHFQSGNRQKRGKRNVGD-DVSVSGSVVSPSIVE 123
           + K LGKR + SS +S    RQ+SLLDHF+S N+ K+     G  +V      VS    E
Sbjct: 62  SNKILGKRAMPSSFSSSESKRQSSLLDHFRSVNQNKKKGDTFGTVEVDSQLETVSEHSEE 121

Query: 124 EQKESYPGMDCNLKAESDSLAVSCPKEVEIGSDWEVKVNSLLKKHFGHSSLKNFQKEALS 183
            +K   P    +       L   C    E  S WE +VNS+L+  FG SSL++FQ+EALS
Sbjct: 122 VRKSLAPVFMESSCFPEGQLLNGCS---EASSSWEKRVNSILRNRFGISSLRSFQREALS 178

Query: 184 AWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCSKLSKHGVTACFL 243
            W+AH DCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQC KLS+H V+ACFL
Sbjct: 179 TWVAHKDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCLKLSRHKVSACFL 238

Query: 244 GSGQPDNKVEQKALRGMYSIIYVCPETVIRLIKPLQRLAESRGIALFAIDEVHCVSKWGH 303
           GSGQ DN +E+KA++GMY IIYVCPETV+RLIKPLQ+LA++ GIALFAIDE HCVSKWGH
Sbjct: 239 GSGQLDNCIEEKAMQGMYQIIYVCPETVVRLIKPLQKLAKTHGIALFAIDEAHCVSKWGH 298

Query: 304 DFRPDYRRLSVLRENFGANNLKSLKFDIPLMALTATATIQVREDILKSLHMSKGTKFVLT 363
           DFRP YR+LSVLRENF A+NL+ L++D+P+MALTATAT+ V+EDIL+SLH+SK TK VLT
Sbjct: 299 DFRPHYRKLSVLRENFCASNLEFLEYDVPIMALTATATVNVQEDILESLHLSKETKIVLT 358

Query: 364 SFFRPNLRFSVKHSKTSSRASYKKDFCQLIDIYTKKKKTGEKEKSAIPQDLDDQSDTSSS 423
           SFFRPNL+FSVKHS+T   +SY KDF  L+D+Y++KK +  K+ + I ++ ++Q+D  S 
Sbjct: 359 SFFRPNLQFSVKHSRTKFASSYAKDFQNLVDLYSEKKNSTGKKLAVISRESEEQTDFGSH 418

Query: 424 SSMSEESRISPNIGDGYYDDEDVGNSPMGKEMSVEFLEND-----SVDDWDVACGEFYGH 478
            S +          +   +     NS  GKE+S  +LE++     SVDDWDVACGEF   
Sbjct: 419 DSENIHETDYDEDEEDQENSLAKKNSSNGKELSEAYLEDETDIFQSVDDWDVACGEFC-- 476

Query: 479 SPHRDRDTDRSFERTDLLNKPAERLSMLQEPLEDGLTIIYVPTRKETLSIAKYLCGFGVK 538
                     +    +LL  P    S  Q+ LE GLTIIYVPTRKE+++IAKYLCG G+K
Sbjct: 477 ----------AMPSCELLEIPVP--SEKQKDLE-GLTIIYVPTRKESVNIAKYLCGVGLK 523

Query: 539 AAAYNASLPKSQLRRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWPQSLEAYYQ 598
           AAAYNASLPK  LR+VH +FH+NKL+VVVATIAFGMGIDK NVR+IIHYGW QSLEAYYQ
Sbjct: 524 AAAYNASLPKKHLRQVHQDFHDNKLQVVVATIAFGMGIDKKNVRKIIHYGWLQSLEAYYQ 583

Query: 599 EAGRAGRDGHLADCVLYANLSSMPTLLPSRRSEDQTKQAYRMLSDCFRYGMNTSCCRAKI 658
           EAGRAGRDG LA+CVLYA+LS  PTLLPSRRS++QT+QAY+MLSDCFRYGMNTS CRAKI
Sbjct: 584 EAGRAGRDGELAECVLYADLSRAPTLLPSRRSKEQTEQAYKMLSDCFRYGMNTSQCRAKI 643

Query: 659 LVEYFGEDFSHEKCQLCDVCVDGPPEMKNLKEEANILMQVIAAY-----NEQSNSMDDDD 713
           LVEYFGE+FS +KC  CDVC +GPPE+ +++EEAN+L QVI A+     N+  ++  +D 
Sbjct: 644 LVEYFGEEFSSKKCNSCDVCTEGPPELVDVREEANLLFQVITAFHLQVDNDSEHAPYEDY 703

Query: 714 GIYSGIKKQKFMDRPNLKMFVSKIREQSQKYLATDLLWWRGLARIMENKGYIREGDDR 771
           G+ +  K+ K   +PNL  F+SK+REQ +K+  TD LWW+GLARIME +GYI+E D++
Sbjct: 704 GLGNS-KQNKLSHKPNLLFFISKLREQCEKFKETDCLWWKGLARIMEAEGYIKEMDNK 760
Plant specific 3'-5' DNA helicase that may play a role in the repair of DNA.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|Q9DEY9|BLM_XENLA Bloom syndrome protein homolog OS=Xenopus laevis GN=blm PE=2 SV=1 Back     alignment and function description
>sp|O93530|WRN_XENLA Werner syndrome ATP-dependent helicase homolog OS=Xenopus laevis GN=wrn PE=2 SV=1 Back     alignment and function description
>sp|Q14191|WRN_HUMAN Werner syndrome ATP-dependent helicase OS=Homo sapiens GN=WRN PE=1 SV=2 Back     alignment and function description
>sp|Q9FT73|MED34_ARATH Mediator of RNA polymerase II transcription subunit 34 OS=Arabidopsis thaliana GN=MED34 PE=1 SV=1 Back     alignment and function description
>sp|O09053|WRN_MOUSE Werner syndrome ATP-dependent helicase homolog OS=Mus musculus GN=Wrn PE=1 SV=3 Back     alignment and function description
>sp|Q9FT72|RQL3_ARATH ATP-dependent DNA helicase Q-like 3 OS=Arabidopsis thaliana GN=RECQL3 PE=1 SV=1 Back     alignment and function description
>sp|P71359|RECQ_HAEIN ATP-dependent DNA helicase RecQ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=recQ PE=3 SV=1 Back     alignment and function description
>sp|P54132|BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 Back     alignment and function description
>sp|O88700|BLM_MOUSE Bloom syndrome protein homolog OS=Mus musculus GN=Blm PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query774
359487624 893 PREDICTED: ATP-dependent DNA helicase Q- 0.987 0.855 0.677 0.0
296089683 1537 unnamed protein product [Vitis vinifera] 0.950 0.478 0.670 0.0
224123798 1048 predicted protein [Populus trichocarpa] 0.983 0.726 0.645 0.0
356574959854 PREDICTED: ATP-dependent DNA helicase Q- 0.944 0.855 0.620 0.0
255542712803 DNA helicase, putative [Ricinus communis 0.857 0.826 0.656 0.0
449454155821 PREDICTED: ATP-dependent DNA helicase Q- 0.891 0.840 0.638 0.0
449521040821 PREDICTED: LOW QUALITY PROTEIN: ATP-depe 0.891 0.840 0.636 0.0
297808755855 predicted protein [Arabidopsis lyrata su 0.952 0.861 0.593 0.0
34391859 880 putative DNA helicase RecQsim [Brassica 0.931 0.819 0.582 0.0
357441723 903 ATP-dependent DNA helicase Q4 [Medicago 0.970 0.831 0.585 0.0
>gi|359487624|ref|XP_002279606.2| PREDICTED: ATP-dependent DNA helicase Q-like SIM-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1051 bits (2717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/801 (67%), Positives = 636/801 (79%), Gaps = 37/801 (4%)

Query: 1   MSGSGTSRDEVIAKLIEMGFDDSDITEAVETVGPSFNDAIEYILNGSVRNSKGKSVSWSS 60
           M G+    D+VIA+LIEMGF+ S +TEA+E VGPS +DAIE+ILNG  R+S+G S +  S
Sbjct: 1   MDGNNVHSDQVIAELIEMGFEFSAVTEAIEVVGPSLDDAIEFILNGPHRSSRGASSN--S 58

Query: 61  KCVTENGKTLGKRTLSSANSLGQMRQASLLDHFQSGNRQKRGKRN-VGDDVSVSGSVVSP 119
           KC T  GK L K  L S++SL QMRQ+S+ +H Q   R KR + N V + VS  GS + P
Sbjct: 59  KCPTSTGKALDKTALISSHSLDQMRQSSITEHLQPVGRSKRIRTNSVYNAVSPYGSEMLP 118

Query: 120 SIVEEQKESYPGMDCNLKAESD--SLAVSCPKEVEIGSDWEVKVNSLLKKHFGHSSLKNF 177
             +EEQ  S+ G  CNLKA S+  +L V C +E+EIG DW  +VNSLL KHFG  SLK+F
Sbjct: 119 GHLEEQVLSFSGEGCNLKAASELSALPVCCQQELEIGKDWVQRVNSLLHKHFGILSLKSF 178

Query: 178 QKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCSKLSKHG 237
           QKEALSAWLAH DCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQC KL+KHG
Sbjct: 179 QKEALSAWLAHQDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCLKLAKHG 238

Query: 238 VTACFLGSGQPDNKVEQKALRGMYSIIYVCPETVIRLIKPLQRLAESRGIALFAIDEVHC 297
           V+ACFLGSGQPD+ VEQKA+ GMY IIYVCPETV+RLIKPLQRLAE+RGIALFAIDEVHC
Sbjct: 239 VSACFLGSGQPDSSVEQKAMSGMYEIIYVCPETVLRLIKPLQRLAENRGIALFAIDEVHC 298

Query: 298 VSKWGHDFRPDYRRLSVLRENFGANNLKSLKFDIPLMALTATATIQVREDILKSLHMSKG 357
           VSKWGHDFRPDYRRLSVLRENF A +LK L+FDIP+MALTATATI VREDIL SL MSK 
Sbjct: 299 VSKWGHDFRPDYRRLSVLRENFSACSLKFLEFDIPIMALTATATICVREDILHSLCMSKE 358

Query: 358 TKFVLTSFFRPNLRFSVKHSKTSSRASYKKDFCQLIDIYTKKKKTGEKEKSAIPQDL--- 414
           TK VLTSFFR NLRFSVKHS+TSS +SY+KDF +L+D+YTK K   +K++    Q+L   
Sbjct: 359 TKIVLTSFFRSNLRFSVKHSRTSSPSSYEKDFSELMDVYTKSKVG-KKKQKIFSQELDDA 417

Query: 415 DDQSDTSSSSSMSEESRISP----NIGDGYY---DDEDVGNSPMG------KEMSVEFLE 461
            D S +S+  S+SE  R+SP    N GDGY+   DDE   +   G      ++MSVE+LE
Sbjct: 418 SDDSTSSADRSLSEADRMSPSDVENNGDGYFGENDDEANSSQENGSAASKQRQMSVEYLE 477

Query: 462 ND-----SVDDWDVACGEFYGHSPHRDRDTDRSFERTDLLN---KPAERLSMLQEPLEDG 513
           N+     SVDDWDV+CGEF G  P     T+ +F  ++ L+   K  ERL++L+ PLE G
Sbjct: 478 NEVDLFQSVDDWDVSCGEFSGQPP-----TEHTFGSSETLDPSMKLDERLTLLKGPLEQG 532

Query: 514 LTIIYVPTRKETLSIAKYLCGFGVKAAAYNASLPKSQLRRVHTEFHENKLEVVVATIAFG 573
            TIIYVPTRKETL+IAKYLC  GVKAAAYNA LPKS LRRVH EFH+N L+VVVATIAFG
Sbjct: 533 PTIIYVPTRKETLNIAKYLCRCGVKAAAYNAKLPKSHLRRVHKEFHDNALQVVVATIAFG 592

Query: 574 MGIDKLNVRRIIHYGWPQSLEAYYQEAGRAGRDGHLADCVLYANLSSMPTLLPSRRSEDQ 633
           MGIDKLNVRRIIHYGWPQSLEAYYQEAGRAGRDG LADC+LYANLS +PTLLPS+RSEDQ
Sbjct: 593 MGIDKLNVRRIIHYGWPQSLEAYYQEAGRAGRDGKLADCILYANLSRVPTLLPSQRSEDQ 652

Query: 634 TKQAYRMLSDCFRYGMNTSCCRAKILVEYFGEDFSHEKCQLCDVCVDGPPEMKNLKEEAN 693
           TKQAY+MLSDCFRYGMNT+CCRAK LVEYFGEDF H+ C LCDVCV+GPPE +NLK+EA+
Sbjct: 653 TKQAYKMLSDCFRYGMNTTCCRAKTLVEYFGEDFCHQSCILCDVCVNGPPEKQNLKDEAD 712

Query: 694 ILMQVIAAYNEQSNSMDD--DDGIYSGIKKQKFMDRPNLKMFVSKIREQSQKYLATDLLW 751
             M VIAA+  +S+ +DD  D  IY  +++Q+FMD+PNL+M VS+IREQ QK+ ATDLLW
Sbjct: 713 TFMHVIAAHYGKSSFVDDLYDGVIYGDVEQQRFMDKPNLRMLVSRIREQFQKFAATDLLW 772

Query: 752 WRGLARIMENKGYIREGDDRV 772
           WRGLARIME+KGYIREG+DR+
Sbjct: 773 WRGLARIMEDKGYIREGEDRI 793

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296089683|emb|CBI39502.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224123798|ref|XP_002330211.1| predicted protein [Populus trichocarpa] gi|222871667|gb|EEF08798.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356574959|ref|XP_003555610.1| PREDICTED: ATP-dependent DNA helicase Q-like SIM-like [Glycine max] Back     alignment and taxonomy information
>gi|255542712|ref|XP_002512419.1| DNA helicase, putative [Ricinus communis] gi|223548380|gb|EEF49871.1| DNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449454155|ref|XP_004144821.1| PREDICTED: ATP-dependent DNA helicase Q-like SIM-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449521040|ref|XP_004167539.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent DNA helicase Q-like SIM-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297808755|ref|XP_002872261.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297318098|gb|EFH48520.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|34391859|gb|AAO52679.1| putative DNA helicase RecQsim [Brassica napus] Back     alignment and taxonomy information
>gi|357441723|ref|XP_003591139.1| ATP-dependent DNA helicase Q4 [Medicago truncatula] gi|355480187|gb|AES61390.1| ATP-dependent DNA helicase Q4 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query774
TAIR|locus:2180255858 RECQSIM "RECQ helicase SIM" [A 0.959 0.865 0.571 9.8e-222
TIGR_CMR|GSU_0898603 GSU_0898 "ATP-dependent DNA he 0.255 0.328 0.447 2.8e-62
UNIPROTKB|P15043609 recQ [Escherichia coli K-12 (t 0.262 0.333 0.408 6.3e-62
UNIPROTKB|F1NAR0 1367 F1NAR0 "Uncharacterized protei 0.264 0.149 0.431 1.3e-61
TIGR_CMR|SO_4241607 SO_4241 "ATP-dependent DNA hel 0.272 0.347 0.375 2e-61
UNIPROTKB|F1PZR2 1336 WRN "Uncharacterized protein" 0.267 0.154 0.440 2.3e-61
UNIPROTKB|F1PZR3 1499 WRN "Uncharacterized protein" 0.267 0.138 0.440 4.1e-61
UNIPROTKB|F1PUF8 1574 WRN "Uncharacterized protein" 0.267 0.131 0.440 5.2e-61
UNIPROTKB|Q9KVF0620 VC_0196 "ATP-dependent DNA hel 0.271 0.338 0.392 6.9e-61
TIGR_CMR|VC_0196620 VC_0196 "ATP-dependent DNA hel 0.271 0.338 0.392 6.9e-61
TAIR|locus:2180255 RECQSIM "RECQ helicase SIM" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2141 (758.7 bits), Expect = 9.8e-222, P = 9.8e-222
 Identities = 445/779 (57%), Positives = 554/779 (71%)

Query:     7 SRDEVIAKLIEMGFDDSDITEAVETVG-PSFNDAIEYILNGSVRNSKGKSVSWSSKCVTE 65
             S D+++ K++EMGF+  D  EAV+ VG  S +DA+EYIL G+ R    K  S    C + 
Sbjct:     4 SSDQLVMKIVEMGFEKLDALEAVKAVGGKSCDDAVEYILKGNHRTGGFKPASLL--CSSG 61

Query:    66 NGKTLGKRTL-SSANSLGQMRQASLLDHFQSGNRQKRGKRNXXXXXXXXXXXXXXXIVEE 124
             + K LGKR + SS +S    RQ+SLLDHF+S N+ K+                     EE
Sbjct:    62 SNKILGKRAMPSSFSSSESKRQSSLLDHFRSVNQNKKKGDTFGTVEVDSQLETVSEHSEE 121

Query:   125 QKESYPG--MDCNLKAESDSLAVSCPKEVEIGSDWEVKVNSLLKKHFGHSSLKNFQKEAL 182
              ++S     M+ +   E   L   C    E  S WE +VNS+L+  FG SSL++FQ+EAL
Sbjct:   122 VRKSLAPVFMESSCFPEGQLLN-GCS---EASSSWEKRVNSILRNRFGISSLRSFQREAL 177

Query:   183 SAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCSKLSKHGVTACF 242
             S W+AH DCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQC KLS+H V+ACF
Sbjct:   178 STWVAHKDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCLKLSRHKVSACF 237

Query:   243 LGSGQPDNKVEQKALRGMYSIIYVCPETVIRLIKPLQRLAESRGIALFAIDEVHCVSKWG 302
             LGSGQ DN +E+KA++GMY IIYVCPETV+RLIKPLQ+LA++ GIALFAIDE HCVSKWG
Sbjct:   238 LGSGQLDNCIEEKAMQGMYQIIYVCPETVVRLIKPLQKLAKTHGIALFAIDEAHCVSKWG 297

Query:   303 HDFRPDYRRLSVLRENFGANNLKSLKFDIPLMALTATATIQVREDILKSLHMSKGTKFVL 362
             HDFRP YR+LSVLRENF A+NL+ L++D+P+MALTATAT+ V+EDIL+SLH+SK TK VL
Sbjct:   298 HDFRPHYRKLSVLRENFCASNLEFLEYDVPIMALTATATVNVQEDILESLHLSKETKIVL 357

Query:   363 TSFFRPNLRFSVKHSKTSSRASYKKDFCQLIDIYXXXXXXXXXXXSAIPQXXXXXXXXXX 422
             TSFFRPNL+FSVKHS+T   +SY KDF  L+D+Y           + I +          
Sbjct:   358 TSFFRPNLQFSVKHSRTKFASSYAKDFQNLVDLYSEKKNSTGKKLAVISRESEEQTDFGS 417

Query:   423 XXXXXXXXXXXPNIGDGYYDDEDVGNSPMGKEMSVEFLEND-----SVDDWDVACGEFYG 477
                            +   +     NS  GKE+S  +LE++     SVDDWDVACGEF  
Sbjct:   418 HDSENIHETDYDEDEEDQENSLAKKNSSNGKELSEAYLEDETDIFQSVDDWDVACGEFCA 477

Query:   478 HSPHRDRDTDRSFERTDLLNKPAERLSMLQEPLEDGLTIIYVPTRKETLSIAKYLCGFGV 537
               P        S E  ++   P+E+    Q+ LE GLTIIYVPTRKE+++IAKYLCG G+
Sbjct:   478 -MP--------SCELLEI-PVPSEK----QKDLE-GLTIIYVPTRKESVNIAKYLCGVGL 522

Query:   538 KAAAYNASLPKSQLRRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWPQSLEAYY 597
             KAAAYNASLPK  LR+VH +FH+NKL+VVVATIAFGMGIDK NVR+IIHYGW QSLEAYY
Sbjct:   523 KAAAYNASLPKKHLRQVHQDFHDNKLQVVVATIAFGMGIDKKNVRKIIHYGWLQSLEAYY 582

Query:   598 QEAGRAGRDGHLADCVLYANLSSMPTLLPSRRSEDQTKQAYRMLSDCFRYGMNTSCCRAK 657
             QEAGRAGRDG LA+CVLYA+LS  PTLLPSRRS++QT+QAY+MLSDCFRYGMNTS CRAK
Sbjct:   583 QEAGRAGRDGELAECVLYADLSRAPTLLPSRRSKEQTEQAYKMLSDCFRYGMNTSQCRAK 642

Query:   658 ILVEYFGEDFSHEKCQLCDVCVDGPPEMKNLKEEANILMQVIAAY-----NEQSNSMDDD 712
             ILVEYFGE+FS +KC  CDVC +GPPE+ +++EEAN+L QVI A+     N+  ++  +D
Sbjct:   643 ILVEYFGEEFSSKKCNSCDVCTEGPPELVDVREEANLLFQVITAFHLQVDNDSEHAPYED 702

Query:   713 DGIYSGIKKQKFMDRPNLKMFVSKIREQSQKYLATDLLWWRGLARIMENKGYIREGDDR 771
              G+ +  K+ K   +PNL  F+SK+REQ +K+  TD LWW+GLARIME +GYI+E D++
Sbjct:   703 YGLGNS-KQNKLSHKPNLLFFISKLREQCEKFKETDCLWWKGLARIMEAEGYIKEMDNK 760
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006310 "DNA recombination" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0006281 "DNA repair" evidence=IDA
GO:0043138 "3'-5' DNA helicase activity" evidence=IDA
GO:0006270 "DNA replication initiation" evidence=RCA
GO:0006275 "regulation of DNA replication" evidence=RCA
GO:0051726 "regulation of cell cycle" evidence=RCA
TIGR_CMR|GSU_0898 GSU_0898 "ATP-dependent DNA helicase RecQ" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|P15043 recQ [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAR0 F1NAR0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4241 SO_4241 "ATP-dependent DNA helicase RecQ" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|F1PZR2 WRN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PZR3 WRN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PUF8 WRN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KVF0 VC_0196 "ATP-dependent DNA helicase RecQ" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0196 VC_0196 "ATP-dependent DNA helicase RecQ" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9FT69RQSIM_ARATH3, ., 6, ., 4, ., 1, 20.58220.96120.8671yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.120.946
3rd Layer3.6.40.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query774
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 7e-69
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 2e-65
TIGR01389591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 3e-61
PRK11057607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 6e-48
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 7e-45
TIGR01389 591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 4e-43
PLN03137 1195 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 3e-41
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 8e-40
PRK11057 607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 4e-34
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 2e-31
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-24
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 2e-24
PLN03137 1195 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4 2e-22
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 4e-21
smart0049082 smart00490, HELICc, helicase superfamily c-termina 3e-19
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-18
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 5e-13
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 2e-11
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 9e-08
COG1205 851 COG1205, COG1205, Distinct helicase family with a 7e-07
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 2e-06
TIGR03817 742 TIGR03817, DECH_helic, helicase/secretion neighbor 2e-06
cd00268203 cd00268, DEADc, DEAD-box helicases 9e-06
COG1205 851 COG1205, COG1205, Distinct helicase family with a 2e-05
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 3e-05
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 6e-05
pfam04851100 pfam04851, ResIII, Type III restriction enzyme, re 1e-04
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 1e-04
TIGR03817742 TIGR03817, DECH_helic, helicase/secretion neighbor 2e-04
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-04
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 2e-04
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 4e-04
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 0.001
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 0.004
pfam0062737 pfam00627, UBA, UBA/TS-N domain 0.004
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information 
 Score =  234 bits (598), Expect = 7e-69
 Identities = 98/220 (44%), Positives = 130/220 (59%), Gaps = 13/220 (5%)

Query: 163 SLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPL 222
           S+LK  FG SS +  Q E ++A L   DC V+  TG GKSLC+Q+PAL +  + +VISPL
Sbjct: 1   SILKTVFGLSSFRPVQLEVINAVLLGRDCFVVMPTGGGKSLCYQLPALCSDGITLVISPL 60

Query: 223 ISLMHDQCSKLSKHGVTACFLGSGQPDNK---VEQKALRGMYSIIYVCPETVIRLIKPLQ 279
           ISLM DQ  +L   G+ A FL S Q   +   V      G   ++YV PE      + LQ
Sbjct: 61  ISLMEDQVLQLKASGIPATFLNSSQSKEQQKNVLTDLKDGKIKLLYVTPEKCSASNRLLQ 120

Query: 280 RLAESRGIALFAIDEVHCVSKWGHDFRPDYRRLSVLRENFGANNLKSLKFDIPLMALTAT 339
            L E +GI L A+DE HC+S+WGHDFRPDY+ L  L++ F          ++P+MALTAT
Sbjct: 121 TLEERKGITLIAVDEAHCISQWGHDFRPDYKALGSLKQKFP---------NVPIMALTAT 171

Query: 340 ATIQVREDILKSLHMSKGTKFVLTSFFRPNLRFSVKHSKT 379
           A+  VREDIL+ L++     F  TSF RPNL + V+    
Sbjct: 172 ASPSVREDILRQLNLKNPQIFC-TSFDRPNLYYEVRRKTP 210

All proteins in this family for which functions are known are 3'-5' DNA-DNA helicases. These proteins are used for recombination, recombinational repair, and possibly maintenance of chromosome stability. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 470
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|218292 pfam04851, ResIII, Type III restriction enzyme, res subunit Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|201355 pfam00627, UBA, UBA/TS-N domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 774
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0353695 consensus ATP-dependent DNA helicase [General func 100.0
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00110545 helicase; Provisional 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0334 997 consensus RNA helicase [RNA processing and modific 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
PRK106891147 transcription-repair coupling factor; Provisional 100.0
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
KOG0354746 consensus DEAD-box like helicase [General function 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
PRK13766 773 Hef nuclease; Provisional 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
PRK09200790 preprotein translocase subunit SecA; Reviewed 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
COG1202 830 Superfamily II helicase, archaea-specific [General 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 100.0
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 100.0
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK04914 956 ATP-dependent helicase HepA; Validated 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.98
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.97
PRK05580679 primosome assembly protein PriA; Validated 99.97
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.97
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.97
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.97
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.97
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.96
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.96
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.96
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.95
PRK09694878 helicase Cas3; Provisional 99.95
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.95
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.95
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.95
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.94
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.94
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.94
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.94
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.94
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.93
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.93
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.92
KOG0387 923 consensus Transcription-coupled repair protein CSB 99.92
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.92
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.92
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.9
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.88
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.87
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.85
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.85
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.84
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.84
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 99.84
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.84
PRK05298652 excinuclease ABC subunit B; Provisional 99.84
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.83
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.83
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.82
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.82
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.82
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.82
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 99.82
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.81
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 99.81
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.8
COG4096 875 HsdR Type I site-specific restriction-modification 99.77
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.75
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.73
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.73
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.73
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 99.73
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.73
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 99.72
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 99.72
smart00487201 DEXDc DEAD-like helicases superfamily. 99.71
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.71
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.7
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.7
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.7
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.69
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.68
COG4889 1518 Predicted helicase [General function prediction on 99.68
KOG1123776 consensus RNA polymerase II transcription initiati 99.65
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.64
KOG4439901 consensus RNA polymerase II transcription terminat 99.63
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.6
KOG1002791 consensus Nucleotide excision repair protein RAD16 99.6
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.58
smart0049082 HELICc helicase superfamily c-terminal domain. 99.57
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.57
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.56
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.5
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.5
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 99.47
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.44
PRK14873665 primosome assembly protein PriA; Provisional 99.43
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.43
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 99.39
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 99.38
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.32
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.19
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.15
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 99.07
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.02
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.86
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.86
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.79
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.77
COG0610 962 Type I site-specific restriction-modification syst 98.74
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 98.73
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.69
KOG1001674 consensus Helicase-like transcription factor HLTF/ 98.51
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.49
KOG0383696 consensus Predicted helicase [General function pre 98.4
PF09382106 RQC: RQC domain; InterPro: IPR018982 This entry re 98.39
PRK15483 986 type III restriction-modification system StyLTI en 98.28
KOG2340698 consensus Uncharacterized conserved protein [Funct 98.26
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 98.26
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.79
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.77
TIGR00376637 DNA helicase, putative. The gene product may repre 97.66
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 97.58
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.58
KOG1803649 consensus DNA helicase [Replication, recombination 97.31
KOG18051100 consensus DNA replication helicase [Replication, r 97.24
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.23
PF1324576 AAA_19: Part of AAA domain 97.22
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.18
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.15
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 96.98
COG3587 985 Restriction endonuclease [Defense mechanisms] 96.88
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.86
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 96.79
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.79
PRK10875615 recD exonuclease V subunit alpha; Provisional 96.69
KOG1132945 consensus Helicase of the DEAD superfamily [Replic 96.63
KOG1131 755 consensus RNA polymerase II transcription initiati 96.62
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 96.55
KOG0298 1394 consensus DEAD box-containing helicase-like transc 96.51
PRK10536262 hypothetical protein; Provisional 96.49
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.46
PRK14974336 cell division protein FtsY; Provisional 96.43
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.38
smart00491142 HELICc2 helicase superfamily c-terminal domain. 96.31
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.27
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.18
PRK08727233 hypothetical protein; Validated 96.08
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.08
PRK08181269 transposase; Validated 96.06
PRK06526254 transposase; Provisional 95.94
PRK08084235 DNA replication initiation factor; Provisional 95.89
PF13871278 Helicase_C_4: Helicase_C-like 95.74
PRK06893229 DNA replication initiation factor; Validated 95.72
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 95.66
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 95.61
smart00382148 AAA ATPases associated with a variety of cellular 95.61
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 95.52
PF00004132 AAA: ATPase family associated with various cellula 95.51
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.51
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 95.49
PRK13889988 conjugal transfer relaxase TraA; Provisional 95.45
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 95.39
PRK12377248 putative replication protein; Provisional 95.36
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.32
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.3
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.28
PRK06835329 DNA replication protein DnaC; Validated 95.23
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.22
PRK06921266 hypothetical protein; Provisional 95.16
PRK04296190 thymidine kinase; Provisional 95.14
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 95.13
PRK05642234 DNA replication initiation factor; Validated 94.95
PRK08903227 DnaA regulatory inactivator Hda; Validated 94.93
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 94.8
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 94.79
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 94.69
PTZ001121164 origin recognition complex 1 protein; Provisional 94.68
PRK12422445 chromosomal replication initiation protein; Provis 94.67
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.63
PRK07952244 DNA replication protein DnaC; Validated 94.62
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 94.59
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.53
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.44
PHA02533534 17 large terminase protein; Provisional 94.43
TIGR00362405 DnaA chromosomal replication initiator protein Dna 94.32
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 94.31
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 94.29
PRK05580 679 primosome assembly protein PriA; Validated 94.21
PRK08116268 hypothetical protein; Validated 94.14
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 94.09
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.04
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 93.98
TIGR00595 505 priA primosomal protein N'. All proteins in this f 93.98
COG2256436 MGS1 ATPase related to the helicase subunit of the 93.97
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 93.93
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 93.92
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 93.88
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 93.88
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.86
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 93.86
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 93.77
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 93.75
PRK00149450 dnaA chromosomal replication initiation protein; R 93.71
PRK13833323 conjugal transfer protein TrbB; Provisional 93.7
PRK05973237 replicative DNA helicase; Provisional 93.69
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 93.64
PRK13897606 type IV secretion system component VirD4; Provisio 93.63
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 93.61
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 93.57
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 93.56
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 93.55
PRK14088440 dnaA chromosomal replication initiation protein; P 93.53
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 93.52
PF13173128 AAA_14: AAA domain 93.52
TIGR02928365 orc1/cdc6 family replication initiation protein. M 93.51
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 93.45
PRK05707328 DNA polymerase III subunit delta'; Validated 93.42
PRK14087450 dnaA chromosomal replication initiation protein; P 93.39
PLN03025319 replication factor C subunit; Provisional 93.35
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 93.34
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 93.29
PRK04195482 replication factor C large subunit; Provisional 93.23
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 93.23
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 93.22
PRK09112351 DNA polymerase III subunit delta'; Validated 93.13
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 93.13
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.04
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 93.04
PRK10416318 signal recognition particle-docking protein FtsY; 93.02
PRK13342413 recombination factor protein RarA; Reviewed 92.95
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 92.94
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 92.93
TIGR00643630 recG ATP-dependent DNA helicase RecG. 92.91
PRK00771437 signal recognition particle protein Srp54; Provisi 92.84
PRK13850670 type IV secretion system protein VirD4; Provisiona 92.83
PRK11823446 DNA repair protein RadA; Provisional 92.81
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 92.68
PRK08769319 DNA polymerase III subunit delta'; Validated 92.66
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 92.63
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 92.63
TIGR00064272 ftsY signal recognition particle-docking protein F 92.59
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 92.58
PRK14873 665 primosome assembly protein PriA; Provisional 92.56
PRK04328249 hypothetical protein; Provisional 92.56
PRK06067234 flagellar accessory protein FlaH; Validated 92.54
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 92.48
PRK13894319 conjugal transfer ATPase TrbB; Provisional 92.34
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 92.28
PRK13826 1102 Dtr system oriT relaxase; Provisional 92.23
PRK07940394 DNA polymerase III subunit delta'; Validated 92.16
PRK10867433 signal recognition particle protein; Provisional 92.15
cd00983325 recA RecA is a bacterial enzyme which has roles in 92.11
PRK11331459 5-methylcytosine-specific restriction enzyme subun 92.04
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 91.97
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 91.93
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 91.93
TIGR02237209 recomb_radB DNA repair and recombination protein R 91.88
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 91.88
CHL00181287 cbbX CbbX; Provisional 91.8
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 91.77
PRK09361225 radB DNA repair and recombination protein RadB; Pr 91.76
PRK13822641 conjugal transfer coupling protein TraG; Provision 91.75
PRK07471365 DNA polymerase III subunit delta'; Validated 91.68
PRK09354349 recA recombinase A; Provisional 91.67
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 91.66
cd03115173 SRP The signal recognition particle (SRP) mediates 91.65
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 91.63
PRK12402337 replication factor C small subunit 2; Reviewed 91.63
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 91.62
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 91.57
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 91.36
COG0593408 DnaA ATPase involved in DNA replication initiation 91.34
PRK08533230 flagellar accessory protein FlaH; Reviewed 91.33
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 91.31
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 91.31
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 91.3
PRK14086617 dnaA chromosomal replication initiation protein; P 91.28
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 91.24
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 91.18
PHA03368738 DNA packaging terminase subunit 1; Provisional 91.17
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 91.17
TIGR02767623 TraG-Ti Ti-type conjugative transfer system protie 91.12
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 90.98
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 90.9
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 90.85
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 90.83
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 90.81
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 90.77
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 90.74
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 90.73
PRK13876663 conjugal transfer coupling protein TraG; Provision 90.63
TIGR02012321 tigrfam_recA protein RecA. This model describes or 90.62
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 90.6
TIGR00767415 rho transcription termination factor Rho. Members 90.6
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 90.57
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 90.5
PRK06871325 DNA polymerase III subunit delta'; Validated 90.47
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 90.4
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 90.36
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 90.3
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 90.26
PRK06964342 DNA polymerase III subunit delta'; Validated 90.26
TIGR00959428 ffh signal recognition particle protein. This mode 90.21
cd01394218 radB RadB. The archaeal protein radB shares simila 90.11
PHA02544316 44 clamp loader, small subunit; Provisional 90.01
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 89.89
TIGR02688449 conserved hypothetical protein TIGR02688. Members 89.69
PHA03333752 putative ATPase subunit of terminase; Provisional 89.64
PRK07133725 DNA polymerase III subunits gamma and tau; Validat 89.59
PRK06904472 replicative DNA helicase; Validated 89.59
TIGR00665434 DnaB replicative DNA helicase. This model describe 89.51
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 89.49
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 89.46
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 89.4
COG1198 730 PriA Primosomal protein N' (replication factor Y) 89.38
PHA00729226 NTP-binding motif containing protein 89.34
PRK06321472 replicative DNA helicase; Provisional 89.32
PRK08939306 primosomal protein DnaI; Reviewed 89.29
PRK10689 1147 transcription-repair coupling factor; Provisional 89.28
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 89.2
PRK13880636 conjugal transfer coupling protein TraG; Provision 89.16
PRK06090319 DNA polymerase III subunit delta'; Validated 89.13
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 89.13
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 89.06
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 89.05
PRK09165497 replicative DNA helicase; Provisional 89.04
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 89.01
PRK05636505 replicative DNA helicase; Provisional 88.91
PRK13341725 recombination factor protein RarA/unknown domain f 88.89
KOG1133821 consensus Helicase of the DEAD superfamily [Replic 88.86
cd01393226 recA_like RecA is a bacterial enzyme which has rol 88.83
KOG2028554 consensus ATPase related to the helicase subunit o 88.7
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 88.62
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 88.61
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 88.59
PRK11054684 helD DNA helicase IV; Provisional 88.55
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 88.41
PRK08760476 replicative DNA helicase; Provisional 88.4
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 88.39
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 88.32
PRK05595444 replicative DNA helicase; Provisional 88.29
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 88.18
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 88.13
COG1200677 RecG RecG-like helicase [DNA replication, recombin 88.05
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 88.03
KOG0347 731 consensus RNA helicase [RNA processing and modific 87.97
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 87.91
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 87.86
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 87.81
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 87.79
PRK08840464 replicative DNA helicase; Provisional 87.73
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 87.71
PRK07993334 DNA polymerase III subunit delta'; Validated 87.59
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 87.53
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 87.53
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 87.48
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 87.47
CHL00176638 ftsH cell division protein; Validated 87.47
KOG0734752 consensus AAA+-type ATPase containing the peptidas 87.41
KOG2543438 consensus Origin recognition complex, subunit 5 [R 87.25
COG2255332 RuvB Holliday junction resolvasome, helicase subun 87.17
PRK09376416 rho transcription termination factor Rho; Provisio 86.95
PRK14701 1638 reverse gyrase; Provisional 86.94
PTZ00293211 thymidine kinase; Provisional 86.9
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 86.63
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 86.62
COG0470325 HolB ATPase involved in DNA replication [DNA repli 86.61
PRK05748448 replicative DNA helicase; Provisional 86.6
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 86.48
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 86.41
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 86.32
PRK13851344 type IV secretion system protein VirB11; Provision 86.3
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 86.27
PHA00350399 putative assembly protein 86.27
COG4185187 Uncharacterized protein conserved in bacteria [Fun 86.27
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 86.17
PRK08506472 replicative DNA helicase; Provisional 86.13
PRK03992389 proteasome-activating nucleotidase; Provisional 85.77
PRK08699325 DNA polymerase III subunit delta'; Validated 85.72
PTZ00035337 Rad51 protein; Provisional 85.72
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 85.7
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 85.56
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 85.41
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 85.35
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 85.14
PRK04301317 radA DNA repair and recombination protein RadA; Va 85.03
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 84.97
PRK08006471 replicative DNA helicase; Provisional 84.86
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 84.8
PHA02542473 41 41 helicase; Provisional 84.78
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 84.78
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 84.59
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 84.59
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 84.42
PRK10865857 protein disaggregation chaperone; Provisional 84.41
CHL00095821 clpC Clp protease ATP binding subunit 84.36
cd01128249 rho_factor Transcription termination factor rho is 84.31
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 84.29
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 84.21
PRK00440319 rfc replication factor C small subunit; Reviewed 84.19
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 84.15
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 84.09
PRK12608380 transcription termination factor Rho; Provisional 83.89
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 83.57
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 83.52
PRK08058329 DNA polymerase III subunit delta'; Validated 83.4
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 83.21
PRK09302509 circadian clock protein KaiC; Reviewed 82.91
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 82.83
PRK102631355 DNA translocase FtsK; Provisional 82.75
PRK07004460 replicative DNA helicase; Provisional 82.64
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 82.62
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 82.59
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 82.59
KOG0745564 consensus Putative ATP-dependent Clp-type protease 82.38
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 82.34
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 82.26
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 82.2
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 82.09
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 82.02
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 81.98
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 81.98
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 81.82
PF00154322 RecA: recA bacterial DNA recombination protein; In 81.81
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 81.67
PRK09519 790 recA DNA recombination protein RecA; Reviewed 81.56
cd01125239 repA Hexameric Replicative Helicase RepA. RepA is 81.51
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 81.45
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 81.37
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 81.3
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 81.11
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 80.92
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 80.88
PRK07399314 DNA polymerase III subunit delta'; Validated 80.76
COG1618179 Predicted nucleotide kinase [Nucleotide transport 80.72
COG3973747 Superfamily I DNA and RNA helicases [General funct 80.7
KOG18061320 consensus DEAD box containing helicases [Replicati 80.68
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 80.21
PRK09183259 transposase/IS protein; Provisional 80.13
TIGR03743634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 80.12
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.4e-88  Score=783.19  Aligned_cols=488  Identities=33%  Similarity=0.489  Sum_probs=409.7

Q ss_pred             CCCcccCCCChHHHHHHHHHHhcCCCCCCHHHHHHHHHHHcCCCEEEEecCCCchHHHHHHhhhccCCeEEEEccchHHH
Q 004098          147 CPKEVEIGSDWEVKVNSLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLM  226 (774)
Q Consensus       147 ~~~~~~~~~~~~~~l~~~L~~~~g~~~~r~~Q~~ai~~il~g~d~lv~apTGsGKTl~~~lpal~~~~~~LVvsPt~~L~  226 (774)
                      .+.+....++|...+...++++||+..|||+|.++|++++.|+|+|++||||+|||+||+||++...+.+|||+||++||
T Consensus       434 ~~~W~~~~fpw~~~L~~~lk~~FG~~sFRp~Q~eaI~aiL~GrDVLVimPTGSGKSLcYQLPAL~~~GiTLVISPLiSLm  513 (1195)
T PLN03137        434 DKKWSSRNFPWTKKLEVNNKKVFGNHSFRPNQREIINATMSGYDVFVLMPTGGGKSLTYQLPALICPGITLVISPLVSLI  513 (1195)
T ss_pred             CccccccCCCchHHHHHHHHHHcCCCCCCHHHHHHHHHHHcCCCEEEEcCCCccHHHHHHHHHHHcCCcEEEEeCHHHHH
Confidence            34455578999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhcCCcEEEEcCCCChHHHHHHH---Hc--CCceEEEEChHHHHH---HHHHHHHHHHhcCccEEEEeccccc
Q 004098          227 HDQCSKLSKHGVTACFLGSGQPDNKVEQKA---LR--GMYSIIYVCPETVIR---LIKPLQRLAESRGIALFAIDEVHCV  298 (774)
Q Consensus       227 ~qq~~~l~~~gi~~~~l~~~~~~~~~~~~~---~~--~~~~Ilv~TPe~l~~---ll~~~~~~~~~~~i~~iVIDEaH~l  298 (774)
                      +||+..+...|++++.++++.........+   ..  +.++|||+|||+|..   ++..+..+.....+.+||||||||+
T Consensus       514 qDQV~~L~~~GI~Aa~L~s~~s~~eq~~ilr~l~s~~g~~~ILyvTPERL~~~d~ll~~L~~L~~~~~LslIVIDEAHcV  593 (1195)
T PLN03137        514 QDQIMNLLQANIPAASLSAGMEWAEQLEILQELSSEYSKYKLLYVTPEKVAKSDSLLRHLENLNSRGLLARFVIDEAHCV  593 (1195)
T ss_pred             HHHHHHHHhCCCeEEEEECCCCHHHHHHHHHHHHhcCCCCCEEEEChHHhhcchHHHHHHHhhhhccccceeccCcchhh
Confidence            999999999999999999988765433222   22  678999999999863   3333333334456899999999999


Q ss_pred             ccCCCCcHHHHHHHHHHHHHhcccccccccCCCCEEEEeccCCHHHHHHHHHHcCCCCCceEEEccCCCCCcEEEEeecC
Q 004098          299 SKWGHDFRPDYRRLSVLRENFGANNLKSLKFDIPLMALTATATIQVREDILKSLHMSKGTKFVLTSFFRPNLRFSVKHSK  378 (774)
Q Consensus       299 ~~~g~~fr~~~~~l~~l~~~~~~~~~~~l~~~~~il~lTAT~~~~~~~~i~~~L~~~~~~~~~~~~~~r~~l~~~v~~~~  378 (774)
                      ++|||+||++|+.|..++..|+         .+|+++||||+++.+.+++...|++. .+.++..+++|||+.|.|....
T Consensus       594 SqWGhDFRpdYr~L~~Lr~~fp---------~vPilALTATAT~~V~eDI~~~L~l~-~~~vfr~Sf~RpNL~y~Vv~k~  663 (1195)
T PLN03137        594 SQWGHDFRPDYQGLGILKQKFP---------NIPVLALTATATASVKEDVVQALGLV-NCVVFRQSFNRPNLWYSVVPKT  663 (1195)
T ss_pred             hhcccchHHHHHHHHHHHHhCC---------CCCeEEEEecCCHHHHHHHHHHcCCC-CcEEeecccCccceEEEEeccc
Confidence            9999999999999999998887         78999999999999999999999987 5778889999999999887532


Q ss_pred             CccchhhhHhHHHHHHHHHhhhcccccccccCCCcCCCccCccCCCcccccccCCCCCCCCCCCCccCCCCCCccchhhh
Q 004098          379 TSSRASYKKDFCQLIDIYTKKKKTGEKEKSAIPQDLDDQSDTSSSSSMSEESRISPNIGDGYYDDEDVGNSPMGKEMSVE  458 (774)
Q Consensus       379 ~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  458 (774)
                      ..       .+..+..                                                                
T Consensus       664 kk-------~le~L~~----------------------------------------------------------------  672 (1195)
T PLN03137        664 KK-------CLEDIDK----------------------------------------------------------------  672 (1195)
T ss_pred             hh-------HHHHHHH----------------------------------------------------------------
Confidence            10       0111111                                                                


Q ss_pred             hhhcCCCcccccccccccCCCCCCCCCCccchhhccccCchhHhhhhccCCCCCCcEEEEeCchHHHHHHHHHHHhCCCc
Q 004098          459 FLENDSVDDWDVACGEFYGHSPHRDRDTDRSFERTDLLNKPAERLSMLQEPLEDGLTIIYVPTRKETLSIAKYLCGFGVK  538 (774)
Q Consensus       459 ~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~ll~~L~~~~~~~~~IIF~~sr~~~~~l~~~L~~~g~~  538 (774)
                      |                                              +.......++||||.|++.|+.++..|...|++
T Consensus       673 ~----------------------------------------------I~~~~~~esgIIYC~SRke~E~LAe~L~~~Gik  706 (1195)
T PLN03137        673 F----------------------------------------------IKENHFDECGIIYCLSRMDCEKVAERLQEFGHK  706 (1195)
T ss_pred             H----------------------------------------------HHhcccCCCceeEeCchhHHHHHHHHHHHCCCC
Confidence            1                                              111113457999999999999999999999999


Q ss_pred             eEEecCCCCHHHHHHHHHHHhcCCceEEEEecccccCcccCCcceEEEeCCCCCHHHHHHHhhccccCCCcceEEEEeeC
Q 004098          539 AAAYNASLPKSQLRRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWPQSLEAYYQEAGRAGRDGHLADCVLYANL  618 (774)
Q Consensus       539 ~~~~h~~l~~~~R~~~~~~F~~g~~~vLVAT~a~~~GIDip~V~~VI~~d~p~s~~~y~Qr~GRaGR~G~~g~~il~~~~  618 (774)
                      +..|||+|++++|..++++|.+|+++|||||++||||||+|+|++||||++|.|++.|+||+|||||+|.+|.|++||+.
T Consensus       707 a~~YHAGLs~eeR~~vqe~F~~Gei~VLVATdAFGMGIDkPDVR~VIHydlPkSiEsYyQriGRAGRDG~~g~cILlys~  786 (1195)
T PLN03137        707 AAFYHGSMDPAQRAFVQKQWSKDEINIICATVAFGMGINKPDVRFVIHHSLPKSIEGYHQECGRAGRDGQRSSCVLYYSY  786 (1195)
T ss_pred             eeeeeCCCCHHHHHHHHHHHhcCCCcEEEEechhhcCCCccCCcEEEEcCCCCCHHHHHhhhcccCCCCCCceEEEEecH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             CCCCc---cCCCCCC---------------HHHHHHHHHHHHHHHHhccccchhHHHHHHHHcCCCCCCcCCCC-CCCCC
Q 004098          619 SSMPT---LLPSRRS---------------EDQTKQAYRMLSDCFRYGMNTSCCRAKILVEYFGEDFSHEKCQL-CDVCV  679 (774)
Q Consensus       619 ~~~~~---~~~~~~~---------------~~~~~~~~~~l~~~~~y~~~~~~Crr~~l~~~f~~~~~~~~c~~-Cd~C~  679 (774)
                      .|...   ++.....               ....+..++.|..|++||.++..|||++||.||||.+....|+. ||||.
T Consensus       787 ~D~~~~~~lI~~~~~~~s~~~~~~~r~~~s~~~~e~~~~~L~~m~~yce~~~~CRR~~lL~yFGE~~~~~~C~~~CDnC~  866 (1195)
T PLN03137        787 SDYIRVKHMISQGGVEQSPMAMGYNRMASSGRILETNTENLLRMVSYCENEVDCRRFLQLVHFGEKFDSTNCKKTCDNCS  866 (1195)
T ss_pred             HHHHHHHHHHhccccccchhhhhhcccchhHHHHHHHHHHHHHHHHHHhChHhhHHHHHHHHcccccCccCCCCCCCCCC
Confidence            76532   2211100               11123356778889999976679999999999999986668985 99999


Q ss_pred             CCCCc-ccchHHHHHHHHHHHHHHhccCCccc-ceeeeccCcccccccCCCCccchhhhhhhhhhccccCCHHHHHHHHH
Q 004098          680 DGPPE-MKNLKEEANILMQVIAAYNEQSNSMD-DDDGIYSGIKKQKFMDRPNLKMFVSKIREQSQKYLATDLLWWRGLAR  757 (774)
Q Consensus       680 ~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  757 (774)
                      +.+.. ..|+|++|+++++||.+++++++... +|+++|+.+++.+..+++.|++| |       .+++.+..+|+.+++
T Consensus       867 ~~~~~~~~D~T~~Aq~~ls~V~~~~~~fg~~~iidvlrGs~~~~i~~~~~d~l~~~-G-------~gk~~s~~~~~~li~  938 (1195)
T PLN03137        867 SSKSLIDKDVTEIARQLVELVKLTGERFSSAHILEVYRGSLNQYVKKHRHETLSLH-G-------AGKHLSKGEASRILH  938 (1195)
T ss_pred             CCCcccccccHHHHHHHHHHHHHhccCcchhheehhhhccccHHHHHhCccccccc-C-------ccccCCHHHHHHHHH
Confidence            84332 36999999999999999766665533 89999987776555566788888 2       335788999999999


Q ss_pred             HHHHcCCceecC
Q 004098          758 IMENKGYIREGD  769 (774)
Q Consensus       758 ~~~~~~~~~~~~  769 (774)
                      +|+.+|||.+..
T Consensus       939 ~Li~~g~L~~~~  950 (1195)
T PLN03137        939 YLVTEDILAEDV  950 (1195)
T ss_pred             HHHHcCCceeec
Confidence            999999999865

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PF09382 RQC: RQC domain; InterPro: IPR018982 This entry represents the RQC domain, which is a DNA-binding domain found only in RecQ family enzymes Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK06321 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09165 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05636 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK08760 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK08840 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00035 Rad51 protein; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK08006 replicative DNA helicase; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>cd01125 repA Hexameric Replicative Helicase RepA Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>KOG1806 consensus DEAD box containing helicases [Replication, recombination and repair] Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query774
1oyy_A523 Structure Of The Recq Catalytic Core Bound To Atp-G 8e-38
1oyy_A523 Structure Of The Recq Catalytic Core Bound To Atp-G 4e-29
1oyw_A523 Structure Of The Recq Catalytic Core Length = 523 3e-36
1oyw_A523 Structure Of The Recq Catalytic Core Length = 523 1e-27
2v1x_A591 Crystal Structure Of Human Recq-Like Dna Helicase L 2e-34
2v1x_A591 Crystal Structure Of Human Recq-Like Dna Helicase L 7e-29
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 1e-08
2jgn_A185 Ddx3 Helicase Domain Length = 185 1e-07
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 2e-07
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 3e-06
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 5e-06
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 6e-06
1t5i_A172 Crystal Structure Of The C-Terminal Domain Of Uap56 6e-06
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 6e-06
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 8e-06
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 1e-05
2wax_A193 Structure Of The Human Ddx6 C-Terminal Domain In Co 2e-05
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 8e-05
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 9e-05
2yjt_D170 Crystal Structure Of E. Coli Dead-Box Protein Srmb 1e-04
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 2e-04
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure 
Iteration: 1

 Score =  155 bits (392), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 88/220 (40%), Positives = 126/220 (57%), Gaps = 15/220 (6%)
Query: 156 DWEVKVNSLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKV 215
           + E     +L++ FG+   +  Q+E +   L+  DCLV+  TG GKSLC+QIPALL   +
Sbjct: 8   NLESGAKQVLQETFGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLLNGL 67
Query: 216 VVVISPLISLMHDQCSKLSKHGVTACFLGSGQPDNK---VEQKALRGMYSIIYVCPETVI 272
            VV+SPLISLM DQ  +L  +GV A  L S Q   +   V      G   ++Y+ PE ++
Sbjct: 68  TVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQLEVMTGCRTGQIRLLYIAPERLM 127
Query: 273 RLIKPLQRLAESRGIALFAIDEVHCVSKWGHDFRPDYRRLSVLRENFGANNLKSLKFDIP 332
            L   L+ LA    + L A+DE HC+S+WGHDFRP+Y  L  LR+ F           +P
Sbjct: 128 -LDNFLEHLAHWNPV-LLAVDEAHCISQWGHDFRPEYAALGQLRQRFPT---------LP 176
Query: 333 LMALTATATIQVREDILKSLHMSKGTKFVLTSFFRPNLRF 372
            MALTATA    R+DI++ L ++      ++SF RPN+R+
Sbjct: 177 FMALTATADDTTRQDIVRLLGLNDPL-IQISSFDRPNIRY 215
>pdb|1OYY|A Chain A, Structure Of The Recq Catalytic Core Bound To Atp-Gamma-S Length = 523 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|1OYW|A Chain A, Structure Of The Recq Catalytic Core Length = 523 Back     alignment and structure
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure
>pdb|2V1X|A Chain A, Crystal Structure Of Human Recq-Like Dna Helicase Length = 591 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1T5I|A Chain A, Crystal Structure Of The C-Terminal Domain Of Uap56 Length = 172 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|2WAX|A Chain A, Structure Of The Human Ddx6 C-Terminal Domain In Complex With An Edc3-Fdf Peptide Length = 193 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|2YJT|D Chain D, Crystal Structure Of E. Coli Dead-Box Protein Srmb Bound To Regulator Of Ribonuclease Activity A (Rraa) Length = 170 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query774
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 3e-82
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 2e-55
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 6e-81
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 2e-51
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-09
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 2e-11
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 3e-10
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 4e-10
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 5e-10
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 8e-10
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-09
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 1e-08
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 1e-08
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 2e-08
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 2e-08
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 2e-08
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 5e-08
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 5e-08
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 7e-08
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 9e-08
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 2e-07
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 3e-07
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 1e-06
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 2e-06
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 3e-06
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 2e-06
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 2e-06
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 3e-04
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 2e-06
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 2e-06
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 2e-06
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 3e-06
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 3e-06
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 4e-06
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 5e-06
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 6e-06
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 6e-06
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 6e-06
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 7e-06
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 7e-06
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 8e-06
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-05
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 2e-05
3b6e_A216 Interferon-induced helicase C domain-containing P; 4e-05
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 8e-05
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 1e-04
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 1e-04
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 1e-04
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 3e-04
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 4e-04
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 5e-04
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
 Score =  273 bits (700), Expect = 3e-82
 Identities = 86/245 (35%), Positives = 125/245 (51%), Gaps = 19/245 (7%)

Query: 157 WEVKVNSLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVV 216
           W  KV  +L+  F     +  Q E ++  +A  +  ++  TG GKSLC+Q+PAL +    
Sbjct: 28  WSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFT 87

Query: 217 VVISPLISLMHDQCSKLSKHGVTACFLGSGQPD---NKVEQKAL--RGMYSIIYVCPETV 271
           +VI PLISLM DQ   L + G++A  L +         V  + +       +IYV PE +
Sbjct: 88  LVICPLISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTPEKI 147

Query: 272 I---RLIKPLQRLAESRGIALFAIDEVHCVSKWGHDFRPDYRRLSVLRENFGANNLKSLK 328
                 +  L++  E+R     A+DEVHC S+WGHDFRPDY+ L +L+  F         
Sbjct: 148 AKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGILKRQFP-------- 199

Query: 329 FDIPLMALTATATIQVREDILKSLHMSKGTKFVLTSFFRPNLRFSVKHSKTSSRASYKKD 388
            +  L+ LTATAT  V  D  K L + K   F   SF RPNL + V+  K S+   + +D
Sbjct: 200 -NASLIGLTATATNHVLTDAQKILCIEKCFTFT-ASFNRPNLYYEVRQ-KPSNTEDFIED 256

Query: 389 FCQLI 393
             +LI
Sbjct: 257 IVKLI 261
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Length = 591 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Length = 523 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 49 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query774
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 100.0
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.98
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.97
3jux_A822 Protein translocase subunit SECA; protein transloc 99.97
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.96
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.96
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.96
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.96
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.95
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.95
3bor_A237 Human initiation factor 4A-II; translation initiat 99.95
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.95
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.95
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.95
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.95
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.95
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.95
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.95
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.94
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.94
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.94
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.94
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.93
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.91
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.91
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.91
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.91
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.9
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.9
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.9
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.89
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.87
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.79
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.85
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.81
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.8
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.79
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.74
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.73
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.69
3aaf_A134 Werner syndrome ATP-dependent helicase; helix-turn 98.87
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.28
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 98.18
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.78
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.73
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.52
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.5
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.23
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.03
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.53
1wji_A63 Tudor domain containing protein 3; UBA domain, str 96.46
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 96.38
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.06
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 95.89
3co5_A143 Putative two-component system transcriptional RES 95.89
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 95.82
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 95.71
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 95.68
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 95.45
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.39
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 95.25
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 95.05
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 95.03
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.0
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 94.97
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 94.93
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 94.61
2cos_A54 Serine/threonine protein kinase LATS2; UBA domain, 94.54
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 94.53
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.48
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 94.44
1xp8_A366 RECA protein, recombinase A; recombination, radior 94.35
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 94.34
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.3
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 94.29
2z43_A324 DNA repair and recombination protein RADA; archaea 94.27
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 94.25
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 94.22
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 94.2
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.13
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 94.13
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 94.02
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 93.99
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 93.97
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 93.8
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 93.8
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.77
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 93.77
1u94_A356 RECA protein, recombinase A; homologous recombinat 93.76
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 93.72
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 93.63
2r6a_A454 DNAB helicase, replicative helicase; replication, 93.61
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 93.6
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 93.59
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 93.56
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 93.53
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.48
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 93.45
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 93.38
3bos_A242 Putative DNA replication factor; P-loop containing 93.3
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 93.29
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 93.23
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 93.22
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 93.11
2cvh_A220 DNA repair and recombination protein RADB; filamen 93.1
2v1u_A387 Cell division control protein 6 homolog; DNA repli 93.08
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 93.07
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 92.9
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 92.89
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 92.83
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 92.81
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 92.8
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 92.74
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 92.73
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 92.56
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 92.56
2dna_A67 Unnamed protein product; ubiquitin associated doma 92.55
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 92.37
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 92.26
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 92.22
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 92.18
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 91.9
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 91.81
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 91.6
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 91.51
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 91.44
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 91.36
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 91.35
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 91.29
3pvs_A447 Replication-associated recombination protein A; ma 91.28
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 91.24
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 91.22
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 91.18
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 91.16
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 90.99
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 90.68
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 90.61
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 90.57
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 90.42
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 90.33
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 90.29
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 90.13
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 90.03
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 90.0
2qgz_A308 Helicase loader, putative primosome component; str 89.99
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 89.87
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 89.74
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 89.68
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 89.64
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 89.52
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 89.45
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 89.38
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 89.37
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 89.33
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 89.27
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 89.11
2gno_A305 DNA polymerase III, gamma subunit-related protein; 89.03
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 89.01
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 88.91
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 88.75
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 88.74
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 88.51
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 88.51
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 88.43
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 88.3
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 87.99
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 87.92
2cwb_A108 Chimera of immunoglobulin G binding protein G and 87.86
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 87.77
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 87.5
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 87.39
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 87.33
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 87.27
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 87.04
1vma_A306 Cell division protein FTSY; TM0570, structural gen 86.95
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 86.86
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 86.76
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 86.7
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 86.47
3io5_A333 Recombination and repair protein; storage dimer, i 86.04
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 85.97
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 85.95
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 85.84
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 85.78
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 85.67
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 85.66
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 85.22
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 85.1
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 84.98
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 84.96
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 84.86
1ojl_A304 Transcriptional regulatory protein ZRAR; response 84.82
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 84.67
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 84.62
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 84.27
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 84.05
4a74_A231 DNA repair and recombination protein RADA; hydrola 84.01
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 83.82
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 83.72
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 83.49
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 82.79
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 82.75
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 82.67
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 82.33
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 82.09
3bor_A237 Human initiation factor 4A-II; translation initiat 81.9
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 81.83
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 80.91
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 80.67
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 80.17
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 80.14
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 80.07
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
Probab=100.00  E-value=2.2e-79  Score=707.95  Aligned_cols=472  Identities=32%  Similarity=0.536  Sum_probs=397.5

Q ss_pred             cCCCChHHHHHHHHHHhcCCCCCCHHHHHHHHHHHcCCCEEEEecCCCchHHHHHHhhhccCCeEEEEccchHHHHHHHH
Q 004098          152 EIGSDWEVKVNSLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGKVVVVISPLISLMHDQCS  231 (774)
Q Consensus       152 ~~~~~~~~~l~~~L~~~~g~~~~r~~Q~~ai~~il~g~d~lv~apTGsGKTl~~~lpal~~~~~~LVvsPt~~L~~qq~~  231 (774)
                      ...++|...+.+.|++.|||..|||+|.++|+.+++|+|++++||||+|||+||++|++...+.+|||+|+++||.||++
T Consensus        23 ~~~~~l~~~l~~~L~~~fg~~~~rp~Q~~~i~~il~g~d~lv~~pTGsGKTl~~~lpal~~~g~~lVisP~~~L~~q~~~  102 (591)
T 2v1x_A           23 KEDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKSLCYQLPALCSDGFTLVICPLISLMEDQLM  102 (591)
T ss_dssp             CSCSTTHHHHHHHHHHTSCCCSCCTTHHHHHHHHHTTCCEEEECCTTSCTTHHHHHHHHTSSSEEEEECSCHHHHHHHHH
T ss_pred             cccCCCCHHHHHHHHHHhCCCCCCHHHHHHHHHHHcCCCEEEEECCCChHHHHHHHHHHHcCCcEEEEeCHHHHHHHHHH
Confidence            34678999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCcEEEEcCCCChHHHHHH---H--HcCCceEEEEChHHHH---HHHHHHHHHHHhcCccEEEEecccccccCCC
Q 004098          232 KLSKHGVTACFLGSGQPDNKVEQK---A--LRGMYSIIYVCPETVI---RLIKPLQRLAESRGIALFAIDEVHCVSKWGH  303 (774)
Q Consensus       232 ~l~~~gi~~~~l~~~~~~~~~~~~---~--~~~~~~Ilv~TPe~l~---~ll~~~~~~~~~~~i~~iVIDEaH~l~~~g~  303 (774)
                      .+.++|+.+..++++.........   +  ..+.++|+|+|||+|.   .++..+.....+.++++||||||||+++|||
T Consensus       103 ~l~~~gi~~~~l~~~~~~~~~~~~~~~l~~~~~~~~Ilv~Tpe~L~~~~~~~~~l~~~~~~~~i~~iViDEAH~is~~g~  182 (591)
T 2v1x_A          103 VLKQLGISATMLNASSSKEHVKWVHAEMVNKNSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGH  182 (591)
T ss_dssp             HHHHHTCCEEECCSSCCHHHHHHHHHHHHCTTCCCCEEEECHHHHHSCHHHHHHHHHHHHTTCEEEEEEETGGGGSTTCT
T ss_pred             HHHhcCCcEEEEeCCCCHHHHHHHHHHhhcccCCCCEEEEChhHhhccHHHHHHHHhhhhccCCcEEEEECccccccccc
Confidence            999999999999998876543222   2  2567899999999985   4555556666778999999999999999999


Q ss_pred             CcHHHHHHHHHHHHHhcccccccccCCCCEEEEeccCCHHHHHHHHHHcCCCCCceEEEccCCCCCcEEEEeecCCccch
Q 004098          304 DFRPDYRRLSVLRENFGANNLKSLKFDIPLMALTATATIQVREDILKSLHMSKGTKFVLTSFFRPNLRFSVKHSKTSSRA  383 (774)
Q Consensus       304 ~fr~~~~~l~~l~~~~~~~~~~~l~~~~~il~lTAT~~~~~~~~i~~~L~~~~~~~~~~~~~~r~~l~~~v~~~~~~~~~  383 (774)
                      +|++.|..|..++..++         ++|+++||||+++.+..++...|++. .+..+..++.++++.|.+........ 
T Consensus       183 dfr~~~~~l~~l~~~~~---------~~~ii~lSAT~~~~v~~~i~~~l~~~-~~~~~~~~~~r~nl~~~v~~~~~~~~-  251 (591)
T 2v1x_A          183 DFRPDYKALGILKRQFP---------NASLIGLTATATNHVLTDAQKILCIE-KCFTFTASFNRPNLYYEVRQKPSNTE-  251 (591)
T ss_dssp             TCCGGGGGGGHHHHHCT---------TSEEEEEESSCCHHHHHHHHHHTTCC-SCEEEECCCCCTTEEEEEEECCSSHH-
T ss_pred             ccHHHHHHHHHHHHhCC---------CCcEEEEecCCCHHHHHHHHHHhCCC-CcEEEecCCCCcccEEEEEeCCCcHH-
Confidence            99999999988888776         78999999999999999999999987 56778889999999999876432110 


Q ss_pred             hhhHhHHHHHHHHHhhhcccccccccCCCcCCCccCccCCCcccccccCCCCCCCCCCCCccCCCCCCccchhhhhhhcC
Q 004098          384 SYKKDFCQLIDIYTKKKKTGEKEKSAIPQDLDDQSDTSSSSSMSEESRISPNIGDGYYDDEDVGNSPMGKEMSVEFLEND  463 (774)
Q Consensus       384 ~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~  463 (774)
                         ..+..                                                                        
T Consensus       252 ---~~~~~------------------------------------------------------------------------  256 (591)
T 2v1x_A          252 ---DFIED------------------------------------------------------------------------  256 (591)
T ss_dssp             ---HHHHH------------------------------------------------------------------------
T ss_pred             ---HHHHH------------------------------------------------------------------------
Confidence               11111                                                                        


Q ss_pred             CCcccccccccccCCCCCCCCCCccchhhccccCchhHhhhhccCCCCCCcEEEEeCchHHHHHHHHHHHhCCCceEEec
Q 004098          464 SVDDWDVACGEFYGHSPHRDRDTDRSFERTDLLNKPAERLSMLQEPLEDGLTIIYVPTRKETLSIAKYLCGFGVKAAAYN  543 (774)
Q Consensus       464 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~ll~~L~~~~~~~~~IIF~~sr~~~~~l~~~L~~~g~~~~~~h  543 (774)
                                                            +++++.....+.++||||+|++.++.+++.|...|+.+..||
T Consensus       257 --------------------------------------l~~~l~~~~~~~~~IVf~~sr~~~e~la~~L~~~g~~~~~~h  298 (591)
T 2v1x_A          257 --------------------------------------IVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYH  298 (591)
T ss_dssp             --------------------------------------HHHHHTTTTTTCEEEEECSSHHHHHHHHHHHHHTTCCEEEEC
T ss_pred             --------------------------------------HHHHHHHhccCCCeEEEeCcHHHHHHHHHHHHHCCCCEEEec
Confidence                                                  122222222467899999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHHHHhcCCceEEEEecccccCcccCCcceEEEeCCCCCHHHHHHHhhccccCCCcceEEEEeeCCCCCc
Q 004098          544 ASLPKSQLRRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWPQSLEAYYQEAGRAGRDGHLADCVLYANLSSMPT  623 (774)
Q Consensus       544 ~~l~~~~R~~~~~~F~~g~~~vLVAT~a~~~GIDip~V~~VI~~d~p~s~~~y~Qr~GRaGR~G~~g~~il~~~~~~~~~  623 (774)
                      |+|++++|..++++|++|+++|||||++++||||+|+|++||||++|.|+++|+||+|||||+|++|.|++||++.|...
T Consensus       299 ~~l~~~~R~~~~~~F~~g~~~VlVAT~a~~~GID~p~V~~VI~~~~p~s~~~y~Qr~GRaGR~G~~g~~i~l~~~~D~~~  378 (591)
T 2v1x_A          299 ANLEPEDKTTVHRKWSANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDMKADCILYYGFGDIFR  378 (591)
T ss_dssp             TTSCHHHHHHHHHHHHTTSSSEEEECTTSCTTCCCSCEEEEEESSCCSSHHHHHHHHTTSCTTSSCEEEEEEECHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHcCCCeEEEEechhhcCCCcccccEEEEeCCCCCHHHHHHHhccCCcCCCCceEEEEEChHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999998776543


Q ss_pred             ---cCCCCCCHHHHHHHHHHHHHHHHhccccchhHHHHHHHHcCCCCCCcCCC-CCCCCCCCC-CcccchHHHHHHHHHH
Q 004098          624 ---LLPSRRSEDQTKQAYRMLSDCFRYGMNTSCCRAKILVEYFGEDFSHEKCQ-LCDVCVDGP-PEMKNLKEEANILMQV  698 (774)
Q Consensus       624 ---~~~~~~~~~~~~~~~~~l~~~~~y~~~~~~Crr~~l~~~f~~~~~~~~c~-~Cd~C~~~~-~~~~~~~~~~~~~~~~  698 (774)
                         ++....      .....+..|..||.++..|||++|++||||.+....|+ +||+|...+ ++.+|+|++|++++++
T Consensus       379 ~~~~~~~~~------~~~~~l~~~~~~~~~~~~Crr~~ll~~f~e~~~~~~c~~~Cd~C~~~~~~~~~d~~~~~~~~l~~  452 (591)
T 2v1x_A          379 ISSMVVMEN------VGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCCKDSAFERKNITEYCRDLIKI  452 (591)
T ss_dssp             HHHHTTTST------THHHHHHHHHHHHTCSSSCHHHHHHHHHTCCC---CCCSCBHHHHCCCCEEEEECHHHHHHHHHH
T ss_pred             HHHHHhhhh------hhHHHHHHHHHHHhcccccHHHHHHHHcCCCCCccccCCCCCCCCCCCcccccchHHHHHHHHHH
Confidence               222211      12345667778888899999999999999998767895 799999854 4788999999999999


Q ss_pred             HHHH---hccCCccc-ceeeeccCcccccccCCCCccchhhhhhhhhhccccCCHHHHHHHHHHHHHcCCceec
Q 004098          699 IAAY---NEQSNSMD-DDDGIYSGIKKQKFMDRPNLKMFVSKIREQSQKYLATDLLWWRGLARIMENKGYIREG  768 (774)
Q Consensus       699 ~~~~---~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  768 (774)
                      |.+.   +++++... +|+++|+.+++.+..+++               +++.+..+|+.++++|+.+|||.++
T Consensus       453 v~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~---------------~~~~~~~~~~~~~~~l~~~~~l~~~  511 (591)
T 2v1x_A          453 LKQAEELNEKLTPLKLIDSWMGKGAAKLRVAGVV---------------APTLPREDLEKIIAHFLIQQYLKED  511 (591)
T ss_dssp             HHHHHHTTCCCCHHHHHHHHTTCSCGGGCCTTCC---------------CCSCCHHHHHHHHHHHHHTTSEEEE
T ss_pred             HHHHHhcCCcccHHHHHHHHhCCCchHHHhcCCC---------------cCcCCHHHHHHHHHHHHHcCCcEEe
Confidence            9983   33433333 899999766554433322               2567899999999999999999985
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3aaf_A Werner syndrome ATP-dependent helicase; helix-turn-helix, winged-helix, protein-DNA complex, DNA-BIN helicase; HET: DNA; 1.90A {Homo sapiens} PDB: 2axl_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 774
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 5e-33
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 3e-20
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 5e-18
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 2e-14
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 7e-14
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 2e-12
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 7e-12
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 5e-11
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 5e-10
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-10
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 7e-10
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 1e-09
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 2e-09
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 8e-09
d1c4oa2174 c.37.1.19 (A:410-583) Nucleotide excision repair e 3e-08
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 2e-07
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 2e-07
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 5e-07
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 1e-06
d1t5la2181 c.37.1.19 (A:415-595) Nucleotide excision repair e 2e-06
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 2e-06
d1wjia_63 a.5.2.1 (A:) Tudor domain containing protein 3, TD 9e-05
d1oqya141 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum 5e-04
d1tf5a4175 c.37.1.19 (A:396-570) Translocation ATPase SecA, n 6e-04
d1gm5a4206 c.37.1.19 (A:550-755) RecG helicase domain {Thermo 6e-04
d1wgna_63 a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 0.002
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 0.002
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: RecQ helicase domain
species: Escherichia coli [TaxId: 562]

 Score =  124 bits (311), Expect = 5e-33
 Identities = 75/210 (35%), Positives = 110/210 (52%), Gaps = 14/210 (6%)

Query: 155 SDWEVKVNSLLKKHFGHSSLKNFQKEALSAWLAHHDCLVLAATGSGKSLCFQIPALLTGK 214
            + E     +L++ FG+   +  Q+E +   L+  DCLV+  TG GKSLC+QIPALL   
Sbjct: 7   LNLESGAKQVLQETFGYQQFRPGQEEIIDTVLSGRDCLVVMPTGGGKSLCYQIPALLLNG 66

Query: 215 VVVVISPLISLMHDQCSKLSKHGVTACF---LGSGQPDNKVEQKALRGMYSIIYVCPETV 271
           + VV+SPLISLM DQ  +L  +GV A       + +   +V      G   ++Y+ PE +
Sbjct: 67  LTVVVSPLISLMKDQVDQLQANGVAAACLNSTQTREQQLEVMTGCRTGQIRLLYIAPERL 126

Query: 272 IRLIKPLQRLAESRGIALFAIDEVHCVSKWGHDFRPDYRRLSVLRENFGANNLKSLKFDI 331
           +                L A+DE HC+S+WGHDFRP+Y  L  LR+ F           +
Sbjct: 127 MLDNF--LEHLAHWNPVLLAVDEAHCISQWGHDFRPEYAALGQLRQRFP---------TL 175

Query: 332 PLMALTATATIQVREDILKSLHMSKGTKFV 361
           P MALTATA    R+DI++ L ++     +
Sbjct: 176 PFMALTATADDTTRQDIVRLLGLNDPLIQI 205
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Length = 174 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Length = 181 Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Length = 175 Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 206 Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query774
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 100.0
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 100.0
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.98
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.97
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.97
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.97
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.96
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.95
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.95
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.95
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.95
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.94
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.94
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.94
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.93
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.93
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.93
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.92
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.92
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.92
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.9
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.89
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.88
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.86
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.81
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.79
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.78
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.76
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.75
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.73
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.71
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.68
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.66
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.63
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.62
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.62
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.61
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.49
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.43
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.4
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.32
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.3
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.27
d1oywa1110 DNA helicase RecQ DNA-binding domain {Escherichia 98.95
d2axla1144 Werner syndrome ATP-dependent helicase WRN {Human 98.84
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.74
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.59
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.46
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.18
d2qy9a2211 GTPase domain of the signal recognition particle r 96.37
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 96.35
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.28
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.27
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 96.19
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 96.15
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 95.82
d1okkd2207 GTPase domain of the signal recognition particle r 95.79
d1vmaa2213 GTPase domain of the signal recognition particle r 95.67
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.64
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.53
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 95.44
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.36
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.31
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 95.25
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.03
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 94.7
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 94.69
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 94.54
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 94.44
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 94.34
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.28
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.2
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 93.76
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 93.01
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 92.83
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 92.74
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 92.12
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 91.99
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 91.94
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 91.71
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 91.45
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.44
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 91.35
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 90.35
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 90.04
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 90.02
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 89.51
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 89.35
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 89.26
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 89.15
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 89.01
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 88.99
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 88.57
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 88.21
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 88.13
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 87.79
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 87.77
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 87.07
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 86.87
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 86.16
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 86.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 85.94
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 85.31
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 84.99
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 84.86
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 84.84
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 83.6
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 83.02
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 82.66
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 82.58
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 82.56
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 82.25
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 82.22
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 81.68
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 81.5
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 81.18
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 80.62
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: RecQ helicase domain
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.6e-39  Score=319.55  Aligned_cols=168  Identities=38%  Similarity=0.664  Sum_probs=146.8

Q ss_pred             CCCcEEEEeCchHHHHHHHHHHHhCCCceEEecCCCCHHHHHHHHHHHhcCCceEEEEecccccCcccCCcceEEEeCCC
Q 004098          511 EDGLTIIYVPTRKETLSIAKYLCGFGVKAAAYNASLPKSQLRRVHTEFHENKLEVVVATIAFGMGIDKLNVRRIIHYGWP  590 (774)
Q Consensus       511 ~~~~~IIF~~sr~~~~~l~~~L~~~g~~~~~~h~~l~~~~R~~~~~~F~~g~~~vLVAT~a~~~GIDip~V~~VI~~d~p  590 (774)
                      ...++||||+|++.++.++..|...|+.+..|||+|++++|.++++.|++|+++|||||++++||||+|+|++|||||+|
T Consensus        29 ~~~~~IIF~~t~~~~~~l~~~l~~~~~~~~~~h~~~~~~~r~~~~~~f~~g~~~ilvaTd~~~~GiD~p~v~~VI~~~~P  108 (200)
T d1oywa3          29 RGKSGIIYCNSRAKVEDTAARLQSKGISAAAYHAGLENNVRADVQEKFQRDDLQIVVATVAFGMGINKPNVRFVVHFDIP  108 (200)
T ss_dssp             TTCCEEEECSSHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHHHTTSCSEEEECTTSCTTTCCTTCCEEEESSCC
T ss_pred             CCCCEEEEEeeehhhHHhhhhhccCCceeEEecCCCcHHHHHHHHHHHhcccceEEEecchhhhccCCCCCCEEEECCCc
Confidence            45689999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHhhccccCCCcceEEEEeeCCCCCcc---CCCCCCHHHHHHHHHHHHHHHHhccccchhHHHHHHHHcCCCC
Q 004098          591 QSLEAYYQEAGRAGRDGHLADCVLYANLSSMPTL---LPSRRSEDQTKQAYRMLSDCFRYGMNTSCCRAKILVEYFGEDF  667 (774)
Q Consensus       591 ~s~~~y~Qr~GRaGR~G~~g~~il~~~~~~~~~~---~~~~~~~~~~~~~~~~l~~~~~y~~~~~~Crr~~l~~~f~~~~  667 (774)
                      .|+++|+||+|||||+|++|.|++|+++.+...+   +...............+..|..|+ +++.|||+.|++|||+..
T Consensus       109 ~~~~~y~qr~GR~gR~g~~g~ai~~~~~~d~~~l~~~i~~~~~~~~~~~~~~~~~~m~~~~-~~~~Crr~~ll~~fge~~  187 (200)
T d1oywa3         109 RNIESYYQETGRAGRDGLPAEAMLFYDPADMAWLRRCLEEKPQGQLQDIERHKLNAMGAFA-EAQTCRRLVLLNYFGEGR  187 (200)
T ss_dssp             SSHHHHHHHHTTSCTTSSCEEEEEEECHHHHHHHHHHHHTSCCSHHHHHHHHHHHHHHHHH-TCSSCHHHHHHHHTTCCC
T ss_pred             cchHHHHHHhhhhhcCCCCceEEEecCHHHHHHHHhhhhccccccchhhhHHHHHHHHHHH-hchhhHHHHHHHHcCCCC
Confidence            9999999999999999999999999987765433   222222222233344566677777 789999999999999986


Q ss_pred             CCcCCCCCCCCCC
Q 004098          668 SHEKCQLCDVCVD  680 (774)
Q Consensus       668 ~~~~c~~Cd~C~~  680 (774)
                       ...|++||+|.+
T Consensus       188 -~~~C~~CD~C~~  199 (200)
T d1oywa3         188 -QEPCGNCDICLD  199 (200)
T ss_dssp             -CSCCSCBHHHHS
T ss_pred             -CCCCCCCCCCCC
Confidence             478999999976
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1oywa1 a.4.5.43 (A:407-516) DNA helicase RecQ DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2axla1 a.4.5.43 (A:1-144) Werner syndrome ATP-dependent helicase WRN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure