Citrus Sinensis ID: 004117
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 773 | ||||||
| 225429898 | 1094 | PREDICTED: ubiquitin carboxyl-terminal h | 0.992 | 0.701 | 0.672 | 0.0 | |
| 255558648 | 1058 | ubiquitin specific protease, putative [R | 0.946 | 0.691 | 0.679 | 0.0 | |
| 296081825 | 1044 | unnamed protein product [Vitis vinifera] | 0.930 | 0.688 | 0.653 | 0.0 | |
| 224066813 | 1055 | predicted protein [Populus trichocarpa] | 0.956 | 0.700 | 0.645 | 0.0 | |
| 224082308 | 1084 | predicted protein [Populus trichocarpa] | 0.990 | 0.706 | 0.657 | 0.0 | |
| 449441976 | 1088 | PREDICTED: ubiquitin carboxyl-terminal h | 0.988 | 0.702 | 0.642 | 0.0 | |
| 356554385 | 1083 | PREDICTED: ubiquitin carboxyl-terminal h | 0.985 | 0.703 | 0.626 | 0.0 | |
| 357466469 | 1083 | Ubiquitin carboxyl-terminal hydrolase [M | 0.983 | 0.701 | 0.610 | 0.0 | |
| 356515521 | 1085 | PREDICTED: ubiquitin carboxyl-terminal h | 0.981 | 0.699 | 0.612 | 0.0 | |
| 356507807 | 1085 | PREDICTED: ubiquitin carboxyl-terminal h | 0.981 | 0.699 | 0.611 | 0.0 |
| >gi|225429898|ref|XP_002283635.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 26 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1075 bits (2781), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 520/773 (67%), Positives = 623/773 (80%), Gaps = 6/773 (0%)
Query: 7 SPFCFPGELNMQRRLSEPSQLDLIYDLSAVLIHKGTAVNSGHYIALIKDENTGQWWEFDD 66
S FCFPGEL+M+ RLSEPS L+LIYDLSAVLIHKGT VNSGHYIA IKDENTGQWWEFDD
Sbjct: 322 SAFCFPGELDMRERLSEPSDLELIYDLSAVLIHKGTTVNSGHYIAHIKDENTGQWWEFDD 381
Query: 67 EHVSNLGHHPFGEGSSSSGSKVVRSEPVVCQPVSERVEGA-NENHVDV-HLPSSEYYNGS 124
EHVSNLGHHPFGEGSSSS +K V++EP V +E + G N NH+++ L SSE S
Sbjct: 382 EHVSNLGHHPFGEGSSSSAAKPVQTEPSVHLSSTEPMNGVINGNHINIGQLQSSECSIVS 441
Query: 125 NVERFTSNDAYMLMYNLRRDKEDSKRKDVVHDVNNMEIESEMIFFNDDIFLPSHLGKDIK 184
+ ++S DAYMLMYNLRR + + + V N+MEIE ++I+ ++D LP+HL ++IK
Sbjct: 442 GSQTYSSGDAYMLMYNLRRTTKSGEVRQTVSGANHMEIEGDIIYSDNDAALPAHLYEEIK 501
Query: 185 ELNRSYLDGCEQFKLRKNRELDCISERKQEVRSLLSEAPVPSLEEPFYWISSDWLRQWAD 244
ELN SYLD C+Q+K +K RELDCI+ER+QEVRS+LSE PV SLE+P++WIS+DWLR WAD
Sbjct: 502 ELNASYLDACQQYKSKKERELDCITERRQEVRSVLSEGPVLSLEDPYFWISTDWLRLWAD 561
Query: 245 KIFPSTLDNTSIQCLHGKVPESKIGSMKRISSKAWNKFFFKYNGGPALTNDDYCMTCLID 304
I P LDNT IQCLHGKVP SK+GSMKR+SSKAWN F KY GGPAL+NDDYC+ CL++
Sbjct: 562 NITPPVLDNTPIQCLHGKVPVSKVGSMKRLSSKAWNMLFSKYGGGPALSNDDYCINCLVE 621
Query: 305 GAHTVVCADSYRDRRKSLKGLADDVLSGKLVEGT-YYVSKSWLQQWTRRKNLDAPSEADG 363
GA T+V AD+YRDRRK +K LAD V SGK ++G YYVSKSW QQW RRK +D+P +AD
Sbjct: 622 GASTMVSADNYRDRRKVMKELADAVHSGKCLDGNLYYVSKSWFQQWARRKIIDSPCDADA 681
Query: 364 GPTTSIRCPHGQLMPEKAGGAKRLLVPEILWLFIYEDAMKVKPDDLLGCSTFPLDSEECP 423
GPT SIRCPHG+LMPE+A GAKRLLVPE LWLF E A VKPDD LGCS FP D E C
Sbjct: 682 GPTASIRCPHGKLMPEQAPGAKRLLVPENLWLFFCESANTVKPDDTLGCSVFPSDVEPCA 741
Query: 424 ECSDALSEVACLEDSIRARKLKERQNHEKLALGKSIPLSLDCKYYLLPSTWLTKWRNYIS 483
CS L+EVA +ED++R KLK+RQNHEK+ALGK LS CKYYLLPS+WL+ WR+YI+
Sbjct: 742 TCSMELTEVASIEDTLREFKLKQRQNHEKIALGKGFALSSHCKYYLLPSSWLSTWRSYIN 801
Query: 484 PSGKN-ASSIEPEILDGVIDSLKCEKHLRLLERPPDLVCKRGSIYQKGSATDGLTIVTEN 542
+GKN +SS++PE+LD VID +KC KH RLLERP +L+CKRG+I+Q+ SATDGLTI+T++
Sbjct: 802 ANGKNVSSSVQPEMLDSVIDMMKCGKHSRLLERPLELICKRGTIFQRFSATDGLTIITKD 861
Query: 543 DWKWFCEEWGGIKEKGLSVIVDFSNNAGNELVGSCKEILLSEEPCGPRDEENNEIESQRP 602
DWK+FCEEWG +E G+S ++FSN N L GSC+E+ + EE P DE N EIES++P
Sbjct: 862 DWKFFCEEWGCTEEMGISAEIEFSNCVANNLAGSCEEMPIIEEHMSPHDEVNEEIESRQP 921
Query: 603 VVRTFPEICEDCIGERESCELMQKLNYCDKDISVFLVRGKEAPRSILEASESMFEPDRRA 662
V++T PE+CE CIGERESCELMQKLNYC++DI V VRGKEAP+SILEAS ++ EPDRR
Sbjct: 922 VIKTSPEVCEVCIGERESCELMQKLNYCNEDIRVCFVRGKEAPKSILEASGTISEPDRRI 981
Query: 663 SKRSRKTR--SFVNLKVSASTSIYQLKMMIWESLGVVKENQILHKGQRIIDQECATLADL 720
SKRSRKT + +NLKVS STSIYQLKMMIWES GV+KENQILHKG +ID E +TLAD+
Sbjct: 982 SKRSRKTNFGNSINLKVSGSTSIYQLKMMIWESFGVIKENQILHKGSTVIDGETSTLADM 1041
Query: 721 NIFPGDKLWVQDSEIHEHRDIADELSDQKMNVQHVEEGFRGTLLTSNLSSQVV 773
NIFPGD LWV+DSEIHE+RDIADELSD KM VQ EEGFRGTLLTSN+SSQVV
Sbjct: 1042 NIFPGDLLWVKDSEIHEYRDIADELSDHKMEVQQAEEGFRGTLLTSNISSQVV 1094
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255558648|ref|XP_002520349.1| ubiquitin specific protease, putative [Ricinus communis] gi|223540568|gb|EEF42135.1| ubiquitin specific protease, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|296081825|emb|CBI20830.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224066813|ref|XP_002302228.1| predicted protein [Populus trichocarpa] gi|222843954|gb|EEE81501.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224082308|ref|XP_002306642.1| predicted protein [Populus trichocarpa] gi|222856091|gb|EEE93638.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449441976|ref|XP_004138758.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 26-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356554385|ref|XP_003545527.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 26-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357466469|ref|XP_003603519.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] gi|355492567|gb|AES73770.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356515521|ref|XP_003526448.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 26-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356507807|ref|XP_003522655.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 26-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 773 | ||||||
| TAIR|locus:2114653 | 1067 | UBP26 "ubiquitin-specific prot | 0.967 | 0.701 | 0.547 | 5.5e-228 | |
| MGI|MGI:2158502 | 1052 | Usp48 "ubiquitin specific pept | 0.234 | 0.172 | 0.298 | 7.3e-34 | |
| RGD|735213 | 1036 | Usp48 "ubiquitin specific pept | 0.236 | 0.176 | 0.278 | 2.1e-32 | |
| UNIPROTKB|Q76LT8 | 1036 | Usp48 "Ubiquitin carboxyl-term | 0.236 | 0.176 | 0.278 | 2.1e-32 | |
| UNIPROTKB|F1M722 | 1076 | Usp48 "Ubiquitin carboxyl-term | 0.235 | 0.169 | 0.278 | 5.7e-32 | |
| UNIPROTKB|B7ZKS7 | 1047 | USP48 "Ubiquitin carboxyl-term | 0.323 | 0.238 | 0.270 | 4.3e-31 | |
| UNIPROTKB|Q86UV5 | 1035 | USP48 "Ubiquitin carboxyl-term | 0.241 | 0.180 | 0.290 | 1.9e-30 | |
| UNIPROTKB|F1PG27 | 1036 | USP48 "Uncharacterized protein | 0.241 | 0.180 | 0.290 | 1.9e-30 | |
| UNIPROTKB|E1BF92 | 1038 | USP48 "Uncharacterized protein | 0.238 | 0.177 | 0.295 | 3.2e-29 | |
| UNIPROTKB|Q5ZM45 | 1033 | USP48 "Ubiquitin carboxyl-term | 0.236 | 0.177 | 0.269 | 3e-28 |
| TAIR|locus:2114653 UBP26 "ubiquitin-specific protease 26" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2200 (779.5 bits), Expect = 5.5e-228, P = 5.5e-228
Identities = 424/775 (54%), Positives = 552/775 (71%)
Query: 2 KKKITSPFCFPGELNMQRRLSEPSQLDLIYDLSAVLIHKGTAVNSGHYIALIKDENTGQW 61
KKKITS F FP L+M RL+E SQ L YDLSAVLIHKG+AVNSGHY+A IKDE TG W
Sbjct: 313 KKKITSSFSFPQVLDMGSRLAESSQNKLTYDLSAVLIHKGSAVNSGHYVAHIKDEKTGLW 372
Query: 62 WEFDDEHVSNLGHHPFGEXXXXXXXKVVRSEPVVCQPVSERVEGANENHVD--VHLPSSE 119
WEFDDEHVS LG P E P SE A+ ++ + SS+
Sbjct: 373 WEFDDEHVSELGKRPCNEASSST-------------PQSESNGTASSGNITDGIQSGSSD 419
Query: 120 YYNGSNVERFTSNDAYMLMYNLRRDKEDSKRKDVVHDVNNMEIESEMIFFNDDIFLPSHL 179
+ E F+S+DAYMLMY+LR DK++++ + ++ + E + + +LP HL
Sbjct: 420 CRSAIKSEVFSSSDAYMLMYSLRCDKQENQEGQKENPIDITKGEVKQLKGG---YLPKHL 476
Query: 180 GKDIKELNRSYLDGCEQFKLRKNRELDCISERKQEVRSLLSEAPVPSLEEPFYWISSDWL 239
+ I +N +L+ C+Q+ LRK +EL+ ++ER+QEVR++LSEA V SLEE ++WIS+DWL
Sbjct: 477 SEWINNMNAVFLESCKQYNLRKEKELNALTERRQEVRTILSEAAVQSLEEQYFWISTDWL 536
Query: 240 RQWADKIFPSTLDNTSIQCLHGKVPESKIGSMKRISSKAWNKFFFKYNGGPALTNDDYCM 299
R WAD P LDNT + C HGKV SK+ MKRIS AW K K+NGGP L DYC
Sbjct: 537 RLWADTTLPPALDNTPLLCSHGKVHASKVNCMKRISELAWIKLESKFNGGPKLGKGDYCR 596
Query: 300 TCLIDGAHTVVCADSYRDRRKSLKGLADDVLSGKLVEGTYYVSKSWLQQWTRRKNLDAPS 359
CL+DGA VV +DSYRDRR +K +A+DVLSGK +G YY+S++WLQQW +RKNLDAP+
Sbjct: 597 DCLMDGARMVVSSDSYRDRRTFMKSIANDVLSGKCEDGMYYISRAWLQQWIKRKNLDAPT 656
Query: 360 EADGGPTTSIRCPHGQLMPEKAGGAKRLLVPEILWLFIYEDAMKVKPDDLLGCSTFPLDS 419
EAD GPT +I C HG+LMPE+A GAKR++VPE W F++EDA+KV +D L C+ FP+DS
Sbjct: 657 EADAGPTNAITCNHGELMPEQAPGAKRVVVPENFWSFLFEDALKVMSEDTLDCTCFPVDS 716
Query: 420 EECPECSDALSEVACLEDSIRARKLKERQNHEKLALGKSIPLSLDCKYYLLPSTWLTKWR 479
+C C++ LSEVAC EDS+R K+K+RQNHEKLA GK IPL+ +Y+LLPS WL +WR
Sbjct: 717 SQCCHCTEVLSEVACFEDSLRTLKVKQRQNHEKLATGKGIPLTPQSRYFLLPSPWLVQWR 776
Query: 480 NYISPSGKNASSI-EPEILDGVIDSLKCEKHLRLLERPPDLVCKRGSIYQKGSATDGLTI 538
YI+ +GKN+SS EPE LDGVI++LKC+KH RLLER P+LVC+RGS +QK +TD LTI
Sbjct: 777 IYINMTGKNSSSAPEPERLDGVINTLKCKKHTRLLERLPELVCRRGSYFQKNPSTDKLTI 836
Query: 539 VTENDWKWFCEEWGGIKEKGLSVIVDFSNNAGNELVGSCKEILLSEEPCGPRDEENNEIE 598
+ E DWK+FC+EWGG+ E G+S ++ GN S +++ E+ P D N +++
Sbjct: 837 IPELDWKYFCDEWGGLMENGISAFIE----VGNTDQSSSPDVIDLEKDSSPDD--NMDVD 890
Query: 599 SQRPVVRTFPEICEDCIGERESCELMQKLNYCDKDISVFLVRGKEAPRSILEASESMFEP 658
+Q+ ++R PEICE+CIGERESCELMQKL+Y + D+ V VRGKEAP+++LEAS+S FE
Sbjct: 891 AQQLILRASPEICEECIGERESCELMQKLSYSEGDVFVCFVRGKEAPKAMLEASDSSFEV 950
Query: 659 DXXXXXXXXXXXX--FVNLKVSASTSIYQLKMMIWESLGVVKENQILHKGQRIIDQECAT 716
D +LKVSA+T++YQLKMMIWE LGV+KENQ LHKG ++IDQE AT
Sbjct: 951 DRRTSKRSRRTNYGNLTSLKVSATTTVYQLKMMIWELLGVMKENQELHKGSKVIDQESAT 1010
Query: 717 LADLNIFPGDKLWVQDSEIHEHRDIADELSDQKMNVQHVEEGFRGTLLTSNLSSQ 771
LAD+NIFPGD+LWV+D+E+HEHRDIADEL ++K Q +EEGFRGTLLT N+SS+
Sbjct: 1011 LADMNIFPGDRLWVRDTEMHEHRDIADELCEKKPGAQDIEEGFRGTLLTGNISSE 1065
|
|
| MGI|MGI:2158502 Usp48 "ubiquitin specific peptidase 48" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|735213 Usp48 "ubiquitin specific peptidase 48" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q76LT8 Usp48 "Ubiquitin carboxyl-terminal hydrolase 48" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M722 Usp48 "Ubiquitin carboxyl-terminal hydrolase 48" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B7ZKS7 USP48 "Ubiquitin carboxyl-terminal hydrolase 48" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86UV5 USP48 "Ubiquitin carboxyl-terminal hydrolase 48" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PG27 USP48 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BF92 USP48 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZM45 USP48 "Ubiquitin carboxyl-terminal hydrolase 48" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 773 | |||
| cd02668 | 324 | cd02668, Peptidase_C19L, A subfamily of Peptidase | 7e-28 | |
| cd02257 | 255 | cd02257, Peptidase_C19, Peptidase C19 contains ubi | 3e-17 | |
| pfam00443 | 313 | pfam00443, UCH, Ubiquitin carboxyl-terminal hydrol | 2e-14 | |
| cd02659 | 334 | cd02659, peptidase_C19C, A subfamily of Peptidase | 2e-14 | |
| cd02657 | 305 | cd02657, Peptidase_C19A, A subfamily of Peptidase | 7e-13 | |
| cd02660 | 328 | cd02660, Peptidase_C19D, A subfamily of Peptidase | 2e-12 | |
| cd02661 | 304 | cd02661, Peptidase_C19E, A subfamily of Peptidase | 6e-12 | |
| COG5077 | 1089 | COG5077, COG5077, Ubiquitin carboxyl-terminal hydr | 7e-12 | |
| cd02674 | 230 | cd02674, Peptidase_C19R, A subfamily of peptidase | 8e-10 | |
| pfam06337 | 86 | pfam06337, DUSP, DUSP domain | 7e-09 | |
| cd01795 | 107 | cd01795, USP48_C, USP ubiquitin-specific protease | 2e-08 | |
| smart00695 | 88 | smart00695, DUSP, Domain in ubiquitin-specific pro | 5e-08 | |
| cd02663 | 300 | cd02663, Peptidase_C19G, A subfamily of Peptidase | 6e-08 | |
| cd02658 | 311 | cd02658, Peptidase_C19B, A subfamily of Peptidase | 2e-07 | |
| COG5560 | 823 | COG5560, UBP12, Ubiquitin C-terminal hydrolase [Po | 1e-04 | |
| cd02666 | 343 | cd02666, Peptidase_C19J, A subfamily of Peptidase | 3e-04 | |
| pfam00240 | 69 | pfam00240, ubiquitin, Ubiquitin family | 3e-04 | |
| pfam06337 | 86 | pfam06337, DUSP, DUSP domain | 0.001 | |
| cd02669 | 440 | cd02669, Peptidase_C19M, A subfamily of Peptidase | 0.001 | |
| cd01769 | 69 | cd01769, UBL, Ubiquitin-like domain of UBL | 0.002 | |
| smart00213 | 72 | smart00213, UBQ, Ubiquitin homologues | 0.002 | |
| pfam06337 | 86 | pfam06337, DUSP, DUSP domain | 0.003 | |
| pfam13423 | 296 | pfam13423, UCH_1, Ubiquitin carboxyl-terminal hydr | 0.004 |
| >gnl|CDD|239133 cd02668, Peptidase_C19L, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
Score = 114 bits (288), Expect = 7e-28
Identities = 46/138 (33%), Positives = 65/138 (47%), Gaps = 31/138 (22%)
Query: 2 KKKITSPFCFPGELNMQRRLSEPSQLDLIYDLSAVLIHKGTAVNSGHYIALIKDENTGQW 61
KKK+ + FP L+M L+E + +Y+LS VLIH+G + SGHYIA IKDE TG+W
Sbjct: 217 KKKLNASISFPEILDMGEYLAESDEGSYVYELSGVLIHQGVSAYSGHYIAHIKDEQTGEW 276
Query: 62 WEFDDEHVSNLGHHPFGEGSSSSGSKVVRSEPVVCQPVSERVEGANENHVDVHLPSSEYY 121
++F+DE V + P G+S +K +SE
Sbjct: 277 YKFNDEDVEEMPGKPLKLGNSEDPAKPRKSE----------------------------- 307
Query: 122 NGSNVERFTSNDAYMLMY 139
+S AYML+Y
Sbjct: 308 --IKKGTHSSRTAYMLVY 323
|
Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome. Length = 324 |
| >gnl|CDD|239072 cd02257, Peptidase_C19, Peptidase C19 contains ubiquitinyl hydrolases | Back alignment and domain information |
|---|
| >gnl|CDD|215922 pfam00443, UCH, Ubiquitin carboxyl-terminal hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|239124 cd02659, peptidase_C19C, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|239122 cd02657, Peptidase_C19A, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|239125 cd02660, Peptidase_C19D, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|239126 cd02661, Peptidase_C19E, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|227409 COG5077, COG5077, Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239139 cd02674, Peptidase_C19R, A subfamily of peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|218995 pfam06337, DUSP, DUSP domain | Back alignment and domain information |
|---|
| >gnl|CDD|176390 cd01795, USP48_C, USP ubiquitin-specific protease | Back alignment and domain information |
|---|
| >gnl|CDD|197831 smart00695, DUSP, Domain in ubiquitin-specific proteases | Back alignment and domain information |
|---|
| >gnl|CDD|239128 cd02663, Peptidase_C19G, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|239123 cd02658, Peptidase_C19B, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|227847 COG5560, UBP12, Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239131 cd02666, Peptidase_C19J, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family | Back alignment and domain information |
|---|
| >gnl|CDD|218995 pfam06337, DUSP, DUSP domain | Back alignment and domain information |
|---|
| >gnl|CDD|239134 cd02669, Peptidase_C19M, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues | Back alignment and domain information |
|---|
| >gnl|CDD|218995 pfam06337, DUSP, DUSP domain | Back alignment and domain information |
|---|
| >gnl|CDD|222118 pfam13423, UCH_1, Ubiquitin carboxyl-terminal hydrolase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 773 | |||
| cd01795 | 107 | USP48_C USP ubiquitin-specific protease. The USP ( | 99.96 | |
| cd02668 | 324 | Peptidase_C19L A subfamily of Peptidase C19. Pepti | 99.8 | |
| KOG1865 | 545 | consensus Ubiquitin carboxyl-terminal hydrolase [P | 99.8 | |
| COG5077 | 1089 | Ubiquitin carboxyl-terminal hydrolase [Posttransla | 99.77 | |
| cd02664 | 327 | Peptidase_C19H A subfamily of Peptidase C19. Pepti | 99.73 | |
| cd02657 | 305 | Peptidase_C19A A subfamily of Peptidase C19. Pepti | 99.72 | |
| cd02667 | 279 | Peptidase_C19K A subfamily of Peptidase C19. Pepti | 99.72 | |
| cd02670 | 241 | Peptidase_C19N A subfamily of Peptidase C19. Pepti | 99.72 | |
| KOG1866 | 944 | consensus Ubiquitin carboxyl-terminal hydrolase [P | 99.71 | |
| cd02663 | 300 | Peptidase_C19G A subfamily of Peptidase C19. Pepti | 99.71 | |
| cd02659 | 334 | peptidase_C19C A subfamily of Peptidase C19. Pepti | 99.69 | |
| cd02665 | 228 | Peptidase_C19I A subfamily of Peptidase C19. Pepti | 99.67 | |
| cd02669 | 440 | Peptidase_C19M A subfamily of Peptidase C19. Pepti | 99.66 | |
| cd02671 | 332 | Peptidase_C19O A subfamily of Peptidase C19. Pepti | 99.63 | |
| KOG4598 | 1203 | consensus Putative ubiquitin-specific protease [Po | 99.63 | |
| cd02661 | 304 | Peptidase_C19E A subfamily of Peptidase C19. Pepti | 99.61 | |
| cd02660 | 328 | Peptidase_C19D A subfamily of Peptidase C19. Pepti | 99.61 | |
| cd02662 | 240 | Peptidase_C19F A subfamily of Peptidase C19. Pepti | 99.59 | |
| PF00443 | 269 | UCH: Ubiquitin carboxyl-terminal hydrolase; InterP | 99.58 | |
| cd02674 | 230 | Peptidase_C19R A subfamily of peptidase C19. Pepti | 99.56 | |
| cd02658 | 311 | Peptidase_C19B A subfamily of Peptidase C19. Pepti | 99.53 | |
| KOG1863 | 1093 | consensus Ubiquitin carboxyl-terminal hydrolase [P | 99.52 | |
| cd02257 | 255 | Peptidase_C19 Peptidase C19 contains ubiquitinyl h | 99.52 | |
| cd02673 | 245 | Peptidase_C19Q A subfamily of Peptidase C19. Pepti | 99.5 | |
| KOG0005 | 70 | consensus Ubiquitin-like protein [Cell cycle contr | 99.5 | |
| cd01793 | 74 | Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui | 99.49 | |
| cd02672 | 268 | Peptidase_C19P A subfamily of Peptidase C19. Pepti | 99.47 | |
| cd01794 | 70 | DC_UbP_C dendritic cell derived ubiquitin-like pro | 99.45 | |
| cd01807 | 74 | GDX_N ubiquitin-like domain of GDX. GDX contains a | 99.45 | |
| KOG1867 | 492 | consensus Ubiquitin-specific protease [Posttransla | 99.45 | |
| COG5560 | 823 | UBP12 Ubiquitin C-terminal hydrolase [Posttranslat | 99.44 | |
| cd01796 | 71 | DDI1_N DNA damage inducible protein 1 ubiquitin-li | 99.42 | |
| KOG0003 | 128 | consensus Ubiquitin/60s ribosomal protein L40 fusi | 99.4 | |
| cd01791 | 73 | Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know | 99.39 | |
| cd01798 | 70 | parkin_N amino-terminal ubiquitin-like of parkin p | 99.39 | |
| cd01810 | 74 | ISG15_repeat2 ISG15 ubiquitin-like protein, second | 99.36 | |
| cd01799 | 75 | Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO | 99.35 | |
| cd01802 | 103 | AN1_N ubiquitin-like domain of AN1. AN1 (also know | 99.33 | |
| cd01815 | 75 | BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC | 99.32 | |
| cd01797 | 78 | NIRF_N amino-terminal ubiquitin-like domain of Np9 | 99.32 | |
| PTZ00044 | 76 | ubiquitin; Provisional | 99.31 | |
| PF00240 | 69 | ubiquitin: Ubiquitin family; InterPro: IPR000626 U | 99.31 | |
| cd01800 | 76 | SF3a120_C Ubiquitin-like domain of Mammalian splic | 99.31 | |
| KOG1868 | 653 | consensus Ubiquitin C-terminal hydrolase [Posttran | 99.31 | |
| KOG0004 | 156 | consensus Ubiquitin/40S ribosomal protein S27a fus | 99.28 | |
| cd02666 | 343 | Peptidase_C19J A subfamily of Peptidase C19. Pepti | 99.27 | |
| cd01808 | 71 | hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC | 99.26 | |
| cd01806 | 76 | Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn | 99.26 | |
| KOG1870 | 842 | consensus Ubiquitin C-terminal hydrolase [Posttran | 99.25 | |
| cd01805 | 77 | RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo | 99.24 | |
| smart00695 | 86 | DUSP Domain in ubiquitin-specific proteases. | 99.24 | |
| cd01812 | 71 | BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter | 99.23 | |
| cd01803 | 76 | Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 | 99.22 | |
| cd01809 | 72 | Scythe_N Ubiquitin-like domain of Scythe protein. | 99.22 | |
| cd01804 | 78 | midnolin_N Ubiquitin-like domain of midnolin. midn | 99.22 | |
| cd01792 | 80 | ISG15_repeat1 ISG15 ubiquitin-like protein, first | 99.2 | |
| COG5533 | 415 | UBP5 Ubiquitin C-terminal hydrolase [Posttranslati | 99.19 | |
| cd01813 | 74 | UBP_N UBP ubiquitin processing protease. The UBP ( | 99.11 | |
| cd01790 | 79 | Herp_N Homocysteine-responsive endoplasmic reticul | 99.09 | |
| KOG1864 | 587 | consensus Ubiquitin-specific protease [Posttransla | 99.05 | |
| cd01763 | 87 | Sumo Small ubiquitin-related modifier (SUMO). Smal | 99.04 | |
| cd01814 | 113 | NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT | 98.98 | |
| smart00213 | 64 | UBQ Ubiquitin homologues. Ubiquitin-mediated prote | 98.95 | |
| PF06337 | 99 | DUSP: DUSP domain; InterPro: IPR006615 Deubiquitin | 98.93 | |
| KOG1873 | 877 | consensus Ubiquitin-specific protease [Posttransla | 98.92 | |
| KOG1872 | 473 | consensus Ubiquitin-specific protease [Posttransla | 98.91 | |
| smart00695 | 86 | DUSP Domain in ubiquitin-specific proteases. | 98.88 | |
| cd01769 | 69 | UBL Ubiquitin-like domain of UBL. UBLs function by | 98.88 | |
| cd01789 | 84 | Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol | 98.83 | |
| PF06337 | 99 | DUSP: DUSP domain; InterPro: IPR006615 Deubiquitin | 98.8 | |
| KOG0944 | 763 | consensus Ubiquitin-specific protease UBP14 [Postt | 98.8 | |
| cd01788 | 119 | ElonginB Ubiquitin-like domain of Elongin B. Elong | 98.72 | |
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 98.68 | |
| KOG0010 | 493 | consensus Ubiquitin-like protein [Posttranslationa | 98.64 | |
| PF14560 | 87 | Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K | 98.44 | |
| PF11976 | 72 | Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter | 98.43 | |
| PF13423 | 295 | UCH_1: Ubiquitin carboxyl-terminal hydrolase | 98.42 | |
| COG5207 | 749 | UBP14 Isopeptidase T [Posttranslational modificati | 98.41 | |
| KOG0001 | 75 | consensus Ubiquitin and ubiquitin-like proteins [P | 98.41 | |
| KOG1871 | 420 | consensus Ubiquitin-specific protease [Posttransla | 98.3 | |
| PF13881 | 111 | Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB | 98.09 | |
| PLN02560 | 308 | enoyl-CoA reductase | 98.03 | |
| cd01801 | 77 | Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- | 97.99 | |
| PF11543 | 80 | UN_NPL4: Nuclear pore localisation protein NPL4; I | 97.97 | |
| KOG4495 | 110 | consensus RNA polymerase II transcription elongati | 97.87 | |
| cd00196 | 69 | UBQ Ubiquitin-like proteins. Ubiquitin homologs; I | 97.84 | |
| KOG0011 | 340 | consensus Nucleotide excision repair factor NEF2, | 97.82 | |
| KOG4248 | 1143 | consensus Ubiquitin-like protein, regulator of apo | 97.72 | |
| cd01811 | 80 | OASL_repeat1 2'-5' oligoadenylate synthetase-like | 97.44 | |
| KOG0006 | 446 | consensus E3 ubiquitin-protein ligase (Parkin prot | 96.98 | |
| KOG1872 | 473 | consensus Ubiquitin-specific protease [Posttransla | 95.78 | |
| PF11470 | 65 | TUG-UBL1: GLUT4 regulating protein TUG; InterPro: | 95.72 | |
| PF08817 | 79 | YukD: WXG100 protein secretion system (Wss), prote | 95.0 | |
| KOG1275 | 1118 | consensus PAB-dependent poly(A) ribonuclease, subu | 94.28 | |
| KOG2026 | 442 | consensus Spindle pole body protein - Sad1p [Cytos | 93.95 | |
| cd01772 | 79 | SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst | 93.86 | |
| smart00166 | 80 | UBX Domain present in ubiquitin-regulatory protein | 93.4 | |
| KOG3206 | 234 | consensus Alpha-tubulin folding cofactor B [Posttr | 93.37 | |
| PF00789 | 82 | UBX: UBX domain; InterPro: IPR001012 The UBX domai | 93.37 | |
| KOG0013 | 231 | consensus Uncharacterized conserved protein [Funct | 92.87 | |
| KOG1769 | 99 | consensus Ubiquitin-like proteins [Posttranslation | 92.74 | |
| PF10302 | 97 | DUF2407: DUF2407 ubiquitin-like domain; InterPro: | 92.67 | |
| PF14836 | 88 | Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A | 92.54 | |
| KOG1639 | 297 | consensus Steroid reductase required for elongatio | 91.84 | |
| KOG3493 | 73 | consensus Ubiquitin-like protein [Posttranslationa | 91.11 | |
| cd01770 | 79 | p47_UBX p47-like ubiquitin domain. p47_UBX p47 is | 87.98 | |
| cd01767 | 77 | UBX UBX (ubiquitin regulatory X) domain. The UBX ( | 87.84 | |
| cd01774 | 85 | Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i | 86.91 | |
| PF15044 | 76 | CLU_N: Mitochondrial function, CLU-N-term | 86.53 | |
| cd01773 | 82 | Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i | 85.41 | |
| cd01771 | 80 | Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac | 80.84 |
| >cd01795 USP48_C USP ubiquitin-specific protease | Back alignment and domain information |
|---|
Probab=99.96 E-value=1e-29 Score=221.54 Aligned_cols=104 Identities=36% Similarity=0.468 Sum_probs=101.5
Q ss_pred cccccccccCCCceEEEEecCcccHHHHHHHHHHHhCCCCCCcEEEeCCeeeccccchhhhcCCCCCCEEEEEecccccC
Q 004117 659 DRRASKRSRKTRSFVNLKVSASTSIYQLKMMIWESLGVVKENQILHKGQRIIDQECATLADLNIFPGDKLWVQDSEIHEH 738 (773)
Q Consensus 659 ~~R~S~R~R~~~~~~~l~vs~~~tv~~lK~~I~e~~gi~p~~Q~L~~~G~~L~~d~~TL~~~~I~~~~~l~l~~~~~~~~ 738 (773)
++|||+|+|+.++..+|+|++++||.+||.+||++|||+|++|+|+++|+.|.||++||++|||.+|++|+|.+++
T Consensus 3 ~irrs~r~r~~~~~~~L~V~~~~TVg~LK~lImQ~f~V~P~dQkL~~dG~~L~DDsrTLssyGv~sgSvl~Llide---- 78 (107)
T cd01795 3 VIRRSMRHRKVRGEKALLVSANQTLKELKIQIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADE---- 78 (107)
T ss_pred ccchhhhhccCCCCceEEeCccccHHHHHHHHHHHhcCCcccceeeecCceeccCCccHHhcCCCCCCEEEEEecC----
Confidence 5899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCccch-hhhcccccccccccccccccccc
Q 004117 739 RDIADE-LSDQKMNVQHVEEGFRGTLLTSN 767 (773)
Q Consensus 739 ~~~~d~-~~~~~~~~~~~E~GF~gT~L~~~ 767 (773)
|+.|+ ++++.+++++||+||+||+|+|+
T Consensus 79 -P~~d~~~~~~~~~~~~~~~~~~~~~~~~~ 107 (107)
T cd01795 79 -PIADYAAMDDVMQVCMPEEGFKGTGLLGH 107 (107)
T ss_pred -CcccHHHHHHHHHhcCcccccccccccCC
Confidence 99999 88999999999999999999985
|
The USP (ubiquitin-specific protease) family is one of at least seven deubiquitylating enzyme (DUB) families capable of deconjugating ubiquitin and ubiquitin-like adducts. While the USP's have a conserved catalytic core domain, they differ in their domain architectures. This subfamily, which includes USP31, and USP48, has a carboxy-terminal ubiquitin-like domain in addition to a DUSP (domain of ubiquitin-specific proteases) domain, |
| >cd02668 Peptidase_C19L A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG1865 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02664 Peptidase_C19H A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02657 Peptidase_C19A A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02667 Peptidase_C19K A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02670 Peptidase_C19N A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG1866 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02663 Peptidase_C19G A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02659 peptidase_C19C A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02665 Peptidase_C19I A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02669 Peptidase_C19M A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02671 Peptidase_C19O A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG4598 consensus Putative ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02661 Peptidase_C19E A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02660 Peptidase_C19D A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02662 Peptidase_C19F A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >PF00443 UCH: Ubiquitin carboxyl-terminal hydrolase; InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd02674 Peptidase_C19R A subfamily of peptidase C19 | Back alignment and domain information |
|---|
| >cd02658 Peptidase_C19B A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG1863 consensus Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases | Back alignment and domain information |
|---|
| >cd02673 Peptidase_C19Q A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01793 Fubi Fubi ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd02672 Peptidase_C19P A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein | Back alignment and domain information |
|---|
| >cd01807 GDX_N ubiquitin-like domain of GDX | Back alignment and domain information |
|---|
| >KOG1867 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain | Back alignment and domain information |
|---|
| >KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd01791 Ubl5 UBL5 ubiquitin-like modifier | Back alignment and domain information |
|---|
| >cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein | Back alignment and domain information |
|---|
| >cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 | Back alignment and domain information |
|---|
| >cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 | Back alignment and domain information |
|---|
| >cd01802 AN1_N ubiquitin-like domain of AN1 | Back alignment and domain information |
|---|
| >cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP | Back alignment and domain information |
|---|
| >cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF | Back alignment and domain information |
|---|
| >PTZ00044 ubiquitin; Provisional | Back alignment and domain information |
|---|
| >PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade | Back alignment and domain information |
|---|
| >cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 | Back alignment and domain information |
|---|
| >KOG1868 consensus Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd02666 Peptidase_C19J A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 | Back alignment and domain information |
|---|
| >cd01806 Nedd8 Nebb8-like ubiquitin protein | Back alignment and domain information |
|---|
| >KOG1870 consensus Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01805 RAD23_N Ubiquitin-like domain of RAD23 | Back alignment and domain information |
|---|
| >smart00695 DUSP Domain in ubiquitin-specific proteases | Back alignment and domain information |
|---|
| >cd01812 BAG1_N Ubiquitin-like domain of BAG1 | Back alignment and domain information |
|---|
| >cd01803 Ubiquitin Ubiquitin | Back alignment and domain information |
|---|
| >cd01809 Scythe_N Ubiquitin-like domain of Scythe protein | Back alignment and domain information |
|---|
| >cd01804 midnolin_N Ubiquitin-like domain of midnolin | Back alignment and domain information |
|---|
| >cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 | Back alignment and domain information |
|---|
| >COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01813 UBP_N UBP ubiquitin processing protease | Back alignment and domain information |
|---|
| >cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein | Back alignment and domain information |
|---|
| >KOG1864 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01763 Sumo Small ubiquitin-related modifier (SUMO) | Back alignment and domain information |
|---|
| >cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 | Back alignment and domain information |
|---|
| >smart00213 UBQ Ubiquitin homologues | Back alignment and domain information |
|---|
| >PF06337 DUSP: DUSP domain; InterPro: IPR006615 Deubiquitinating enzymes (DUB) form a large family of cysteine protease that can deconjugate ubiquitin or ubiquitin-like proteins (see PDOC00271 from PROSITEDOC) from ubiquitin-conjugated proteins | Back alignment and domain information |
|---|
| >KOG1873 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00695 DUSP Domain in ubiquitin-specific proteases | Back alignment and domain information |
|---|
| >cd01769 UBL Ubiquitin-like domain of UBL | Back alignment and domain information |
|---|
| >cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B | Back alignment and domain information |
|---|
| >PF06337 DUSP: DUSP domain; InterPro: IPR006615 Deubiquitinating enzymes (DUB) form a large family of cysteine protease that can deconjugate ubiquitin or ubiquitin-like proteins (see PDOC00271 from PROSITEDOC) from ubiquitin-conjugated proteins | Back alignment and domain information |
|---|
| >KOG0944 consensus Ubiquitin-specific protease UBP14 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01788 ElonginB Ubiquitin-like domain of Elongin B | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
| >PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A | Back alignment and domain information |
|---|
| >PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins | Back alignment and domain information |
|---|
| >PF13423 UCH_1: Ubiquitin carboxyl-terminal hydrolase | Back alignment and domain information |
|---|
| >COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1871 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A | Back alignment and domain information |
|---|
| >PLN02560 enoyl-CoA reductase | Back alignment and domain information |
|---|
| >cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 | Back alignment and domain information |
|---|
| >PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway | Back alignment and domain information |
|---|
| >KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription] | Back alignment and domain information |
|---|
| >cd00196 UBQ Ubiquitin-like proteins | Back alignment and domain information |
|---|
| >KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 | Back alignment and domain information |
|---|
| >KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly | Back alignment and domain information |
|---|
| >PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] | Back alignment and domain information |
|---|
| >KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2026 consensus Spindle pole body protein - Sad1p [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01772 SAKS1_UBX SAKS1-like UBX domain | Back alignment and domain information |
|---|
| >smart00166 UBX Domain present in ubiquitin-regulatory proteins | Back alignment and domain information |
|---|
| >KOG3206 consensus Alpha-tubulin folding cofactor B [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast | Back alignment and domain information |
|---|
| >KOG0013 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi | Back alignment and domain information |
|---|
| >PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A | Back alignment and domain information |
|---|
| >KOG1639 consensus Steroid reductase required for elongation of the very long chain fatty acids [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01770 p47_UBX p47-like ubiquitin domain | Back alignment and domain information |
|---|
| >cd01767 UBX UBX (ubiquitin regulatory X) domain | Back alignment and domain information |
|---|
| >cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain | Back alignment and domain information |
|---|
| >PF15044 CLU_N: Mitochondrial function, CLU-N-term | Back alignment and domain information |
|---|
| >cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain | Back alignment and domain information |
|---|
| >cd01771 Faf1_UBX Faf1 UBX domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 773 | ||||
| 3mhh_A | 476 | Structure Of The Saga Ubp8SGF11SUS1SGF73 DUB MODULE | 5e-06 | ||
| 4fip_A | 476 | Structure Of The Saga Ubp8(S144n)SGF11(1-72, Delta- | 5e-06 | ||
| 3m99_A | 471 | Structure Of The Ubp8-Sgf11-Sgf73-Sus1 Saga Dub Mod | 6e-06 | ||
| 2y6e_A | 367 | Ubiquitin Specific Protease 4 Is Inhibited By Its U | 2e-04 | ||
| 1vjv_A | 415 | Crystal Structure Of Ubiquitin Carboxyl-terminal Hy | 2e-04 | ||
| 2ayn_A | 404 | Structure Of Usp14, A Proteasome-Associated Deubiqu | 2e-04 |
| >pdb|3MHH|A Chain A, Structure Of The Saga Ubp8SGF11SUS1SGF73 DUB MODULE Length = 476 | Back alignment and structure |
|
| >pdb|4FIP|A Chain A, Structure Of The Saga Ubp8(S144n)SGF11(1-72, Delta-Znf)SUS1SGF73 Dub Module Length = 476 | Back alignment and structure |
| >pdb|3M99|A Chain A, Structure Of The Ubp8-Sgf11-Sgf73-Sus1 Saga Dub Module Length = 471 | Back alignment and structure |
| >pdb|2Y6E|A Chain A, Ubiquitin Specific Protease 4 Is Inhibited By Its Ubiquitin- Like Domain Length = 367 | Back alignment and structure |
| >pdb|1VJV|A Chain A, Crystal Structure Of Ubiquitin Carboxyl-terminal Hydrolase 6 (yfr010w) From Saccharomyces Cerevisiae At 1.74 A Resolution Length = 415 | Back alignment and structure |
| >pdb|2AYN|A Chain A, Structure Of Usp14, A Proteasome-Associated Deubiquitinating Enzyme Length = 404 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 773 | |||
| 1nb8_A | 353 | Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub | 6e-18 | |
| 2f1z_A | 522 | Ubiquitin carboxyl-terminal hydrolase 7; hausp, US | 4e-17 | |
| 3mhs_A | 476 | Ubiquitin carboxyl-terminal hydrolase 8; multi-pro | 1e-14 | |
| 3nhe_A | 348 | Ubiquitin carboxyl-terminal hydrolase 2; cysteine | 6e-14 | |
| 2y6e_A | 367 | Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; | 2e-13 | |
| 2gfo_A | 396 | Ubiquitin carboxyl-terminal hydrolase 8; protease, | 4e-11 | |
| 3i3t_A | 355 | Ubiquitin carboxyl-terminal hydrolase 21; hydrolas | 7e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 7e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-08 | |
| 2ayn_A | 404 | Ubiquitin carboxyl-terminal hydrolase 14; deubiqui | 1e-09 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 2e-09 | |
| 1vjv_A | 415 | Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, | 2e-07 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 3e-04 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 8e-04 |
| >1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A Length = 353 | Back alignment and structure |
|---|
Score = 84.9 bits (210), Expect = 6e-18
Identities = 44/205 (21%), Positives = 74/205 (36%), Gaps = 63/205 (30%)
Query: 1 MKKKITSPFCFPGELNMQRRLSEPSQLD-LIYDLSAVLIHKGTAVNSGHYIALIKDENTG 59
KI F FP +L + L + D Y L AVL+H G + GHY+ + + G
Sbjct: 210 QNIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDN-HGGHYVVYLNPKGDG 268
Query: 60 QWWEFDDEHVSNLGHHPFGEGSSSSGSKVVRSEPVVCQPVSERVEGANENHVDVHLPSSE 119
+W +FDD+ VS + E G +++
Sbjct: 269 KWCKFDDDVVS----------------------RCTKEEAIEHNYGGHDD---------- 296
Query: 120 YYNGSNVERFTSNDAYMLMYNLRRDKEDSKRKDVVHDVNNMEIESEMIFFNDDIFLPSHL 179
++ +AYML+Y +R K +V+ V + +I P L
Sbjct: 297 -----DLSVRHCTNAYMLVY-IRESKLS----EVLQAVTDHDI-------------PQQL 333
Query: 180 GKDIKELNRSYLDGCEQFKLRKNRE 204
+ ++E R + + RK R+
Sbjct: 334 VERLQEEKR------IEAQKRKERQ 352
|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Length = 522 | Back alignment and structure |
|---|
| >3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 3m99_A Length = 476 | Back alignment and structure |
|---|
| >3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} PDB: 2hd5_A 2ibi_A Length = 348 | Back alignment and structure |
|---|
| >2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A Length = 396 | Back alignment and structure |
|---|
| >3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} PDB: 2y5b_A 3mtn_A Length = 355 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A Length = 404 | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 | Back alignment and structure |
|---|
| >1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 Length = 415 | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 773 | |||
| 1nb8_A | 353 | Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub | 99.79 | |
| 2y6e_A | 367 | Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; | 99.76 | |
| 2f1z_A | 522 | Ubiquitin carboxyl-terminal hydrolase 7; hausp, US | 99.75 | |
| 3nhe_A | 348 | Ubiquitin carboxyl-terminal hydrolase 2; cysteine | 99.74 | |
| 1vjv_A | 415 | Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, | 99.73 | |
| 2ayn_A | 404 | Ubiquitin carboxyl-terminal hydrolase 14; deubiqui | 99.72 | |
| 2gfo_A | 396 | Ubiquitin carboxyl-terminal hydrolase 8; protease, | 99.72 | |
| 3i3t_A | 355 | Ubiquitin carboxyl-terminal hydrolase 21; hydrolas | 99.67 | |
| 3mhs_A | 476 | Ubiquitin carboxyl-terminal hydrolase 8; multi-pro | 99.66 | |
| 3plu_A | 93 | Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- | 99.57 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 99.53 | |
| 4ajy_B | 118 | Transcription elongation factor B polypeptide 2; E | 99.53 | |
| 2fnj_B | 118 | Transcription elongation factor B polypeptide 2; b | 99.53 | |
| 1wju_A | 100 | NEDD8 ultimate buster-1; ubiquitin-like domain, st | 99.49 | |
| 1uh6_A | 100 | Ubiquitin-like 5; beta-grAsp fold, structural geno | 99.47 | |
| 3phx_B | 79 | Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu | 99.45 | |
| 4dbg_A | 105 | Ranbp-type and C3HC4-type zinc finger-containing; | 99.44 | |
| 4a3p_A | 217 | Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H | 99.44 | |
| 2kk8_A | 84 | Uncharacterized protein AT4G05270; solution arabid | 99.43 | |
| 2kj6_A | 97 | Tubulin folding cofactor B; methods development, N | 99.4 | |
| 2kjr_A | 95 | CG11242; UBL, ubiquitin, ubiquitin-like, structura | 99.4 | |
| 4fbj_B | 88 | NEDD8; effector-HOST target complex, glutamine dea | 99.38 | |
| 1v2y_A | 105 | 3300001G02RIK protein; hypothetical protein, ubiqu | 99.37 | |
| 4b6w_A | 86 | Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik | 99.37 | |
| 3jyu_A | 231 | Ubiquitin carboxyl-terminal hydrolase; domain in u | 99.37 | |
| 2faz_A | 78 | Ubiquitin-like containing PHD and ring finger DOM | 99.36 | |
| 4eew_A | 88 | Large proline-rich protein BAG6; ubiquitin-like fo | 99.36 | |
| 2uyz_B | 79 | Small ubiquitin-related modifier 1; sumoylation, c | 99.36 | |
| 3v6c_B | 91 | Ubiquitin; structural genomics, structural genomic | 99.36 | |
| 2lxa_A | 87 | Ubiquitin-like protein MDY2; ubiquitin-like domain | 99.36 | |
| 2hj8_A | 88 | Interferon-induced 17 kDa protein; HR2873B, human | 99.35 | |
| 2kan_A | 94 | Uncharacterized protein AR3433A; ubiquitin fold, a | 99.35 | |
| 4dwf_A | 90 | HLA-B-associated transcript 3; ubiquitin-like doma | 99.35 | |
| 2bwf_A | 77 | Ubiquitin-like protein DSK2; signaling protein, UB | 99.34 | |
| 4a20_A | 98 | Ubiquitin-like protein MDY2; protein binding, GET- | 99.34 | |
| 1wyw_B | 97 | Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho | 99.34 | |
| 3dbh_I | 88 | NEDD8; cell cycle, activating enzyme, apoptosis, m | 99.34 | |
| 2l7r_A | 93 | Ubiquitin-like protein FUBI; structural genomics, | 99.34 | |
| 1ndd_A | 76 | NEDD8, protein (ubiquitin-like protein NEDD8); pro | 99.33 | |
| 2wyq_A | 85 | HHR23A, UV excision repair protein RAD23 homolog A | 99.33 | |
| 2kd0_A | 85 | LRR repeats and ubiquitin-like domain-containing p | 99.32 | |
| 3m62_B | 106 | UV excision repair protein RAD23; armadillo-like r | 99.31 | |
| 3n3k_B | 85 | Ubiquitin; hydrolase, protease, thiol protease, DU | 99.31 | |
| 1wy8_A | 89 | NP95-like ring finger protein, isoform A; ubiquiti | 99.31 | |
| 1v5o_A | 102 | 1700011N24RIK protein; hypothetical protein, ubiqu | 99.31 | |
| 1wh3_A | 87 | 59 kDa 2'-5'-oligoadenylate synthetase like protei | 99.31 | |
| 1sif_A | 88 | Ubiquitin; hydrophobic mutants, folding, stability | 99.3 | |
| 2dzi_A | 81 | Ubiquitin-like protein 4A; GDX, structural genomic | 99.3 | |
| 1uel_A | 95 | HHR23B, UV excision repair protein RAD23 homolog B | 99.3 | |
| 2kdb_A | 99 | Homocysteine-responsive endoplasmic reticulum- res | 99.29 | |
| 4hcn_B | 98 | Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas | 99.29 | |
| 1ttn_A | 106 | DC-UBP, dendritic cell-derived ubiquitin-like prot | 99.29 | |
| 3a9j_A | 76 | Ubiquitin; protein complex, cytoplasm, isopeptide | 99.29 | |
| 3m63_B | 101 | Ubiquitin domain-containing protein DSK2; armadill | 99.29 | |
| 3mtn_B | 85 | UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit | 99.28 | |
| 3k9o_B | 96 | Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b | 99.27 | |
| 1wgd_A | 93 | Homocysteine-responsive endoplasmic reticulum- res | 99.27 | |
| 2klc_A | 101 | Ubiquilin-1; ubiquitin-like, structural genomics, | 99.27 | |
| 1we7_A | 115 | SF3A1 protein; structural genomics, ubiquitin-like | 99.27 | |
| 1yqb_A | 100 | Ubiquilin 3; structural genomics consortium, ubiqu | 99.26 | |
| 1se9_A | 126 | Ubiquitin family; ubiquitin-like, cell-free, wheat | 99.26 | |
| 1wx8_A | 96 | Riken cDNA 4931431F19; ubiquitin-like domain, ubiq | 99.26 | |
| 1v6e_A | 95 | Cytoskeleton-associated protein 1; tubulin-specifi | 99.25 | |
| 1wgh_A | 116 | Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo | 99.25 | |
| 2kdi_A | 114 | Ubiquitin, vacuolar protein sorting-associated pro | 99.25 | |
| 2dzm_A | 100 | FAS-associated factor 1; ubiquitin-like domain, HF | 99.25 | |
| 1wxv_A | 92 | BAG-family molecular chaperone regulator-1; struct | 99.24 | |
| 1we6_A | 111 | Splicing factor, putative; structural genomics, ub | 99.24 | |
| 2gow_A | 125 | HCG-1 protein, ubiquitin-like protein 3; BC059385, | 99.23 | |
| 1yx5_B | 98 | Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s | 99.23 | |
| 1v5t_A | 90 | 8430435I17RIK protein; hypothetical protein, ubiqu | 99.23 | |
| 1j8c_A | 125 | Ubiquitin-like protein hplic-2; ubiquitin-like dom | 99.23 | |
| 3vdz_A | 111 | Ubiquitin-40S ribosomal protein S27A; gadolinium, | 99.22 | |
| 3b1l_X | 76 | E3 ubiquitin-protein ligase parkin; proteasome, AL | 98.84 | |
| 1wgg_A | 96 | Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti | 99.2 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.2 | |
| 1wx7_A | 106 | Ubiquilin 3; ubiquitin-like domain, structural gen | 99.2 | |
| 1v86_A | 95 | DNA segment, CHR 7, wayne state university 128, ex | 99.2 | |
| 3l0w_B | 169 | Monoubiquitinated proliferating cell nuclear antig | 99.2 | |
| 2daf_A | 118 | FLJ35834 protein; hypothetical protein FLJ35834, u | 99.2 | |
| 2ojr_A | 111 | Ubiquitin; lanthide-binding TAG, terbium, TB, SAD | 99.17 | |
| 1t0y_A | 122 | Tubulin folding cofactor B; ubiquitin-like, cytosk | 99.16 | |
| 2dzj_A | 88 | Synaptic glycoprotein SC2; ubiquitin-like fold, st | 99.16 | |
| 3q3f_A | 189 | Ribonuclease/ubiquitin chimeric protein; domain SW | 99.16 | |
| 3rt3_B | 159 | Ubiquitin-like protein ISG15; ubiquitin-like domai | 99.14 | |
| 3u5e_m | 128 | 60S ribosomal protein L40; translation, ribosome, | 99.13 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.13 | |
| 1x1m_A | 107 | Ubiquitin-like protein SB132; structural genomics, | 99.12 | |
| 3u30_A | 172 | Ubiquitin, linear DI-ubiquitin; immune system; 2.4 | 99.12 | |
| 1wf9_A | 107 | NPL4 family protein; beta-grAsp fold like domain, | 99.11 | |
| 3u5c_f | 152 | 40S ribosomal protein S31; translation, ribosome, | 99.11 | |
| 1w6v_A | 141 | Ubiquitin carboxyl-terminal hydrolase 15; UCH, USP | 99.08 | |
| 1wia_A | 95 | Hypothetical ubiquitin-like protein (riken cDNA 20 | 99.07 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.05 | |
| 3b08_A | 152 | Polyubiquitin-C, ubiquitin; protein complex, signa | 99.03 | |
| 2kzr_A | 86 | Ubiquitin thioesterase OTU1; structural genomics, | 98.97 | |
| 3ai5_A | 307 | Yeast enhanced green fluorescent protein, ubiquit; | 98.95 | |
| 4a3p_A | 217 | Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H | 98.93 | |
| 2xzm_9 | 189 | RPS31E; ribosome, translation; 3.93A {Tetrahymena | 98.93 | |
| 2io1_B | 94 | Small ubiquitin-related modifier 3 precursor; SUMO | 98.89 | |
| 1wjn_A | 97 | Tubulin-folding protein TBCE; ubiquitin-like domai | 98.85 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 98.84 | |
| 1w6v_A | 141 | Ubiquitin carboxyl-terminal hydrolase 15; UCH, USP | 98.83 | |
| 1wm3_A | 72 | Ubiquitin-like protein SMT3B; ubiquitin fold, half | 98.81 | |
| 3jyu_A | 231 | Ubiquitin carboxyl-terminal hydrolase; domain in u | 98.81 | |
| 2io0_B | 91 | Small ubiquitin-related modifier 2 precursor; SUMO | 98.75 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 98.74 | |
| 3a4r_A | 79 | Nfatc2-interacting protein; ubiquitin fold, coiled | 98.74 | |
| 2d07_B | 93 | Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho | 98.67 | |
| 1wz0_A | 104 | Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li | 98.63 | |
| 2k8h_A | 110 | Small ubiquitin protein; SUMO, post-translational | 98.6 | |
| 2eke_C | 106 | Ubiquitin-like protein SMT3; UBC9, SUMO binding mo | 98.59 | |
| 2vhf_A | 374 | Ubiquitin carboxyl-terminal hydrolase CYLD; cytoki | 98.18 | |
| 3kyd_D | 115 | Small ubiquitin-related modifier 1; SUMO, thioeste | 98.15 | |
| 3pge_A | 200 | SUMO-modified proliferating cell nuclear antigen; | 98.08 | |
| 4efo_A | 94 | Serine/threonine-protein kinase TBK1; ubiquitin li | 98.05 | |
| 2pjh_A | 80 | Protein NPL4, nuclear protein localization protein | 97.93 | |
| 3tix_A | 207 | Ubiquitin-like protein SMT3, RNA-induced transcri | 97.9 | |
| 3v7o_A | 227 | Minor nucleoprotein VP30; ssgcid, seattle structur | 97.46 | |
| 3goe_A | 82 | DNA repair protein RAD60; SUMO-like domain, sumoyl | 97.44 | |
| 3uf8_A | 209 | Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- | 96.9 | |
| 2jxx_A | 97 | Nfatc2-interacting protein; nuclear factor of acti | 96.75 | |
| 2kc2_A | 128 | Talin-1, F1; FERM, adhesion, cell membrane, cell p | 96.6 | |
| 3ix6_A | 360 | TS, tsase, thymidylate synthase; niaid, ssgcid, se | 96.52 | |
| 4da1_A | 389 | Protein phosphatase 1K, mitochondrial; metal-ION-a | 95.96 | |
| 3qx1_A | 84 | FAS-associated factor 1; UBX, protein binding, P97 | 95.72 | |
| 2l76_A | 95 | Nfatc2-interacting protein; ubiquitin-like domain, | 95.49 | |
| 2al3_A | 90 | TUG long isoform; TUG UBL1 insulin, endocytosis/ex | 95.23 | |
| 2dzk_A | 109 | UBX domain-containing protein 2; ubiquitin-like fo | 94.46 | |
| 2bps_A | 81 | YUKD protein; ubiquitin-like protein, ubiquitin; 2 | 93.81 | |
| 1wj4_A | 124 | KIAA0794 protein; UBX domain, beta-grAsp fold, str | 92.09 | |
| 4e71_A | 111 | Plexin-B2, MM1; transmembrane, signaling, RBD, str | 92.05 | |
| 2r2o_A | 138 | Plexin-B1; effector domain, structural genomics, s | 92.04 | |
| 2cr5_A | 109 | Reproduction 8; UBX domain, D0H8S2298E protein, st | 91.51 | |
| 4e74_A | 117 | Plexin-A4; RBD, structural genomics, structural ge | 90.19 | |
| 3h6n_A | 127 | Plexin-D1; structural genomics consortium, SGC, me | 89.52 | |
| 3kuz_A | 126 | Plexin-C1; structural genomics, structural genomic | 88.22 | |
| 1s3s_G | 127 | P47 protein; AAA ATPase, protein-protein complex, | 87.58 | |
| 2kvr_A | 130 | Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi | 80.78 |
| >1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A | Back alignment and structure |
|---|
Probab=99.79 E-value=8.8e-20 Score=199.94 Aligned_cols=134 Identities=27% Similarity=0.433 Sum_probs=97.2
Q ss_pred ccccCcceecCCcccCCCCcCCCC-CCCcceEEEEEEEeecCCCCCceEEEEEEcCCCCcEEEEcCcceeeeCCCCCCCC
Q 004117 2 KKKITSPFCFPGELNMQRRLSEPS-QLDLIYDLSAVLIHKGTAVNSGHYIALIKDENTGQWWEFDDEHVSNLGHHPFGEG 80 (773)
Q Consensus 2 rkKi~~~i~FP~~LDm~~~~~~~~-~~~~~Y~L~aVliH~G~sa~sGHY~a~ik~~~~~~W~~FdD~~V~~~~~~~~~~~ 80 (773)
+.|+++.|.||..|||++|+.... .....|+|+|||+|.|+ +++|||+|||++..+++||.|||+.|++++...
T Consensus 211 ~~K~~~~v~fp~~Ldl~~~~~~~~~~~~~~Y~L~avv~H~G~-~~~GHY~a~v~~~~~~~W~~fnD~~V~~v~~~~---- 285 (353)
T 1nb8_A 211 NIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGD-NHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEE---- 285 (353)
T ss_dssp -CCCCCCCBCCSEEECGGGBSSCCTTSCCEEEEEEEEEEESS-TTCCCEEEEECTTSSSCCEEEETTEEEECCHHH----
T ss_pred eEecCcEEECCCeeehhhhhcccCCCCCceEEEEEEEEEeCC-CCCcEEEEEEecCCCCCEEEEECcceEECCHHH----
Confidence 579999999999999999997642 33689999999999999 799999999998778999999999999998431
Q ss_pred CCCCCCcccccCCcccCCccccccccCCCCcccCCCCccccCCCccccccCCceEEEEEEecCcccccccccccccccch
Q 004117 81 SSSSGSKVVRSEPVVCQPVSERVEGANENHVDVHLPSSEYYNGSNVERFTSNDAYMLMYNLRRDKEDSKRKDVVHDVNNM 160 (773)
Q Consensus 81 ~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~AYmL~Y~r~~~~~~~~~~~~~~~~~~~ 160 (773)
+..+.+| |.. .......+.+||||||+|.+... +++.+
T Consensus 286 --------v~~~~~g--------------g~~-----------~~~~~~~~~~aYiLfY~r~~~~~-----~~~~~---- 323 (353)
T 1nb8_A 286 --------AIEHNYG--------------GHD-----------DDLSVRHCTNAYMLVYIRESKLS-----EVLQA---- 323 (353)
T ss_dssp --------HTGGGSC--------------CC------------------CCEEEEEEEEEETTTHH-----HHTCC----
T ss_pred --------HHHHhcC--------------CCc-----------cccccCcCCeEEEEEEEECchhh-----hhhcc----
Confidence 1111221 000 00001246789999999987542 11111
Q ss_pred hhhhhhhccCCCCCcchhHHHHHHHHHHHHh
Q 004117 161 EIESEMIFFNDDIFLPSHLGKDIKELNRSYL 191 (773)
Q Consensus 161 ~~~~~~~~~~~~~~lP~~l~~~V~~~N~~~~ 191 (773)
-....+|+++.+.++++|..-+
T Consensus 324 ---------~~~~~~p~~~~~~~~~~~~~~~ 345 (353)
T 1nb8_A 324 ---------VTDHDIPQQLVERLQEEKRIEA 345 (353)
T ss_dssp ---------CCGGGSCHHHHHHHHHHHHHHH
T ss_pred ---------cCccccCHHHHHHHHHHHHHHH
Confidence 1224689999999999887655
|
| >2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} SCOP: d.3.1.9 PDB: 2hd5_A 3v6c_A 3v6e_A 2ibi_A | Back alignment and structure |
|---|
| >1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 | Back alignment and structure |
|---|
| >2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A | Back alignment and structure |
|---|
| >2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A | Back alignment and structure |
|---|
| >3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} SCOP: d.3.1.0 PDB: 2y5b_A 3mtn_A | Back alignment and structure |
|---|
| >3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 4fjc_A 4fk5_A 4fip_A 3m99_A | Back alignment and structure |
|---|
| >3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* | Back alignment and structure |
|---|
| >2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A | Back alignment and structure |
|---|
| >1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A | Back alignment and structure |
|---|
| >4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A | Back alignment and structure |
|---|
| >2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B | Back alignment and structure |
|---|
| >1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} | Back alignment and structure |
|---|
| >3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} | Back alignment and structure |
|---|
| >2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B | Back alignment and structure |
|---|
| >3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B | Back alignment and structure |
|---|
| >2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A | Back alignment and structure |
|---|
| >2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S | Back alignment and structure |
|---|
| >4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A | Back alignment and structure |
|---|
| >1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C | Back alignment and structure |
|---|
| >3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I | Back alignment and structure |
|---|
| >2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A | Back alignment and structure |
|---|
| >2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A | Back alignment and structure |
|---|
| >2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... | Back alignment and structure |
|---|
| >3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A | Back alignment and structure |
|---|
| >1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A | Back alignment and structure |
|---|
| >1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B | Back alignment and structure |
|---|
| >1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A | Back alignment and structure |
|---|
| >1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A | Back alignment and structure |
|---|
| >3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A | Back alignment and structure |
|---|
| >1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B | Back alignment and structure |
|---|
| >2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} | Back alignment and structure |
|---|
| >3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A | Back alignment and structure |
|---|
| >3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} | Back alignment and structure |
|---|
| >1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f | Back alignment and structure |
|---|
| >1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B | Back alignment and structure |
|---|
| >2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* | Back alignment and structure |
|---|
| >4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A | Back alignment and structure |
|---|
| >2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 | Back alignment and structure |
|---|
| >2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B | Back alignment and structure |
|---|
| >3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} | Back alignment and structure |
|---|
| >2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A | Back alignment and structure |
|---|
| >2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A | Back alignment and structure |
|---|
| >1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >2vhf_A Ubiquitin carboxyl-terminal hydrolase CYLD; cytokine signalling, linkage specificity, deubiquitinating enzyme, Lys63- linked, anti-oncogene; 2.8A {Homo sapiens} | Back alignment and structure |
|---|
| >3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 | Back alignment and structure |
|---|
| >3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} | Back alignment and structure |
|---|
| >2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} | Back alignment and structure |
|---|
| >3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* | Back alignment and structure |
|---|
| >3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* | Back alignment and structure |
|---|
| >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A | Back alignment and structure |
|---|
| >3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A | Back alignment and structure |
|---|
| >2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A | Back alignment and structure |
|---|
| >2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A | Back alignment and structure |
|---|
| >2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 | Back alignment and structure |
|---|
| >4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* | Back alignment and structure |
|---|
| >3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A | Back alignment and structure |
|---|
| >2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 773 | ||||
| d2gfoa1 | 348 | d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal h | 5e-14 | |
| d2hd5a1 | 336 | d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hy | 9e-13 | |
| d1vjva_ | 397 | d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase | 2e-12 | |
| d2ayna1 | 383 | d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hy | 7e-11 | |
| d1nbfa_ | 347 | d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase | 2e-07 | |
| d1w6va1 | 120 | d.324.1.1 (A:1-120) Ubiquitin carboxyl-terminal hy | 2e-06 | |
| d1wjna_ | 97 | d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse | 9e-05 | |
| d1wxva1 | 81 | d.15.1.1 (A:7-87) Bag-family molecular chaperone r | 1e-04 | |
| d1v5oa_ | 102 | d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu | 3e-04 | |
| d1zkha1 | 86 | d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t | 0.001 |
| >d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Ubiquitin carboxyl-terminal hydrolase, UCH domain: Ubiquitin carboxyl-terminal hydrolase 8 species: Human (Homo sapiens) [TaxId: 9606]
Score = 71.7 bits (174), Expect = 5e-14
Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 1/70 (1%)
Query: 1 MKKKITSPFCFPGELNMQRRLSEPSQLDLIYDLSAVLIHKGTAVNSGHYIALIKDENTGQ 60
+K TS L++ + + P Y+L +V H G + GHY A K+ +
Sbjct: 260 KQKLQTSVDFPLENLDLSQYVIGPKNNLKKYNLFSVSNHYGGL-DGGHYTAYCKNAARQR 318
Query: 61 WWEFDDEHVS 70
W++FDD VS
Sbjct: 319 WFKFDDHEVS 328
|
| >d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 336 | Back information, alignment and structure |
|---|
| >d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 397 | Back information, alignment and structure |
|---|
| >d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} Length = 347 | Back information, alignment and structure |
|---|
| >d1w6va1 d.324.1.1 (A:1-120) Ubiquitin carboxyl-terminal hydrolase 15 {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 773 | |||
| d1nbfa_ | 347 | Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAU | 99.81 | |
| d2ayna1 | 383 | Ubiquitin carboxyl-terminal hydrolase 14 {Human (H | 99.67 | |
| d2hd5a1 | 336 | Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Hum | 99.65 | |
| d2gfoa1 | 348 | Ubiquitin carboxyl-terminal hydrolase 8 {Human (Ho | 99.63 | |
| d1vjva_ | 397 | Ubiquitin carboxyl-terminal hydrolase 6 {Baker's y | 99.62 | |
| d1bt0a_ | 73 | Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI | 99.55 | |
| d2zeqa1 | 78 | Ubiquitin-like domain of parkin {Mouse (Mus muscul | 99.53 | |
| d1z2ma2 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.53 | |
| d2bwfa1 | 73 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.52 | |
| d1ttna1 | 80 | Dendritic cell-derived ubiquitin-like protein {Hum | 99.51 | |
| d1wh3a_ | 87 | 2'-5'-oligoadenylate synthetase-like protein, OASL | 99.5 | |
| d1wy8a1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.5 | |
| d1m94a_ | 73 | Ubiquitin-like modifier protein hub1 {Baker's yeas | 99.49 | |
| d2faza1 | 76 | Ubiquitin-like PHD and RING finger domain-containi | 99.49 | |
| d1z2ma1 | 76 | Interferon-induced 15 kDa protein {Human (Homo sap | 99.48 | |
| d1zkha1 | 86 | Splicing factor 3 subunit 1, C-terminal domain {Hu | 99.46 | |
| d1ogwa_ | 76 | Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1wx9a1 | 73 | Large proline-rich protein BAT3 {Human (Homo sapie | 99.44 | |
| d1yqba1 | 84 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.44 | |
| d1uh6a_ | 100 | Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu | 99.41 | |
| d1v5oa_ | 102 | 1700011n24rik protein {Mouse (Mus musculus) [TaxId | 99.41 | |
| d1j8ca_ | 103 | Ubiquitin-like N-terminal domain of PLIC-2 {Human | 99.38 | |
| d1oqya4 | 77 | Ubiquitin-like domain of Rad23 homolog A (Hhr23a) | 99.38 | |
| d1we6a_ | 111 | Splicing factor 3 subunit 1, C-terminal domain {Th | 99.37 | |
| d2c9wb1 | 103 | Elongin B {Human (Homo sapiens) [TaxId: 9606]} | 99.36 | |
| d1uela_ | 95 | Ubiquitin-like domain of Rad23 homolog B (Hhr23B) | 99.36 | |
| d1wx8a1 | 83 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 99.36 | |
| d1wxva1 | 81 | Bag-family molecular chaperone regulator-1 {Human | 99.31 | |
| d1se9a_ | 101 | Hypothetical protein At3g01050 {Thale cress (Arabi | 99.29 | |
| d1w6va1 | 120 | Ubiquitin carboxyl-terminal hydrolase 15 {Human (H | 99.27 | |
| d1wjua_ | 100 | NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens | 99.27 | |
| d1wgha_ | 116 | Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu | 99.27 | |
| d1v2ya_ | 105 | Ubiquitin-like protein 3300001g02rik {Mouse (Mus m | 99.23 | |
| d1wgga_ | 96 | Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M | 99.21 | |
| d1v86a_ | 95 | hypothetical D7wsu128e protein {Mouse (Mus musculu | 99.21 | |
| d1v5ta_ | 90 | 8430435i17rik protein {Mouse (Mus musculus) [TaxId | 99.19 | |
| d1wgda_ | 93 | Homocysteine-responsive endoplasmic reticulum-resi | 99.16 | |
| d1wiaa_ | 95 | Ubiquitin-like protein bab25500 (2010008E23Rik) {M | 99.15 | |
| d1wjna_ | 97 | Tubulin-folding protein TbcE {Mouse (Mus musculus) | 99.13 | |
| d1v6ea_ | 95 | Ubiquitin-like domain of tubulin folding cofactor | 99.1 | |
| d1x1ma1 | 94 | Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta | 99.09 | |
| d1t0ya_ | 90 | Ubiquitin-like domain of tubulin folding cofactor | 99.0 | |
| d1w6va1 | 120 | Ubiquitin carboxyl-terminal hydrolase 15 {Human (H | 98.99 | |
| d1euvb_ | 79 | SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy | 98.9 | |
| d2uyzb1 | 77 | SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax | 98.65 | |
| d1wf9a1 | 94 | NPL4-like protein 1 {Thale cress (Arabidopsis thal | 98.19 | |
| d1wm3a_ | 72 | SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | 97.47 | |
| d2al3a1 | 76 | Tether containing UBX domain for GLUT4 (Tug) {Mous | 95.69 | |
| d1h8ca_ | 82 | Fas-associated factor 1, Faf1 {Human (Homo sapiens | 94.77 | |
| d1i42a_ | 89 | p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | 89.36 | |
| d1wj4a_ | 124 | Hypothetical protein KIAA0794 {Human (Homo sapiens | 86.6 | |
| d2cr5a1 | 96 | UBX domain-containing protein 6 (Reproduction 8) { | 85.97 |
| >d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Ubiquitin carboxyl-terminal hydrolase, UCH domain: Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.81 E-value=7.2e-21 Score=204.59 Aligned_cols=134 Identities=26% Similarity=0.410 Sum_probs=99.3
Q ss_pred ccccCcceecCCcccCCCCcCCCCC-CCcceEEEEEEEeecCCCCCceEEEEEEcCCCCcEEEEcCcceeeeCCCCCCCC
Q 004117 2 KKKITSPFCFPGELNMQRRLSEPSQ-LDLIYDLSAVLIHKGTAVNSGHYIALIKDENTGQWWEFDDEHVSNLGHHPFGEG 80 (773)
Q Consensus 2 rkKi~~~i~FP~~LDm~~~~~~~~~-~~~~Y~L~aVliH~G~sa~sGHY~a~ik~~~~~~W~~FdD~~V~~~~~~~~~~~ 80 (773)
+.|++..|.||.+|||++|+..... ....|+|+|||+|.|. +++|||+|||++..+++||.|||+.|++++...
T Consensus 211 ~~K~~~~v~fp~~Ldl~~~~~~~~~~~~~~Y~L~~vI~H~G~-~~~GHY~~~~~~~~~~~W~~fnD~~V~~v~~~e---- 285 (347)
T d1nbfa_ 211 NIKINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGD-NHGGHYVVYLNPKGDGKWCKFDDDVVSRCTKEE---- 285 (347)
T ss_dssp EEECCCCCBCCSEEECGGGBSSCCTTSCCEEEEEEEEEEEEE-TTEEEEEEEECTTSSSCCEEEETTEEEECCHHH----
T ss_pred ccccCceEeeeeeeccccccccccccCccceeeEEEEEecCC-CCCCEEEEeeecCCCCEEEEEECCceEECCHHH----
Confidence 4699999999999999999876543 3679999999999998 699999999999888899999999999998432
Q ss_pred CCCCCCcccccCCcccCCccccccccCCCCcccCCCCccccCCCccccccCCceEEEEEEecCcccccccccccccccch
Q 004117 81 SSSSGSKVVRSEPVVCQPVSERVEGANENHVDVHLPSSEYYNGSNVERFTSNDAYMLMYNLRRDKEDSKRKDVVHDVNNM 160 (773)
Q Consensus 81 ~~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~AYmL~Y~r~~~~~~~~~~~~~~~~~~~ 160 (773)
+....+|+.. .......+.+||||||+|.+.... .
T Consensus 286 --------v~~~~~g~~~-------------------------~~~~~~~~~~aYiLfY~r~~~~~~-----~------- 320 (347)
T d1nbfa_ 286 --------AIEHNYGGHD-------------------------DDLSVRHCTNAYMLVYIRESKLSE-----V------- 320 (347)
T ss_dssp --------HTGGGSCCCC-------------------------SCCSTTTTEEEEEEEEEEGGGHHH-----H-------
T ss_pred --------HHHhhcCCCc-------------------------cccccCCCCCEEEEEEEecCchHH-----h-------
Confidence 2222222000 011133578899999999874321 0
Q ss_pred hhhhhhhccCCCCCcchhHHHHHHHHHHHHh
Q 004117 161 EIESEMIFFNDDIFLPSHLGKDIKELNRSYL 191 (773)
Q Consensus 161 ~~~~~~~~~~~~~~lP~~l~~~V~~~N~~~~ 191 (773)
........+|+.|.+.|+++|..++
T Consensus 321 ------~~~~~~~~~~~~l~~~~~e~~~~~~ 345 (347)
T d1nbfa_ 321 ------LQAVTDHDIPQQLVERLQEEKRIEA 345 (347)
T ss_dssp ------TCCCCGGGSCHHHHHHHHTHHHHTT
T ss_pred ------hCCCCccccCHHHHHHHHHHHHHHh
Confidence 0111234589999999999988664
|
| >d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1w6va1 d.324.1.1 (A:1-120) Ubiquitin carboxyl-terminal hydrolase 15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1w6va1 d.324.1.1 (A:1-120) Ubiquitin carboxyl-terminal hydrolase 15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|