Citrus Sinensis ID: 004184
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 770 | ||||||
| 255568450 | 762 | sensory transduction histidine kinase, p | 0.959 | 0.969 | 0.617 | 0.0 | |
| 356545957 | 749 | PREDICTED: two-component response regula | 0.936 | 0.962 | 0.589 | 0.0 | |
| 449524812 | 794 | PREDICTED: two-component response regula | 0.980 | 0.950 | 0.585 | 0.0 | |
| 449448936 | 797 | PREDICTED: two-component response regula | 0.971 | 0.938 | 0.586 | 0.0 | |
| 356536913 | 747 | PREDICTED: two-component response regula | 0.935 | 0.963 | 0.592 | 0.0 | |
| 225435163 | 785 | PREDICTED: two-component response regula | 0.931 | 0.913 | 0.538 | 0.0 | |
| 157399678 | 784 | pseudo-response regulator 7 [Castanea sa | 0.977 | 0.960 | 0.525 | 0.0 | |
| 224098126 | 766 | pseudo response regulator [Populus trich | 0.944 | 0.949 | 0.516 | 0.0 | |
| 224098134 | 711 | predicted protein [Populus trichocarpa] | 0.870 | 0.942 | 0.539 | 0.0 | |
| 297736458 | 769 | unnamed protein product [Vitis vinifera] | 0.964 | 0.966 | 0.531 | 0.0 |
| >gi|255568450|ref|XP_002525199.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223535496|gb|EEF37165.1| sensory transduction histidine kinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 882 bits (2280), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 488/790 (61%), Positives = 584/790 (73%), Gaps = 51/790 (6%)
Query: 1 MNVDGKADKRLQELNHCLQAGSKRDENAVVGEQQHLVGDDRLNDSSIAEDVKDGCEGAV- 59
M++DG DK L ELNH L+ G+K+D VV E+Q+L DD IA ++KDG EGA+
Sbjct: 1 MSIDGVGDKYLMELNHQLRNGNKKD--GVVSEEQNLTQDDGFKVDGIARNIKDGHEGALQ 58
Query: 60 TASAVLQM-PQEQPQGAMVCWERFLHLRSLKVLLVENDDSTRHVVAALLRNCGYEVTEAT 118
+ S LQ+ Q+Q GA VCWERFLHL SLKVLLVEND STRHVV ALLRNC YEV EAT
Sbjct: 59 SPSTALQIFQQQQSLGATVCWERFLHLGSLKVLLVENDYSTRHVVTALLRNCSYEVIEAT 118
Query: 119 NGLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSKIMSHKTRKNLPVI----------I 167
NGLQAW+ILEDLTN IDLVLTEV MPCLSG+ LL KIMSHKTRKN+PVI +
Sbjct: 119 NGLQAWRILEDLTNQIDLVLTEVVMPCLSGIGLLYKIMSHKTRKNVPVIMMSSHDSMGLV 178
Query: 168 FKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESCTQTQKSIKSKNVENSGN 227
FKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSES T+TQKS+KSK+VE SGN
Sbjct: 179 FKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESGTETQKSVKSKSVEKSGN 238
Query: 228 NTGSNDEDNNGSIGVNGGDGSDDGSGTQSSWTKKAVEVDSPRHMSPSDQLAECPDSTCAQ 287
+TGS+DED+NGSIG+N GDGSD+GSGTQSSWTK+AVEVDSPR +SP DQ+AECPDSTCAQ
Sbjct: 239 DTGSSDEDDNGSIGLNVGDGSDNGSGTQSSWTKQAVEVDSPRPVSPMDQVAECPDSTCAQ 298
Query: 288 VIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLDLQLEYQTESPIK 347
VIHSNAE++G+++ P+ AKEC++ EE+ ++ A + + V G ++DLQLE Q PIK
Sbjct: 299 VIHSNAEVSGTKQTPIITAKECEEQEEQLDSAAAKDLEKVVPG--NVDLQLECQVADPIK 356
Query: 348 LVGTKKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGAITKIIDSDKEDTE 407
VGTK+ N L+ GS E+ID+ QLD NSE+PSSK +YEAA L G T ID + TE
Sbjct: 357 FVGTKQKNLLERGSGNYKEKIDKEQLDQNSENPSSKSRYEAANLTGFTTNTIDPHMDSTE 416
Query: 408 YEASNKPSKILDINSKSIKDSKELPSLELSLKRLRGVKDIGTTIQDDRNVLRRSDSSAFS 467
EA+N+ ILDI +K D+KE+P+ ELSLKR RG KD+GT +Q+DRNVLRRSDSSAFS
Sbjct: 417 IEATNRHCNILDIKNKPSNDAKEIPTFELSLKRNRGAKDVGTVVQEDRNVLRRSDSSAFS 476
Query: 468 RYNTASNVNKGPGGNIESASQVVNSLEIIKKGSDCGIQSHSNGDPLNQSSNGGSNNMDMG 527
RYN +SN K P N+ S S +SL++ +KG+ C ++SHSN + N SN GSNN+DMG
Sbjct: 477 RYNASSNAKKAPCANMTSGSHYGSSLDVTEKGTVCDLKSHSNSNLPNHCSNVGSNNIDMG 536
Query: 528 STTNNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKNDLLCSPRQVLLDKRDDLVASSVLV 587
STTN+A K LKNKS S+FQ ++D LC+ +Q+L +K DD + +L
Sbjct: 537 STTNHAITKSVVLKNKSGHP-------PSTFQAMRDDPLCATQQILKEKADDTAGAMLLA 589
Query: 588 HPRSTQEQL-----TQHYDNCHHLVHNMQQQHLPHDHDQLSLKKMAEAVPQCGSSNMLGG 642
P + + T HY++ HHL HNMQ ++VP CGSSN+LGG
Sbjct: 590 QPGGSLSECKIQHQTHHYNHYHHLPHNMQTAQ--------------QSVPHCGSSNVLGG 635
Query: 643 FVEGNAGNYSINGSASGSNHG----SNGQNGSSTAVNAGGMNVESDNGIAGKSGSGGASG 698
+EGN GNYSINGSASGSNHG SNGQNGSSTAVNAGG NVESDNGI GKS SG
Sbjct: 636 PLEGNGGNYSINGSASGSNHGSNHVSNGQNGSSTAVNAGGTNVESDNGIGGKS----GSG 691
Query: 699 SGSGSGNRIDKNKFADREAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVRQT 758
GSG GNR D+NKF+ RE A+TK+RQK+ ERCFRKKVRYQSRKRLAEQRPR+RGQFVRQT
Sbjct: 692 DGSGEGNRGDQNKFSQREVALTKFRQKRKERCFRKKVRYQSRKRLAEQRPRVRGQFVRQT 751
Query: 759 ANENTSREPE 768
N +TS+ E
Sbjct: 752 GNGSTSKASE 761
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356545957|ref|XP_003541399.1| PREDICTED: two-component response regulator-like APRR7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449524812|ref|XP_004169415.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449448936|ref|XP_004142221.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356536913|ref|XP_003536977.1| PREDICTED: two-component response regulator-like APRR7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225435163|ref|XP_002281776.1| PREDICTED: two-component response regulator-like PRR73-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|157399678|gb|ABV53463.1| pseudo-response regulator 7 [Castanea sativa] | Back alignment and taxonomy information |
|---|
| >gi|224098126|ref|XP_002311123.1| pseudo response regulator [Populus trichocarpa] gi|222850943|gb|EEE88490.1| pseudo response regulator [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224098134|ref|XP_002311124.1| predicted protein [Populus trichocarpa] gi|222850944|gb|EEE88491.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297736458|emb|CBI25329.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 770 | ||||||
| TAIR|locus:2151206 | 727 | PRR7 "pseudo-response regulato | 0.651 | 0.690 | 0.494 | 7.9e-117 | |
| TAIR|locus:2044376 | 468 | PRR9 "pseudo-response regulato | 0.159 | 0.262 | 0.507 | 1.1e-52 | |
| TAIR|locus:2163198 | 618 | TOC1 "TIMING OF CAB EXPRESSION | 0.151 | 0.189 | 0.367 | 2e-26 | |
| TAIR|locus:2062749 | 183 | AT2G46670 "AT2G46670" [Arabido | 0.066 | 0.278 | 0.653 | 5e-14 | |
| TAIR|locus:2040194 | 596 | RR12 "response regulator 12" [ | 0.138 | 0.179 | 0.363 | 6e-11 | |
| TAIR|locus:2116587 | 552 | RR10 "response regulator 10" [ | 0.140 | 0.195 | 0.352 | 4.1e-10 | |
| TAIR|locus:2093668 | 690 | RR1 "response regulator 1" [Ar | 0.140 | 0.156 | 0.352 | 5.9e-10 | |
| UNIPROTKB|Q4GZK8 | 131 | rr3 "Type A response regulator | 0.136 | 0.801 | 0.307 | 1.7e-09 | |
| TAIR|locus:2008585 | 521 | ARR11 "response regulator 11" | 0.140 | 0.207 | 0.344 | 2.8e-09 | |
| UNIPROTKB|Q4GZK5 | 170 | rr6 "Type A response regulator | 0.140 | 0.635 | 0.291 | 2.8e-09 |
| TAIR|locus:2151206 PRR7 "pseudo-response regulator 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1151 (410.2 bits), Expect = 7.9e-117, P = 7.9e-117
Identities = 267/540 (49%), Positives = 335/540 (62%)
Query: 45 SSIAEDVKDGCEGAVTASAVLQMPQEQPQGAMVCWERFLHLRSLKVLLVENDDSTRHVVA 104
+ I DV++G G LQ+P Q A VCWERFLH+R+++VLLVENDD TR++V
Sbjct: 41 NGITMDVRNGSSGG------LQIPLSQQTAATVCWERFLHVRTIRVLLVENDDCTRYIVT 94
Query: 105 ALLRNCGYEVTEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSKIMSHKTRKNL 163
ALLRNC YEV EA+NG+QAWK+LEDL NHID+VLTEV MP LSG+ LL KI++HK+R+N+
Sbjct: 95 ALLRNCSYEVVEASNGIQAWKVLEDLNNHIDIVLTEVIMPYLSGIGLLCKILNHKSRRNI 154
Query: 164 PVI----------IFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHXXXXXXXXXCT-Q 212
PVI +FKCLSKGAVDFLVKPIRKNELK LWQHVWRRC T Q
Sbjct: 155 PVIMMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKILWQHVWRRCQSSSGSGSESGTHQ 214
Query: 213 TQKSIKSKNVENSGNNTGSNDEXXXXXXXXXXXXXXXXXXXTQSSWTKKAVEVD-SPRHM 271
TQKS+KSK+++ S ++GS+DE QSSWTKKAV+VD SPR +
Sbjct: 215 TQKSVKSKSIKKSDQDSGSSDENENGSIGLNASDGSSDGSGAQSSWTKKAVDVDDSPRAV 274
Query: 272 SPSDQLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQ 331
S D++ DSTCAQV+HSN E ++ V A KE Q+H+++ E+ RDL++ +
Sbjct: 275 SLWDRV----DSTCAQVVHSNPEFPSNQLVAPPAEKETQEHDDKFEDVTM-GRDLEISIR 329
Query: 332 RSLDLQLEYQTESPIKLVGT-KKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAK 390
R+ DL LE + E K G ++ N + SSK ++ +G LDL+SESPSSK +E
Sbjct: 330 RNCDLALEPKDEPLSKTTGIMRQDNSFEKSSSKWKMKVGKGPLDLSSESPSSKQMHEDG- 388
Query: 391 LAGAITKIIDSDKEDT-EYEASNKPSKILDINSKSIKDSXXXXXXXXXXXXXXGVKDIGT 449
G+ K + S +D E EA N K LD N S+K S G KD GT
Sbjct: 389 --GSSFKAMSSHLQDNREPEAPNTHLKTLDTNEASVKISEELMHVEHSSKRHRGTKDDGT 446
Query: 450 TIQDDRNVLRRSDSSAFSRYNTASNVNKGPGGNIESAS-QVVNSLEIIKKGSDCGIQSHS 508
++DDRNVLRRS+ SAFSRYN ASN NK GGN+ S S Q NS ++IKK ++ HS
Sbjct: 447 LVRDDRNVLRRSEGSAFSRYNPASNANKISGGNLGSTSLQDNNSQDLIKK-TEAAYDCHS 505
Query: 509 NGD---PLNQSSNGGSNNMDMGSTT-NNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKND 564
N + P N S+ GSNN DM STT NNAF KP K S SS+V HSS FQP D
Sbjct: 506 NMNESLPHNHRSHVGSNNFDMSSTTENNAFTKPGAPKVSSAGSSSVK--HSS-FQPLPCD 562
|
|
| TAIR|locus:2044376 PRR9 "pseudo-response regulator 9" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163198 TOC1 "TIMING OF CAB EXPRESSION 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2062749 AT2G46670 "AT2G46670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040194 RR12 "response regulator 12" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2116587 RR10 "response regulator 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093668 RR1 "response regulator 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4GZK8 rr3 "Type A response regulator 3" [Oryza sativa Indica Group (taxid:39946)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008585 ARR11 "response regulator 11" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q4GZK5 rr6 "Type A response regulator 6" [Oryza sativa Indica Group (taxid:39946)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 770 | |||
| pfam00072 | 111 | pfam00072, Response_reg, Response regulator receiv | 1e-20 | |
| cd00156 | 113 | cd00156, REC, Signal receiver domain; originally t | 1e-20 | |
| pfam06203 | 45 | pfam06203, CCT, CCT motif | 2e-19 | |
| COG0784 | 130 | COG0784, CheY, FOG: CheY-like receiver [Signal tra | 4e-19 | |
| COG2204 | 464 | COG2204, AtoC, Response regulator containing CheY- | 4e-15 | |
| COG0745 | 229 | COG0745, OmpR, Response regulators consisting of a | 4e-14 | |
| COG3437 | 360 | COG3437, COG3437, Response regulator containing a | 2e-12 | |
| TIGR02154 | 226 | TIGR02154, PhoB, phosphate regulon transcriptional | 9e-12 | |
| smart00448 | 55 | smart00448, REC, cheY-homologous receiver domain | 3e-11 | |
| COG3706 | 435 | COG3706, PleD, Response regulator containing a Che | 3e-09 | |
| TIGR01818 | 463 | TIGR01818, ntrC, nitrogen regulation protein NR(I) | 4e-09 | |
| PRK11361 | 457 | PRK11361, PRK11361, acetoacetate metabolism regula | 7e-09 | |
| CHL00148 | 240 | CHL00148, orf27, Ycf27; Reviewed | 1e-08 | |
| PRK00742 | 354 | PRK00742, PRK00742, chemotaxis-specific methyleste | 1e-08 | |
| COG2197 | 211 | COG2197, CitB, Response regulator containing a Che | 5e-08 | |
| COG4753 | 475 | COG4753, COG4753, Response regulator containing Ch | 2e-07 | |
| PRK10766 | 221 | PRK10766, PRK10766, DNA-binding transcriptional re | 4e-07 | |
| PRK10365 | 441 | PRK10365, PRK10365, transcriptional regulatory pro | 4e-07 | |
| PRK10955 | 232 | PRK10955, PRK10955, DNA-binding transcriptional re | 5e-07 | |
| PLN03029 | 222 | PLN03029, PLN03029, type-a response regulator prot | 6e-07 | |
| PRK15115 | 444 | PRK15115, PRK15115, response regulator GlrR; Provi | 8e-06 | |
| COG2201 | 350 | COG2201, CheB, Chemotaxis response regulator conta | 1e-05 | |
| PRK09581 | 457 | PRK09581, pleD, response regulator PleD; Reviewed | 1e-05 | |
| PRK11517 | 223 | PRK11517, PRK11517, transcriptional regulatory pro | 2e-05 | |
| PRK15479 | 221 | PRK15479, PRK15479, transcriptional regulatory pro | 2e-05 | |
| COG4566 | 202 | COG4566, TtrR, Response regulator [Signal transduc | 3e-05 | |
| PRK10643 | 222 | PRK10643, PRK10643, DNA-binding transcriptional re | 3e-04 | |
| PRK09836 | 227 | PRK09836, PRK09836, DNA-binding transcriptional ac | 5e-04 | |
| PRK10610 | 129 | PRK10610, PRK10610, chemotaxis regulatory protein | 6e-04 | |
| TIGR02956 | 968 | TIGR02956, TMAO_torS, TMAO reductase sytem sensor | 6e-04 | |
| PRK11173 | 237 | PRK11173, PRK11173, two-component response regulat | 7e-04 | |
| PRK09390 | 202 | PRK09390, fixJ, response regulator FixJ; Provision | 7e-04 | |
| PRK10693 | 303 | PRK10693, PRK10693, response regulator of RpoS; Pr | 0.001 | |
| PRK15347 | 921 | PRK15347, PRK15347, two component system sensor ki | 0.002 | |
| PRK10841 | 924 | PRK10841, PRK10841, hybrid sensory kinase in two-c | 0.002 |
| >gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain | Back alignment and domain information |
|---|
Score = 87.6 bits (218), Expect = 1e-20
Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 15/112 (13%)
Query: 90 VLLVENDDSTRHVVAALLRNCGYEVTEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSGV 148
VL+V++D R ++ LL GY V EA +G +A ++L+ DL+L ++ MP + G+
Sbjct: 1 VLIVDDDPLIRELLRQLLEKEGYVVAEADDGEEALELLK--EKRPDLILLDIRMPGMDGL 58
Query: 149 ALLSKIMSHKTRKNLPVIIF----------KCLSKGAVDFLVKPIRKNELKN 190
LL +I + PVI+ + L GA DFL KP EL
Sbjct: 59 ELLRRI--RRRPPTTPVIVLTAHGDEEDAVEALKAGANDFLSKPFDPEELVA 108
|
This domain receives the signal from the sensor partner in bacterial two-component systems. It is usually found N-terminal to a DNA binding effector domain. Length = 111 |
| >gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >gnl|CDD|203407 pfam06203, CCT, CCT motif | Back alignment and domain information |
|---|
| >gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|225114 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|223816 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|225971 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >gnl|CDD|214668 smart00448, REC, cheY-homologous receiver domain | Back alignment and domain information |
|---|
| >gnl|CDD|226229 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|233585 TIGR01818, ntrC, nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214376 CHL00148, orf27, Ycf27; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234828 PRK00742, PRK00742, chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225107 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|227095 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182711 PRK10766, PRK10766, DNA-binding transcriptional regulator TorR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182864 PRK10955, PRK10955, DNA-binding transcriptional regulator CpxR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215544 PLN03029, PLN03029, type-a response regulator protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225111 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226932 COG4566, TtrR, Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|182612 PRK10643, PRK10643, DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182102 PRK09836, PRK09836, DNA-binding transcriptional activator CusR; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234070 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >gnl|CDD|183013 PRK11173, PRK11173, two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181815 PRK09390, fixJ, response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182652 PRK10693, PRK10693, response regulator of RpoS; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237951 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 770 | |||
| COG0745 | 229 | OmpR Response regulators consisting of a CheY-like | 99.78 | |
| PRK11091 | 779 | aerobic respiration control sensor protein ArcB; P | 99.74 | |
| TIGR02956 | 968 | TMAO_torS TMAO reductase sytem sensor TorS. This p | 99.73 | |
| PF06203 | 45 | CCT: CCT motif; InterPro: IPR010402 The CCT (CONST | 99.72 | |
| PRK11466 | 914 | hybrid sensory histidine kinase TorS; Provisional | 99.72 | |
| PRK15347 | 921 | two component system sensor kinase SsrA; Provision | 99.72 | |
| PRK10841 | 924 | hybrid sensory kinase in two-component regulatory | 99.68 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 99.68 | |
| PRK09959 | 1197 | hybrid sensory histidine kinase in two-component r | 99.67 | |
| COG4753 | 475 | Response regulator containing CheY-like receiver d | 99.67 | |
| COG4565 | 224 | CitB Response regulator of citrate/malate metaboli | 99.65 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 99.65 | |
| PF00072 | 112 | Response_reg: Response regulator receiver domain; | 99.62 | |
| PRK13837 | 828 | two-component VirA-like sensor kinase; Provisional | 99.6 | |
| COG4566 | 202 | TtrR Response regulator [Signal transduction mecha | 99.59 | |
| COG3437 | 360 | Response regulator containing a CheY-like receiver | 99.55 | |
| COG0784 | 130 | CheY FOG: CheY-like receiver [Signal transduction | 99.54 | |
| COG2197 | 211 | CitB Response regulator containing a CheY-like rec | 99.51 | |
| PLN03029 | 222 | type-a response regulator protein; Provisional | 99.51 | |
| PRK13557 | 540 | histidine kinase; Provisional | 99.5 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 99.5 | |
| PRK10046 | 225 | dpiA two-component response regulator DpiA; Provis | 99.47 | |
| KOG0519 | 786 | consensus Sensory transduction histidine kinase [S | 99.47 | |
| PRK10816 | 223 | DNA-binding transcriptional regulator PhoP; Provis | 99.47 | |
| PRK11173 | 237 | two-component response regulator; Provisional | 99.47 | |
| PRK09836 | 227 | DNA-binding transcriptional activator CusR; Provis | 99.46 | |
| PRK10529 | 225 | DNA-binding transcriptional activator KdpE; Provis | 99.45 | |
| PRK10643 | 222 | DNA-binding transcriptional regulator BasR; Provis | 99.45 | |
| PRK10161 | 229 | transcriptional regulator PhoB; Provisional | 99.45 | |
| TIGR02154 | 226 | PhoB phosphate regulon transcriptional regulatory | 99.44 | |
| PRK10766 | 221 | DNA-binding transcriptional regulator TorR; Provis | 99.43 | |
| COG3947 | 361 | Response regulator containing CheY-like receiver a | 99.43 | |
| PRK09468 | 239 | ompR osmolarity response regulator; Provisional | 99.42 | |
| PRK11083 | 228 | DNA-binding response regulator CreB; Provisional | 99.42 | |
| PRK10336 | 219 | DNA-binding transcriptional regulator QseB; Provis | 99.42 | |
| PRK10701 | 240 | DNA-binding transcriptional regulator RstA; Provis | 99.41 | |
| PRK13856 | 241 | two-component response regulator VirG; Provisional | 99.41 | |
| TIGR03787 | 227 | marine_sort_RR proteobacterial dedicated sortase s | 99.39 | |
| PRK10430 | 239 | DNA-binding transcriptional activator DcuR; Provis | 99.39 | |
| PRK10955 | 232 | DNA-binding transcriptional regulator CpxR; Provis | 99.39 | |
| PRK11517 | 223 | transcriptional regulatory protein YedW; Provision | 99.38 | |
| CHL00148 | 240 | orf27 Ycf27; Reviewed | 99.37 | |
| PRK10840 | 216 | transcriptional regulator RcsB; Provisional | 99.36 | |
| PRK14084 | 246 | two-component response regulator; Provisional | 99.35 | |
| TIGR02875 | 262 | spore_0_A sporulation transcription factor Spo0A. | 99.35 | |
| TIGR01387 | 218 | cztR_silR_copR heavy metal response regulator. Mem | 99.34 | |
| COG4567 | 182 | Response regulator consisting of a CheY-like recei | 99.33 | |
| PRK09958 | 204 | DNA-binding transcriptional activator EvgA; Provis | 99.33 | |
| PRK09483 | 217 | response regulator; Provisional | 99.32 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 99.32 | |
| PRK13435 | 145 | response regulator; Provisional | 99.31 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 99.31 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 99.31 | |
| PRK11697 | 238 | putative two-component response-regulatory protein | 99.3 | |
| PRK09935 | 210 | transcriptional regulator FimZ; Provisional | 99.29 | |
| PRK10610 | 129 | chemotaxis regulatory protein CheY; Provisional | 99.28 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 99.28 | |
| PRK15479 | 221 | transcriptional regulatory protein TctD; Provision | 99.26 | |
| PRK10710 | 240 | DNA-binding transcriptional regulator BaeR; Provis | 99.25 | |
| PRK10360 | 196 | DNA-binding transcriptional activator UhpA; Provis | 99.25 | |
| PRK12555 | 337 | chemotaxis-specific methylesterase; Provisional | 99.24 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 99.23 | |
| PRK09581 | 457 | pleD response regulator PleD; Reviewed | 99.22 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 99.22 | |
| PRK00742 | 354 | chemotaxis-specific methylesterase; Provisional | 99.22 | |
| PRK09390 | 202 | fixJ response regulator FixJ; Provisional | 99.22 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 99.22 | |
| COG2201 | 350 | CheB Chemotaxis response regulator containing a Ch | 99.16 | |
| PRK15369 | 211 | two component system sensor kinase SsrB; Provision | 99.12 | |
| PRK10403 | 215 | transcriptional regulator NarP; Provisional | 99.11 | |
| PRK13558 | 665 | bacterio-opsin activator; Provisional | 99.1 | |
| PRK10651 | 216 | transcriptional regulator NarL; Provisional | 99.09 | |
| PRK10100 | 216 | DNA-binding transcriptional regulator CsgD; Provis | 99.08 | |
| PRK09191 | 261 | two-component response regulator; Provisional | 99.06 | |
| PRK11475 | 207 | DNA-binding transcriptional activator BglJ; Provis | 98.95 | |
| PRK15411 | 207 | rcsA colanic acid capsular biosynthesis activation | 98.94 | |
| cd00156 | 113 | REC Signal receiver domain; originally thought to | 98.93 | |
| COG3707 | 194 | AmiR Response regulator with putative antiterminat | 98.93 | |
| PRK15029 | 755 | arginine decarboxylase; Provisional | 98.71 | |
| PRK10693 | 303 | response regulator of RpoS; Provisional | 98.67 | |
| COG3279 | 244 | LytT Response regulator of the LytR/AlgR family [T | 98.66 | |
| PRK10618 | 894 | phosphotransfer intermediate protein in two-compon | 98.64 | |
| PRK11107 | 919 | hybrid sensory histidine kinase BarA; Provisional | 98.02 | |
| smart00448 | 55 | REC cheY-homologous receiver domain. CheY regulate | 97.48 | |
| COG3706 | 435 | PleD Response regulator containing a CheY-like rec | 97.26 | |
| PF06490 | 109 | FleQ: Flagellar regulatory protein FleQ; InterPro: | 97.15 | |
| PRK02261 | 137 | methylaspartate mutase subunit S; Provisional | 95.98 | |
| PF09425 | 27 | CCT_2: Divergent CCT motif; InterPro: IPR018467 Th | 95.46 | |
| TIGR00640 | 132 | acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal | 95.31 | |
| cd02071 | 122 | MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin | 95.19 | |
| KOG1601 | 340 | consensus GATA-4/5/6 transcription factors [Transc | 95.14 | |
| cd02067 | 119 | B12-binding B12 binding domain (B12-BD). This doma | 94.21 | |
| PF03709 | 115 | OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal | 93.87 | |
| TIGR01501 | 134 | MthylAspMutase methylaspartate mutase, S subunit. | 91.11 | |
| cd02070 | 201 | corrinoid_protein_B12-BD B12 binding domain of cor | 90.74 | |
| COG2185 | 143 | Sbm Methylmalonyl-CoA mutase, C-terminal domain/su | 90.65 | |
| PRK15399 | 713 | lysine decarboxylase LdcC; Provisional | 90.25 | |
| PRK15400 | 714 | lysine decarboxylase CadA; Provisional | 89.29 | |
| COG4999 | 140 | Uncharacterized domain of BarA-like signal transdu | 89.1 | |
| cd02072 | 128 | Glm_B12_BD B12 binding domain of glutamate mutase | 88.32 | |
| COG0512 | 191 | PabA Anthranilate/para-aminobenzoate synthases com | 87.82 | |
| TIGR02370 | 197 | pyl_corrinoid methyltransferase cognate corrinoid | 86.47 | |
| PF02310 | 121 | B12-binding: B12 binding domain; InterPro: IPR0061 | 85.91 | |
| PRK09426 | 714 | methylmalonyl-CoA mutase; Reviewed | 82.16 | |
| TIGR03815 | 322 | CpaE_hom_Actino helicase/secretion neighborhood Cp | 82.11 | |
| PRK03958 | 176 | tRNA 2'-O-methylase; Reviewed | 81.69 | |
| cd02069 | 213 | methionine_synthase_B12_BD B12 binding domain of m | 81.14 |
| >COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
Probab=99.78 E-value=1e-18 Score=181.51 Aligned_cols=110 Identities=31% Similarity=0.524 Sum_probs=102.3
Q ss_pred cEEEEEecChhhHHHHHHHHHhCCCEEEEECCHHHHHHHHHhcCCCceEEEEcc-CCCCCHHHHHHHHHhhcCCCCcchh
Q 004184 88 LKVLLVENDDSTRHVVAALLRNCGYEVTEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSKIMSHKTRKNLPVI 166 (770)
Q Consensus 88 lrVLIVDDd~~~r~~L~~lLe~~G~eV~~A~dg~EALe~L~~~~~~pDLVLlDi-MPgmdGleLlr~IR~~~~~~~IPII 166 (770)
++||||||++..+..|...|+..||+|..+.++++|++.+.. . |||||+|+ ||++||+++|++||+. ....+|||
T Consensus 1 ~~ILiveDd~~i~~~l~~~L~~~g~~v~~~~~~~~a~~~~~~--~-~dlviLD~~lP~~dG~~~~~~iR~~-~~~~~PIi 76 (229)
T COG0745 1 MRILLVEDDPELAELLKEYLEEEGYEVDVAADGEEALEAARE--Q-PDLVLLDLMLPDLDGLELCRRLRAK-KGSGPPII 76 (229)
T ss_pred CeEEEEcCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHhc--C-CCEEEEECCCCCCCHHHHHHHHHhh-cCCCCcEE
Confidence 489999999999999999999999999999999999999987 6 99999999 9999999999999966 45678898
Q ss_pred hh----------hhHhcCCCcEEeCCCCHHHHHHHHHHHHHHhhc
Q 004184 167 IF----------KCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHS 201 (770)
Q Consensus 167 vl----------~al~aGAddyL~KP~~~eeL~~~L~~vlrr~~~ 201 (770)
++ .++++||||||.|||.+.||.++|+.+++|...
T Consensus 77 ~Lta~~~~~d~v~gl~~GADDYl~KPf~~~EL~ARi~a~lRR~~~ 121 (229)
T COG0745 77 VLTARDDEEDRVLGLEAGADDYLTKPFSPRELLARLRALLRRNAG 121 (229)
T ss_pred EEECCCcHHHHHHHHhCcCCeeeeCCCCHHHHHHHHHHHHCcCcC
Confidence 66 679999999999999999999999999998754
|
|
| >PRK11091 aerobic respiration control sensor protein ArcB; Provisional | Back alignment and domain information |
|---|
| >TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS | Back alignment and domain information |
|---|
| >PF06203 CCT: CCT motif; InterPro: IPR010402 The CCT (CONSTANS, CO-like, and TOC1) domain is a highly conserved basic module of ~43 amino acids, which is found near the C terminus of plant proteins often involved in light signal transduction | Back alignment and domain information |
|---|
| >PRK11466 hybrid sensory histidine kinase TorS; Provisional | Back alignment and domain information |
|---|
| >PRK15347 two component system sensor kinase SsrA; Provisional | Back alignment and domain information |
|---|
| >PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional | Back alignment and domain information |
|---|
| >COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >PRK13837 two-component VirA-like sensor kinase; Provisional | Back alignment and domain information |
|---|
| >COG4566 TtrR Response regulator [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PLN03029 type-a response regulator protein; Provisional | Back alignment and domain information |
|---|
| >PRK13557 histidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10046 dpiA two-component response regulator DpiA; Provisional | Back alignment and domain information |
|---|
| >KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10816 DNA-binding transcriptional regulator PhoP; Provisional | Back alignment and domain information |
|---|
| >PRK11173 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09836 DNA-binding transcriptional activator CusR; Provisional | Back alignment and domain information |
|---|
| >PRK10529 DNA-binding transcriptional activator KdpE; Provisional | Back alignment and domain information |
|---|
| >PRK10643 DNA-binding transcriptional regulator BasR; Provisional | Back alignment and domain information |
|---|
| >PRK10161 transcriptional regulator PhoB; Provisional | Back alignment and domain information |
|---|
| >TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB | Back alignment and domain information |
|---|
| >PRK10766 DNA-binding transcriptional regulator TorR; Provisional | Back alignment and domain information |
|---|
| >COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09468 ompR osmolarity response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11083 DNA-binding response regulator CreB; Provisional | Back alignment and domain information |
|---|
| >PRK10336 DNA-binding transcriptional regulator QseB; Provisional | Back alignment and domain information |
|---|
| >PRK10701 DNA-binding transcriptional regulator RstA; Provisional | Back alignment and domain information |
|---|
| >PRK13856 two-component response regulator VirG; Provisional | Back alignment and domain information |
|---|
| >TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator | Back alignment and domain information |
|---|
| >PRK10430 DNA-binding transcriptional activator DcuR; Provisional | Back alignment and domain information |
|---|
| >PRK10955 DNA-binding transcriptional regulator CpxR; Provisional | Back alignment and domain information |
|---|
| >PRK11517 transcriptional regulatory protein YedW; Provisional | Back alignment and domain information |
|---|
| >CHL00148 orf27 Ycf27; Reviewed | Back alignment and domain information |
|---|
| >PRK10840 transcriptional regulator RcsB; Provisional | Back alignment and domain information |
|---|
| >PRK14084 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR02875 spore_0_A sporulation transcription factor Spo0A | Back alignment and domain information |
|---|
| >TIGR01387 cztR_silR_copR heavy metal response regulator | Back alignment and domain information |
|---|
| >COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] | Back alignment and domain information |
|---|
| >PRK09958 DNA-binding transcriptional activator EvgA; Provisional | Back alignment and domain information |
|---|
| >PRK09483 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >PRK13435 response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >PRK11697 putative two-component response-regulatory protein YehT; Provisional | Back alignment and domain information |
|---|
| >PRK09935 transcriptional regulator FimZ; Provisional | Back alignment and domain information |
|---|
| >PRK10610 chemotaxis regulatory protein CheY; Provisional | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PRK15479 transcriptional regulatory protein TctD; Provisional | Back alignment and domain information |
|---|
| >PRK10710 DNA-binding transcriptional regulator BaeR; Provisional | Back alignment and domain information |
|---|
| >PRK10360 DNA-binding transcriptional activator UhpA; Provisional | Back alignment and domain information |
|---|
| >PRK12555 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >PRK09581 pleD response regulator PleD; Reviewed | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >PRK00742 chemotaxis-specific methylesterase; Provisional | Back alignment and domain information |
|---|
| >PRK09390 fixJ response regulator FixJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15369 two component system sensor kinase SsrB; Provisional | Back alignment and domain information |
|---|
| >PRK10403 transcriptional regulator NarP; Provisional | Back alignment and domain information |
|---|
| >PRK13558 bacterio-opsin activator; Provisional | Back alignment and domain information |
|---|
| >PRK10651 transcriptional regulator NarL; Provisional | Back alignment and domain information |
|---|
| >PRK10100 DNA-binding transcriptional regulator CsgD; Provisional | Back alignment and domain information |
|---|
| >PRK09191 two-component response regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11475 DNA-binding transcriptional activator BglJ; Provisional | Back alignment and domain information |
|---|
| >PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional | Back alignment and domain information |
|---|
| >cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers | Back alignment and domain information |
|---|
| >COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15029 arginine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK10693 response regulator of RpoS; Provisional | Back alignment and domain information |
|---|
| >COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional | Back alignment and domain information |
|---|
| >PRK11107 hybrid sensory histidine kinase BarA; Provisional | Back alignment and domain information |
|---|
| >smart00448 REC cheY-homologous receiver domain | Back alignment and domain information |
|---|
| >COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e | Back alignment and domain information |
|---|
| >PRK02261 methylaspartate mutase subunit S; Provisional | Back alignment and domain information |
|---|
| >PF09425 CCT_2: Divergent CCT motif; InterPro: IPR018467 The short CCT (CO, COL, TOC1) motif is found in a number of plant proteins, including Constans (CO), Constans-like (COL) and TOC1 | Back alignment and domain information |
|---|
| >TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain | Back alignment and domain information |
|---|
| >cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain | Back alignment and domain information |
|---|
| >KOG1601 consensus GATA-4/5/6 transcription factors [Transcription] | Back alignment and domain information |
|---|
| >cd02067 B12-binding B12 binding domain (B12-BD) | Back alignment and domain information |
|---|
| >PF03709 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal domain; InterPro: IPR005308 This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure | Back alignment and domain information |
|---|
| >TIGR01501 MthylAspMutase methylaspartate mutase, S subunit | Back alignment and domain information |
|---|
| >cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins | Back alignment and domain information |
|---|
| >COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK15399 lysine decarboxylase LdcC; Provisional | Back alignment and domain information |
|---|
| >PRK15400 lysine decarboxylase CadA; Provisional | Back alignment and domain information |
|---|
| >COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) | Back alignment and domain information |
|---|
| >COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR02370 pyl_corrinoid methyltransferase cognate corrinoid proteins, Methanosarcina family | Back alignment and domain information |
|---|
| >PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) | Back alignment and domain information |
|---|
| >PRK09426 methylmalonyl-CoA mutase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein | Back alignment and domain information |
|---|
| >PRK03958 tRNA 2'-O-methylase; Reviewed | Back alignment and domain information |
|---|
| >cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 770 | ||||
| 3f7a_A | 394 | Structure Of Orthorhombic Crystal Form Of Pseudomon | 4e-07 | ||
| 3h1f_A | 129 | Crystal Structure Of Chey Mutant D53a Of Helicobact | 5e-07 | ||
| 3eq2_A | 394 | Structure Of Hexagonal Crystal Form Of Pseudomonas | 5e-07 | ||
| 3gl9_A | 122 | The Structure Of A Histidine Kinase-Response Regula | 6e-07 | ||
| 3gwg_A | 129 | Crystal Structure Of Chey Of Helicobacter Pylori Le | 6e-07 | ||
| 3h1g_A | 129 | Crystal Structure Of Chey Mutant T84a Of Helicobact | 6e-07 | ||
| 3dge_C | 122 | Structure Of A Histidine Kinase-response Regulator | 7e-07 | ||
| 3to5_A | 134 | High Resolution Structure Of Chey3 From Vibrio Chol | 1e-06 | ||
| 3t6k_A | 136 | Crystal Structure Of A Hypothetical Response Regula | 6e-06 | ||
| 3c97_A | 140 | Crystal Structure Of The Response Regulator Receive | 3e-05 | ||
| 3f7n_A | 128 | Crystal Structure Of Chey Triple Mutant F14e, N59m, | 3e-04 | ||
| 3jte_A | 143 | Crystal Structure Of Response Regulator Receiver Do | 5e-04 | ||
| 2oqr_A | 230 | The Structure Of The Response Regulator Regx3 From | 5e-04 | ||
| 2wb4_A | 459 | Activated Diguanylate Cyclase Pled In Complex With | 7e-04 | ||
| 1w25_A | 459 | Response Regulator Pled In Complex With C-digmp Len | 7e-04 |
| >pdb|3F7A|A Chain A, Structure Of Orthorhombic Crystal Form Of Pseudomonas Aeruginosa Rssb Length = 394 | Back alignment and structure |
|
| >pdb|3H1F|A Chain A, Crystal Structure Of Chey Mutant D53a Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|3EQ2|A Chain A, Structure Of Hexagonal Crystal Form Of Pseudomonas Aeruginosa Rssb Length = 394 | Back alignment and structure |
| >pdb|3GL9|A Chain A, The Structure Of A Histidine Kinase-Response Regulator Complex Sheds Light Into Two-Component Signaling And Reveals A Novel Cis Autophosphorylation Mechanism Length = 122 | Back alignment and structure |
| >pdb|3GWG|A Chain A, Crystal Structure Of Chey Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|3H1G|A Chain A, Crystal Structure Of Chey Mutant T84a Of Helicobacter Pylori Length = 129 | Back alignment and structure |
| >pdb|3DGE|C Chain C, Structure Of A Histidine Kinase-response Regulator Complex Reveals Insights Into Two-component Signaling And A Novel Cis- Autophosphorylation Mechanism Length = 122 | Back alignment and structure |
| >pdb|3TO5|A Chain A, High Resolution Structure Of Chey3 From Vibrio Cholerae Length = 134 | Back alignment and structure |
| >pdb|3T6K|A Chain A, Crystal Structure Of A Hypothetical Response Regulator (Caur_3799) From Chloroflexus Aurantiacus J-10-Fl At 1.86 A Resolution Length = 136 | Back alignment and structure |
| >pdb|3C97|A Chain A, Crystal Structure Of The Response Regulator Receiver Domain Of A Signal Transduction Histidine Kinase From Aspergillus Oryzae Length = 140 | Back alignment and structure |
| >pdb|3F7N|A Chain A, Crystal Structure Of Chey Triple Mutant F14e, N59m, E89l Complexed With Bef3- And Mn2+ Length = 128 | Back alignment and structure |
| >pdb|3JTE|A Chain A, Crystal Structure Of Response Regulator Receiver Domain Protein From Clostridium Thermocellum Length = 143 | Back alignment and structure |
| >pdb|2OQR|A Chain A, The Structure Of The Response Regulator Regx3 From Mycobacterium Tuberculosis Length = 230 | Back alignment and structure |
| >pdb|2WB4|A Chain A, Activated Diguanylate Cyclase Pled In Complex With C-Di-Gmp Length = 459 | Back alignment and structure |
| >pdb|1W25|A Chain A, Response Regulator Pled In Complex With C-digmp Length = 459 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 770 | |||
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 1e-24 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 1e-13 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 3e-22 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 7e-22 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 3e-21 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 4e-21 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 6e-21 | |
| 1p6q_A | 129 | CHEY2; chemotaxis, signal transduction, response r | 4e-20 | |
| 1dc7_A | 124 | NTRC, nitrogen regulation protein; receiver domain | 9e-20 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 1e-19 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 2e-19 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 3e-12 | |
| 3bre_A | 358 | Probable two-component response regulator; protein | 3e-19 | |
| 3eq2_A | 394 | Probable two-component response regulator; adaptor | 4e-19 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 6e-19 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 7e-19 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 7e-19 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 8e-19 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 9e-19 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 1e-18 | |
| 3hzh_A | 157 | Chemotaxis response regulator (CHEY-3); phosphatas | 3e-18 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 6e-18 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 8e-18 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 1e-17 | |
| 2qvg_A | 143 | Two component response regulator; NYSGXRC, PSI-2, | 2e-17 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 2e-17 | |
| 3m6m_D | 143 | Sensory/regulatory protein RPFC; RPFF, REC, enoyl- | 2e-17 | |
| 2j48_A | 119 | Two-component sensor kinase; pseudo-receiver, circ | 3e-17 | |
| 2rdm_A | 132 | Response regulator receiver protein; structural ge | 4e-17 | |
| 1mb3_A | 124 | Cell division response regulator DIVK; signal tran | 4e-17 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 8e-17 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 1e-16 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 2e-16 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 2e-16 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 2e-16 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 3e-16 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 6e-16 | |
| 3c3m_A | 138 | Response regulator receiver protein; structural ge | 6e-16 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 7e-16 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 8e-16 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 1e-15 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 1e-15 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 2e-15 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 2e-15 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 2e-15 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 2e-15 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 3e-15 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 5e-15 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 7e-15 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 7e-15 | |
| 3ilh_A | 146 | Two component response regulator; NYSGXRC, PSI-II, | 7e-15 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 1e-14 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 1e-14 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 1e-14 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 1e-14 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 2e-14 | |
| 1dcf_A | 136 | ETR1 protein; beta-alpha five sandwich, transferas | 3e-14 | |
| 2jk1_A | 139 | HUPR, hydrogenase transcriptional regulatory prote | 4e-14 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 7e-14 | |
| 2b4a_A | 138 | BH3024; flavodoxin-like fold, structural genomics, | 8e-14 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 1e-13 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 2e-13 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 2e-13 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 4e-13 | |
| 2jba_A | 127 | Phosphate regulon transcriptional regulatory PROT; | 6e-13 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 7e-13 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 8e-13 | |
| 2a9o_A | 120 | Response regulator; essential protein, YYCF/YYCG h | 9e-13 | |
| 1s8n_A | 205 | Putative antiterminator; RV1626, structural genomi | 1e-12 | |
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 1e-12 | |
| 2qzj_A | 136 | Two-component response regulator; 11017X, PSI-II, | 3e-12 | |
| 3f6p_A | 120 | Transcriptional regulatory protein YYCF; unphospho | 3e-12 | |
| 1zh2_A | 121 | KDP operon transcriptional regulatory protein KDPE | 4e-12 | |
| 1qo0_D | 196 | AMIR; binding protein, gene regulator, receptor; 2 | 5e-12 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 5e-12 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 6e-12 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 2e-11 | |
| 3n0r_A | 286 | Response regulator; sigma factor, receiver, two-co | 2e-11 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 2e-11 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 2e-11 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 3e-11 | |
| 3c97_A | 140 | Signal transduction histidine kinase; structural g | 3e-11 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 3e-11 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 6e-11 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 1e-10 | |
| 3t8y_A | 164 | CHEB, chemotaxis response regulator protein-glutam | 1e-10 | |
| 3kyj_B | 145 | CHEY6 protein, putative histidine protein kinase; | 1e-10 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 4e-10 | |
| 1a2o_A | 349 | CHEB methylesterase; bacterial chemotaxis, adaptat | 4e-10 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 7e-10 | |
| 3r0j_A | 250 | Possible two component system response transcript | 2e-09 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 5e-09 | |
| 1p2f_A | 220 | Response regulator; DRRB, OMPR/PHOB, transcription | 9e-09 | |
| 2hqr_A | 223 | Putative transcriptional regulator; phosporylation | 9e-09 | |
| 3mm4_A | 206 | Histidine kinase homolog; receiver domain, CKI1, c | 1e-07 | |
| 1dz3_A | 130 | Stage 0 sporulation protein A; response regulator, | 4e-07 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 4e-06 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 8e-06 | |
| 3sy8_A | 400 | ROCR; TIM barrel phosphodiesterase-A, transcriptio | 5e-05 |
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 | Back alignment and structure |
|---|
Score = 103 bits (258), Expect = 1e-24
Identities = 36/150 (24%), Positives = 64/150 (42%), Gaps = 13/150 (8%)
Query: 61 ASAVLQMPQEQPQGAMVCWERFLH-LRSLKVLLVENDDSTRHVVAALLRNCGYEVTEATN 119
+ V L+ + ++VL+V++ ++RH A LR +V EA++
Sbjct: 97 VLDYVMKDSRHSLQYAVGLVHRLYLNQQIEVLVVDDSRTSRHRTMAQLRKQLLQVHEASH 156
Query: 120 GLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSKIMSHKTRKNLPVIIF---------- 168
+A LE I LVL + MP + G++L+ + +++ L +I
Sbjct: 157 AREALATLEQ-HPAIRLVLVDYYMPEIDGISLVRMLRERYSKQQLAIIGISVSDKRGLSA 215
Query: 169 KCLSKGAVDFLVKPIRKNELKNLWQHVWRR 198
+ L +GA DFL +P EL+ H
Sbjct: 216 RYLKQGANDFLNQPFEPEELQCRVSHNLEA 245
|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Length = 358 | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Length = 394 | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Length = 128 | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Length = 387 | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} Length = 136 | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Length = 154 | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Length = 132 | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} Length = 140 | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Length = 143 | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Length = 147 | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Length = 140 | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} Length = 152 | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Length = 146 | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} Length = 144 | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} Length = 135 | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Length = 126 | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Length = 123 | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Length = 138 | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} Length = 136 | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Length = 135 | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Length = 132 | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Length = 120 | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Length = 136 | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Length = 122 | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Length = 286 | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Length = 238 | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} Length = 136 | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140 | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Length = 137 | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Length = 164 | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145 | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Length = 249 | Back alignment and structure |
|---|
| >1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Length = 349 | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Length = 250 | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Length = 225 | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Length = 220 | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Length = 223 | Back alignment and structure |
|---|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Length = 206 | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Length = 134 | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Length = 133 | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Length = 400 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 770 | |||
| 3to5_A | 134 | CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p | 99.88 | |
| 3mm4_A | 206 | Histidine kinase homolog; receiver domain, CKI1, c | 99.85 | |
| 2lpm_A | 123 | Two-component response regulator; transcription re | 99.82 | |
| 3t6k_A | 136 | Response regulator receiver; flavodoxin-like, stru | 99.79 | |
| 3gl9_A | 122 | Response regulator; beta-sheet, surrounded by alph | 99.79 | |
| 3h1g_A | 129 | Chemotaxis protein CHEY homolog; sulfate-bound CHE | 99.76 | |
| 3f6p_A | 120 | Transcriptional regulatory protein YYCF; unphospho | 99.75 | |
| 3i42_A | 127 | Response regulator receiver domain protein (CHEY- | 99.75 | |
| 3r0j_A | 250 | Possible two component system response transcript | 99.74 | |
| 3grc_A | 140 | Sensor protein, kinase; protein structure initiati | 99.74 | |
| 3kht_A | 144 | Response regulator; PSI-II, 11023K, structural gen | 99.74 | |
| 3gt7_A | 154 | Sensor protein; structural genomics, signal receiv | 99.74 | |
| 3hzh_A | 157 | Chemotaxis response regulator (CHEY-3); phosphatas | 99.74 | |
| 3n0r_A | 286 | Response regulator; sigma factor, receiver, two-co | 99.74 | |
| 3rqi_A | 184 | Response regulator protein; structural genomics, s | 99.74 | |
| 3crn_A | 132 | Response regulator receiver domain protein, CHEY-; | 99.74 | |
| 3m6m_D | 143 | Sensory/regulatory protein RPFC; RPFF, REC, enoyl- | 99.74 | |
| 2pl1_A | 121 | Transcriptional regulatory protein PHOP; CHEY-like | 99.73 | |
| 3c3m_A | 138 | Response regulator receiver protein; structural ge | 99.73 | |
| 3cg4_A | 142 | Response regulator receiver domain protein (CHEY-; | 99.73 | |
| 1dbw_A | 126 | Transcriptional regulatory protein FIXJ; doubly wo | 99.73 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 99.73 | |
| 3heb_A | 152 | Response regulator receiver domain protein (CHEY); | 99.73 | |
| 2r25_B | 133 | Osmosensing histidine protein kinase SLN1; alpha5- | 99.73 | |
| 3nhm_A | 133 | Response regulator; protein structure initiative I | 99.72 | |
| 1jbe_A | 128 | Chemotaxis protein CHEY; signaling protein; 1.08A | 99.72 | |
| 1xhf_A | 123 | DYE resistance, aerobic respiration control protei | 99.72 | |
| 3jte_A | 143 | Response regulator receiver protein; structural ge | 99.72 | |
| 1mb3_A | 124 | Cell division response regulator DIVK; signal tran | 99.72 | |
| 3h5i_A | 140 | Response regulator/sensory box protein/ggdef domai | 99.72 | |
| 1p6q_A | 129 | CHEY2; chemotaxis, signal transduction, response r | 99.72 | |
| 1srr_A | 124 | SPO0F, sporulation response regulatory protein; as | 99.71 | |
| 3hv2_A | 153 | Response regulator/HD domain protein; PSI-2, NYSGX | 99.71 | |
| 1zgz_A | 122 | Torcad operon transcriptional regulatory protein; | 99.71 | |
| 3b2n_A | 133 | Uncharacterized protein Q99UF4; structural genomic | 99.71 | |
| 3kto_A | 136 | Response regulator receiver protein; PSI-II,struct | 99.71 | |
| 2qzj_A | 136 | Two-component response regulator; 11017X, PSI-II, | 99.71 | |
| 2zay_A | 147 | Response regulator receiver protein; structural ge | 99.71 | |
| 3n53_A | 140 | Response regulator receiver modulated diguanylate; | 99.71 | |
| 4e7p_A | 150 | Response regulator; DNA binding, cytosol, transcri | 99.71 | |
| 1i3c_A | 149 | Response regulator RCP1; phytochrome, signaling pr | 99.7 | |
| 3eod_A | 130 | Protein HNR; response regulator, phosphoprotein, t | 99.7 | |
| 3cnb_A | 143 | DNA-binding response regulator, MERR family; signa | 99.7 | |
| 3hdg_A | 137 | Uncharacterized protein; two-component sensor acti | 99.7 | |
| 2a9o_A | 120 | Response regulator; essential protein, YYCF/YYCG h | 99.7 | |
| 3hdv_A | 136 | Response regulator; PSI-II, structural genomics, P | 99.7 | |
| 3lte_A | 132 | Response regulator; structural genomics, PSI, prot | 99.7 | |
| 2jba_A | 127 | Phosphate regulon transcriptional regulatory PROT; | 99.7 | |
| 3cfy_A | 137 | Putative LUXO repressor protein; structural genomi | 99.7 | |
| 3lua_A | 140 | Response regulator receiver protein; two-component | 99.7 | |
| 1tmy_A | 120 | CHEY protein, TMY; chemotaxis, phosphoryl transfer | 99.7 | |
| 3f6c_A | 134 | Positive transcription regulator EVGA; structural | 99.7 | |
| 1mvo_A | 136 | PHOP response regulator; phosphate regulon, transc | 99.69 | |
| 1k68_A | 140 | Phytochrome response regulator RCPA; phosphorylate | 99.69 | |
| 3a10_A | 116 | Response regulator; phosphoacceptor, signaling pro | 99.69 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 99.69 | |
| 1k66_A | 149 | Phytochrome response regulator RCPB; CHEY homologu | 99.68 | |
| 2qr3_A | 140 | Two-component system response regulator; structura | 99.68 | |
| 1zh2_A | 121 | KDP operon transcriptional regulatory protein KDPE | 99.68 | |
| 3snk_A | 135 | Response regulator CHEY-like protein; P-loop conta | 99.68 | |
| 3cg0_A | 140 | Response regulator receiver modulated diguanylate | 99.68 | |
| 3ilh_A | 146 | Two component response regulator; NYSGXRC, PSI-II, | 99.68 | |
| 2rjn_A | 154 | Response regulator receiver:metal-dependent phosph | 99.67 | |
| 4dad_A | 146 | Putative pilus assembly-related protein; response | 99.67 | |
| 1yio_A | 208 | Response regulatory protein; transcription regulat | 99.67 | |
| 1dz3_A | 130 | Stage 0 sporulation protein A; response regulator, | 99.67 | |
| 2gkg_A | 127 | Response regulator homolog; social motility, recei | 99.67 | |
| 1dcf_A | 136 | ETR1 protein; beta-alpha five sandwich, transferas | 99.66 | |
| 3kcn_A | 151 | Adenylate cyclase homolog; SGX, PSI 2, structural | 99.66 | |
| 3cu5_A | 141 | Two component transcriptional regulator, ARAC FAM; | 99.66 | |
| 1kgs_A | 225 | DRRD, DNA binding response regulator D; DNA-bindin | 99.65 | |
| 1ys7_A | 233 | Transcriptional regulatory protein PRRA; response | 99.65 | |
| 3q9s_A | 249 | DNA-binding response regulator; DNA binding protei | 99.65 | |
| 3eul_A | 152 | Possible nitrate/nitrite response transcriptional | 99.65 | |
| 3c97_A | 140 | Signal transduction histidine kinase; structural g | 99.65 | |
| 3cz5_A | 153 | Two-component response regulator, LUXR family; str | 99.65 | |
| 2qv0_A | 143 | Protein MRKE; structural genomics, transcription, | 99.64 | |
| 1qkk_A | 155 | DCTD, C4-dicarboxylate transport transcriptional r | 99.64 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 99.64 | |
| 2qxy_A | 142 | Response regulator; regulation of transcription, N | 99.64 | |
| 3eq2_A | 394 | Probable two-component response regulator; adaptor | 99.64 | |
| 1s8n_A | 205 | Putative antiterminator; RV1626, structural genomi | 99.64 | |
| 1a04_A | 215 | Nitrate/nitrite response regulator protein NARL; s | 99.64 | |
| 2rdm_A | 132 | Response regulator receiver protein; structural ge | 99.63 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 99.63 | |
| 2jk1_A | 139 | HUPR, hydrogenase transcriptional regulatory prote | 99.63 | |
| 1dc7_A | 124 | NTRC, nitrogen regulation protein; receiver domain | 99.61 | |
| 2qsj_A | 154 | DNA-binding response regulator, LUXR family; struc | 99.61 | |
| 3kyj_B | 145 | CHEY6 protein, putative histidine protein kinase; | 99.61 | |
| 3eqz_A | 135 | Response regulator; structural genomics, unknown f | 99.61 | |
| 2qvg_A | 143 | Two component response regulator; NYSGXRC, PSI-2, | 99.61 | |
| 2oqr_A | 230 | Sensory transduction protein REGX3; response regul | 99.6 | |
| 2j48_A | 119 | Two-component sensor kinase; pseudo-receiver, circ | 99.6 | |
| 2gwr_A | 238 | DNA-binding response regulator MTRA; two-component | 99.6 | |
| 2pln_A | 137 | HP1043, response regulator; signaling protein; 1.8 | 99.6 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 99.59 | |
| 3t8y_A | 164 | CHEB, chemotaxis response regulator protein-glutam | 99.58 | |
| 3c3w_A | 225 | Two component transcriptional regulatory protein; | 99.58 | |
| 3bre_A | 358 | Probable two-component response regulator; protein | 99.58 | |
| 3sy8_A | 400 | ROCR; TIM barrel phosphodiesterase-A, transcriptio | 99.57 | |
| 3klo_A | 225 | Transcriptional regulator VPST; REC domain, HTH do | 99.55 | |
| 1p2f_A | 220 | Response regulator; DRRB, OMPR/PHOB, transcription | 99.55 | |
| 1qo0_D | 196 | AMIR; binding protein, gene regulator, receptor; 2 | 99.51 | |
| 2b4a_A | 138 | BH3024; flavodoxin-like fold, structural genomics, | 99.51 | |
| 2hqr_A | 223 | Putative transcriptional regulator; phosporylation | 99.48 | |
| 1a2o_A | 349 | CHEB methylesterase; bacterial chemotaxis, adaptat | 99.46 | |
| 2vyc_A | 755 | Biodegradative arginine decarboxylase; pyridoxal p | 99.42 | |
| 3luf_A | 259 | Two-component system response regulator/ggdef doma | 99.34 | |
| 1w25_A | 459 | Stalked-cell differentiation controlling protein; | 98.69 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 98.65 | |
| 2ayx_A | 254 | Sensor kinase protein RCSC; two independent struct | 96.91 | |
| 3n75_A | 715 | LDC, lysine decarboxylase, inducible; pyridoxal-5' | 96.21 | |
| 3q7r_A | 121 | Transcriptional regulatory protein; CHXR, receiver | 96.03 | |
| 2yxb_A | 161 | Coenzyme B12-dependent mutase; alpha/beta, structu | 95.57 | |
| 1mu5_A | 471 | Type II DNA topoisomerase VI subunit B; GHKL ATPas | 93.11 | |
| 3ogl_Q | 21 | JAZ1 incomplete degron peptide; leucine-rich repea | 92.79 | |
| 1ccw_A | 137 | Protein (glutamate mutase); coenzyme B12, radical | 92.7 | |
| 3kp1_A | 763 | D-ornithine aminomutase E component; 5 aminomutase | 90.81 | |
| 3ogk_Q | 22 | JAZ1 incomplete degron peptide; leucine rich repea | 89.36 | |
| 1xrs_B | 262 | D-lysine 5,6-aminomutase beta subunit; TIM barrel, | 87.35 | |
| 1y80_A | 210 | Predicted cobalamin binding protein; corrinoid, fa | 86.68 | |
| 3ezx_A | 215 | MMCP 1, monomethylamine corrinoid protein 1; N ter | 86.52 | |
| 3cwo_X | 237 | Beta/alpha-barrel protein based on 1THF and 1TMY; | 84.44 | |
| 2i2x_B | 258 | MTAC, methyltransferase 1; TIM barrel and helix bu | 84.35 | |
| 3jz3_A | 222 | Sensor protein QSEC; helix-turn-helix, kinase doma | 83.9 | |
| 2xij_A | 762 | Methylmalonyl-COA mutase, mitochondrial; isomerase | 83.14 | |
| 1req_A | 727 | Methylmalonyl-COA mutase; isomerase, intramolecula | 80.5 |
| >3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} | Back alignment and structure |
|---|
Probab=99.88 E-value=5.7e-23 Score=194.99 Aligned_cols=111 Identities=32% Similarity=0.635 Sum_probs=102.5
Q ss_pred CCcEEEEEecChhhHHHHHHHHHhCCCE-EEEECCHHHHHHHHHhcCCCceEEEEcc-CCCCCHHHHHHHHHhhcCCCCc
Q 004184 86 RSLKVLLVENDDSTRHVVAALLRNCGYE-VTEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSKIMSHKTRKNL 163 (770)
Q Consensus 86 ~~lrVLIVDDd~~~r~~L~~lLe~~G~e-V~~A~dg~EALe~L~~~~~~pDLVLlDi-MPgmdGleLlr~IR~~~~~~~I 163 (770)
+.+|||||||++.+|..++.+|+.+||. |.+|.+|.+|+++++. ..|||||+|+ ||+|||++++++||+....+.+
T Consensus 11 k~~rILiVDD~~~~r~~l~~~L~~~G~~~v~~a~~g~~al~~~~~--~~~DlillD~~MP~mdG~el~~~ir~~~~~~~i 88 (134)
T 3to5_A 11 KNMKILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKK--GDFDFVVTDWNMPGMQGIDLLKNIRADEELKHL 88 (134)
T ss_dssp TTCCEEEECSCHHHHHHHHHHHHHTTCCCEEEESSHHHHHHHHHH--HCCSEEEEESCCSSSCHHHHHHHHHHSTTTTTC
T ss_pred CCCEEEEEeCCHHHHHHHHHHHHHcCCcEEEEECCHHHHHHHHHh--CCCCEEEEcCCCCCCCHHHHHHHHHhCCCCCCC
Confidence 4579999999999999999999999996 6689999999999998 7899999999 9999999999999987777889
Q ss_pred chhhh----------hhHhcCCCcEEeCCCCHHHHHHHHHHHHHH
Q 004184 164 PVIIF----------KCLSKGAVDFLVKPIRKNELKNLWQHVWRR 198 (770)
Q Consensus 164 PIIvl----------~al~aGAddyL~KP~~~eeL~~~L~~vlrr 198 (770)
|||++ +++++||++||.|||++++|..+|.++++|
T Consensus 89 pvI~lTa~~~~~~~~~~~~~Ga~~yl~KP~~~~~L~~~i~~~l~R 133 (134)
T 3to5_A 89 PVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLKEKLDKIFER 133 (134)
T ss_dssp CEEEEESSCCHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHCC-
T ss_pred eEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHhc
Confidence 99965 679999999999999999999999998865
|
| >3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A | Back alignment and structure |
|---|
| >2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C | Back alignment and structure |
|---|
| >3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A | Back alignment and structure |
|---|
| >3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A | Back alignment and structure |
|---|
| >3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} | Back alignment and structure |
|---|
| >3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} | Back alignment and structure |
|---|
| >3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} | Back alignment and structure |
|---|
| >3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A | Back alignment and structure |
|---|
| >3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A | Back alignment and structure |
|---|
| >3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} | Back alignment and structure |
|---|
| >3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} | Back alignment and structure |
|---|
| >1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B | Back alignment and structure |
|---|
| >3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... | Back alignment and structure |
|---|
| >1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A | Back alignment and structure |
|---|
| >3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A | Back alignment and structure |
|---|
| >3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} | Back alignment and structure |
|---|
| >1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A | Back alignment and structure |
|---|
| >1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E | Back alignment and structure |
|---|
| >3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} | Back alignment and structure |
|---|
| >2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} | Back alignment and structure |
|---|
| >3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A | Back alignment and structure |
|---|
| >1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A | Back alignment and structure |
|---|
| >3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} | Back alignment and structure |
|---|
| >3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* | Back alignment and structure |
|---|
| >3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} | Back alignment and structure |
|---|
| >2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A | Back alignment and structure |
|---|
| >3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y | Back alignment and structure |
|---|
| >3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A | Back alignment and structure |
|---|
| >1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A | Back alignment and structure |
|---|
| >3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} | Back alignment and structure |
|---|
| >4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A | Back alignment and structure |
|---|
| >1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A | Back alignment and structure |
|---|
| >1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* | Back alignment and structure |
|---|
| >2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A | Back alignment and structure |
|---|
| >1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 | Back alignment and structure |
|---|
| >3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} | Back alignment and structure |
|---|
| >3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} | Back alignment and structure |
|---|
| >1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* | Back alignment and structure |
|---|
| >1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A | Back alignment and structure |
|---|
| >3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} | Back alignment and structure |
|---|
| >3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} | Back alignment and structure |
|---|
| >2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A | Back alignment and structure |
|---|
| >1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A | Back alignment and structure |
|---|
| >1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A | Back alignment and structure |
|---|
| >2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B | Back alignment and structure |
|---|
| >1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* | Back alignment and structure |
|---|
| >2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* | Back alignment and structure |
|---|
| >3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 | Back alignment and structure |
|---|
| >2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} | Back alignment and structure |
|---|
| >2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} | Back alignment and structure |
|---|
| >2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A | Back alignment and structure |
|---|
| >2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* | Back alignment and structure |
|---|
| >3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* | Back alignment and structure |
|---|
| >1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* | Back alignment and structure |
|---|
| >1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 | Back alignment and structure |
|---|
| >2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 | Back alignment and structure |
|---|
| >2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 | Back alignment and structure |
|---|
| >2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} | Back alignment and structure |
|---|
| >3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* | Back alignment and structure |
|---|
| >1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A | Back alignment and structure |
|---|
| >3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* | Back alignment and structure |
|---|
| >3q7r_A Transcriptional regulatory protein; CHXR, receiver domain, transcription factor, OMPR, chlamydia transcription; 1.60A {Chlamydia trachomatis} PDB: 3q7s_A* 3q7t_A | Back alignment and structure |
|---|
| >2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* | Back alignment and structure |
|---|
| >1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* | Back alignment and structure |
|---|
| >3kp1_A D-ornithine aminomutase E component; 5 aminomutase (OAM), metal binding protein; HET: PLP B12 5AD; 2.01A {Clostridium sticklandii} PDB: 3kow_A* 3koy_A* 3koz_A* 3kp0_A* 3kox_A* | Back alignment and structure |
|---|
| >3ogk_Q JAZ1 incomplete degron peptide; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1xrs_B D-lysine 5,6-aminomutase beta subunit; TIM barrel, rossmann domain, PLP, cobalamin, 5'-deoxyad radical, adenosylcobalamin; HET: B12 PLP 5AD; 2.80A {Clostridium sticklandii} SCOP: c.23.6.1 d.230.4.1 | Back alignment and structure |
|---|
| >1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica} | Back alignment and structure |
|---|
| >3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A | Back alignment and structure |
|---|
| >2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix B (MTAC); HET: B13; 2.50A {Methanosarcina barkeri} | Back alignment and structure |
|---|
| >3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2xij_A Methylmalonyl-COA mutase, mitochondrial; isomerase, organic aciduria, vitamin B12; HET: B12 5AD BTB; 1.95A {Homo sapiens} PDB: 2xiq_A* 3bic_A | Back alignment and structure |
|---|
| >1req_A Methylmalonyl-COA mutase; isomerase, intramolecular transferase; HET: B12 DCA; 2.00A {Propionibacterium freudenreichii subspshermanii} SCOP: c.1.19.1 c.23.6.1 PDB: 2req_A* 3req_A* 4req_A* 6req_A* 7req_A* 5req_A* 1e1c_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 770 | ||||
| d1zesa1 | 121 | c.23.1.1 (A:3-123) PhoB receiver domain {Escherich | 2e-20 | |
| d1jbea_ | 128 | c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI | 2e-20 | |
| d1dz3a_ | 123 | c.23.1.1 (A:) Sporulation response regulator Spo0A | 4e-20 | |
| d1k68a_ | 140 | c.23.1.1 (A:) Response regulator for cyanobacteria | 2e-19 | |
| d1zgza1 | 120 | c.23.1.1 (A:2-121) TorCAD operon transcriptional r | 1e-18 | |
| d1mb3a_ | 123 | c.23.1.1 (A:) Cell division response regulator Div | 1e-18 | |
| d1peya_ | 119 | c.23.1.1 (A:) Sporulation response regulator Spo0F | 3e-18 | |
| d1dcfa_ | 134 | c.23.1.2 (A:) Receiver domain of the ethylene rece | 3e-18 | |
| d1a2oa1 | 140 | c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal | 4e-18 | |
| d2a9pa1 | 117 | c.23.1.1 (A:2-118) DNA-binding response regulator | 7e-18 | |
| d1krwa_ | 123 | c.23.1.1 (A:) NTRC receiver domain {Salmonella typ | 7e-18 | |
| d1p6qa_ | 129 | c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti | 1e-17 | |
| d1u0sy_ | 118 | c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T | 2e-17 | |
| d1xhfa1 | 121 | c.23.1.1 (A:2-122) Aerobic respiration control pro | 3e-17 | |
| d2r25b1 | 128 | c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba | 6e-17 | |
| d2b4aa1 | 118 | c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Ba | 8e-17 | |
| d1a04a2 | 138 | c.23.1.1 (A:5-142) Nitrate/nitrite response regula | 8e-17 | |
| d2pl1a1 | 119 | c.23.1.1 (A:1-119) PhoP receiver domain {Escherich | 2e-16 | |
| d1dbwa_ | 123 | c.23.1.1 (A:) Transcriptional regulatory protein F | 3e-16 | |
| d1i3ca_ | 144 | c.23.1.1 (A:) Response regulator for cyanobacteria | 4e-16 | |
| d1mvoa_ | 121 | c.23.1.1 (A:) PhoP receiver domain {Bacillus subti | 1e-15 | |
| d1ys7a2 | 121 | c.23.1.1 (A:7-127) Transcriptional regulatory prot | 1e-15 | |
| d1s8na_ | 190 | c.23.1.1 (A:) Probable two-component system transc | 2e-15 | |
| d2ayxa1 | 133 | c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C | 3e-15 | |
| d1qkka_ | 140 | c.23.1.1 (A:) Transcriptional regulatory protein D | 4e-15 | |
| d1ny5a1 | 137 | c.23.1.1 (A:1-137) Transcriptional activator sigm5 | 1e-14 | |
| d1p2fa2 | 120 | c.23.1.1 (A:1-120) Response regulator DrrB {Thermo | 3e-14 | |
| d1zh2a1 | 119 | c.23.1.1 (A:2-120) Transcriptional regulatory prot | 3e-14 | |
| d1w25a1 | 139 | c.23.1.1 (A:2-140) Response regulator PleD, receiv | 5e-14 | |
| d1k66a_ | 149 | c.23.1.1 (A:) Response regulator for cyanobacteria | 9e-14 | |
| d1kgsa2 | 122 | c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog | 3e-13 | |
| d1yioa2 | 128 | c.23.1.1 (A:3-130) Response regulatory protein Sty | 5e-13 | |
| d1qo0d_ | 189 | c.23.1.3 (D:) Positive regulator of the amidase op | 8e-13 | |
| d1w25a2 | 153 | c.23.1.1 (A:141-293) Response regulator PleD, rece | 1e-12 |
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: CheY-like family: CheY-related domain: PhoB receiver domain species: Escherichia coli [TaxId: 562]
Score = 85.4 bits (211), Expect = 2e-20
Identities = 30/121 (24%), Positives = 56/121 (46%), Gaps = 13/121 (10%)
Query: 89 KVLLVENDDSTRHVVAALLRNCGYEVTEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSG 147
++L+VE++ R +V +L G++ EA + A L + DL+L + +P SG
Sbjct: 2 RILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE--PWPDLILLDWMLPGGSG 59
Query: 148 VALLSKIMSHKTRKNLPVIIF----------KCLSKGAVDFLVKPIRKNELKNLWQHVWR 197
+ + + +++PV++ + L GA D++ KP EL + V R
Sbjct: 60 IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 119
Query: 198 R 198
R
Sbjct: 120 R 120
|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 140 | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Length = 118 | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 | Back information, alignment and structure |
|---|
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 | Back information, alignment and structure |
|---|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Length = 189 | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 770 | |||
| d2pl1a1 | 119 | PhoP receiver domain {Escherichia coli [TaxId: 562 | 99.88 | |
| d1ys7a2 | 121 | Transcriptional regulatory protein PrrA, N-termina | 99.87 | |
| d1kgsa2 | 122 | PhoB receiver domain {Thermotoga maritima [TaxId: | 99.87 | |
| d1zesa1 | 121 | PhoB receiver domain {Escherichia coli [TaxId: 562 | 99.87 | |
| d1mb3a_ | 123 | Cell division response regulator DivK {Caulobacter | 99.86 | |
| d1dbwa_ | 123 | Transcriptional regulatory protein FixJ, receiver | 99.86 | |
| d1krwa_ | 123 | NTRC receiver domain {Salmonella typhimurium [TaxI | 99.86 | |
| d1mvoa_ | 121 | PhoP receiver domain {Bacillus subtilis [TaxId: 14 | 99.86 | |
| d2a9pa1 | 117 | DNA-binding response regulator MicA, N-terminal do | 99.86 | |
| d1zh2a1 | 119 | Transcriptional regulatory protein KdpE, N-termina | 99.86 | |
| d1peya_ | 119 | Sporulation response regulator Spo0F {Bacillus sub | 99.85 | |
| d2ayxa1 | 133 | Sensor kinase protein RcsC, C-terminal domain {Esc | 99.85 | |
| d1xhfa1 | 121 | Aerobic respiration control protein ArcA, N-termin | 99.85 | |
| d1w25a1 | 139 | Response regulator PleD, receiver domain {Caulobac | 99.85 | |
| d1jbea_ | 128 | CheY protein {Escherichia coli [TaxId: 562]} | 99.85 | |
| d1p6qa_ | 129 | CheY protein {Sinorhizobium meliloti, CheY2 [TaxId | 99.85 | |
| d1ny5a1 | 137 | Transcriptional activator sigm54 (NtrC1), N-termin | 99.85 | |
| d1zgza1 | 120 | TorCAD operon transcriptional regulator TorD, N-te | 99.84 | |
| d1qkka_ | 140 | Transcriptional regulatory protein DctD, receiver | 99.84 | |
| d2r25b1 | 128 | Response regulator Sin1 {Baker's yeast (Saccharomy | 99.84 | |
| d1u0sy_ | 118 | CheY protein {Thermotoga maritima [TaxId: 2336]} | 99.84 | |
| d1i3ca_ | 144 | Response regulator for cyanobacterial phytochrome | 99.83 | |
| d1s8na_ | 190 | Probable two-component system transcriptional regu | 99.83 | |
| d1yioa2 | 128 | Response regulatory protein StyR, N-terminal domai | 99.83 | |
| d1k68a_ | 140 | Response regulator for cyanobacterial phytochrome | 99.83 | |
| d1p2fa2 | 120 | Response regulator DrrB {Thermotoga maritima [TaxI | 99.82 | |
| d1k66a_ | 149 | Response regulator for cyanobacterial phytochrome | 99.82 | |
| d1dcfa_ | 134 | Receiver domain of the ethylene receptor {Thale cr | 99.82 | |
| d1dz3a_ | 123 | Sporulation response regulator Spo0A {Bacillus ste | 99.82 | |
| d1w25a2 | 153 | Response regulator PleD, receiver domain {Caulobac | 99.81 | |
| d1a04a2 | 138 | Nitrate/nitrite response regulator (NarL), receive | 99.81 | |
| d2b4aa1 | 118 | Hypothetical protein BH3024 {Bacillus halodurans [ | 99.79 | |
| d1a2oa1 | 140 | Methylesterase CheB, N-terminal domain {Salmonella | 99.78 | |
| d1qo0d_ | 189 | Positive regulator of the amidase operon AmiR {Pse | 99.66 | |
| d1ccwa_ | 137 | Glutamate mutase, small subunit {Clostridium cochl | 94.98 | |
| d1xrsb1 | 160 | D-lysine 5,6-aminomutase beta subunit KamE, C-term | 92.76 | |
| d7reqa2 | 168 | Methylmalonyl-CoA mutase alpha subunit, C-terminal | 92.05 | |
| d1ysra1 | 148 | Sensor-type histidine kinase PrrB {Mycobacterium t | 89.63 | |
| d1jm6a2 | 190 | Pyruvate dehydrogenase kinase {Rat (Rattus norvegi | 89.24 | |
| d2c2aa2 | 161 | Sensor histidine kinase TM0853 {Thermotoga maritim | 89.01 | |
| d1i58a_ | 189 | Histidine kinase CheA {Thermotoga maritima [TaxId: | 88.41 | |
| d1kzyc2 | 106 | 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | 85.87 | |
| d1gkza2 | 193 | Branched-chain alpha-ketoacid dehydrogenase kinase | 85.76 | |
| d1bxda_ | 161 | Histidine kinase domain of the osmosensor EnvZ {Es | 84.8 | |
| d1r8ja2 | 135 | N-terminal domain of the circadian clock protein K | 81.91 |
| >d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Flavodoxin-like superfamily: CheY-like family: CheY-related domain: PhoP receiver domain species: Escherichia coli [TaxId: 562]
Probab=99.88 E-value=9.2e-23 Score=186.99 Aligned_cols=107 Identities=27% Similarity=0.507 Sum_probs=101.3
Q ss_pred cEEEEEecChhhHHHHHHHHHhCCCEEEEECCHHHHHHHHHhcCCCceEEEEcc-CCCCCHHHHHHHHHhhcCCCCcchh
Q 004184 88 LKVLLVENDDSTRHVVAALLRNCGYEVTEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSKIMSHKTRKNLPVI 166 (770)
Q Consensus 88 lrVLIVDDd~~~r~~L~~lLe~~G~eV~~A~dg~EALe~L~~~~~~pDLVLlDi-MPgmdGleLlr~IR~~~~~~~IPII 166 (770)
||||||||++.++..++.+|+.+||+|.+|.++++|++++++ ..|||||+|+ ||+++|++++++||+.. +.+|||
T Consensus 1 mrILvVDDd~~~~~~l~~~L~~~G~~v~~a~~g~eal~~l~~--~~~dliilD~~mP~~~G~e~~~~i~~~~--~~~pvi 76 (119)
T d2pl1a1 1 MRVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNE--HIPDIAIVDLGLPDEDGLSLIRRWRSND--VSLPIL 76 (119)
T ss_dssp CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHH--SCCSEEEECSCCSSSCHHHHHHHHHHTT--CCSCEE
T ss_pred CEEEEEeCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHh--cccceeehhccCCCchhHHHHHHHHhcC--cccceE
Confidence 589999999999999999999999999999999999999998 8899999999 99999999999999865 678888
Q ss_pred hh----------hhHhcCCCcEEeCCCCHHHHHHHHHHHHHH
Q 004184 167 IF----------KCLSKGAVDFLVKPIRKNELKNLWQHVWRR 198 (770)
Q Consensus 167 vl----------~al~aGAddyL~KP~~~eeL~~~L~~vlrr 198 (770)
++ +++++||++||.|||+.++|..+|+++++|
T Consensus 77 ~lt~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~v~~~lrR 118 (119)
T d2pl1a1 77 VLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRR 118 (119)
T ss_dssp EEESCCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHH
T ss_pred eeeccCCHHHHHHHHHcCCCEEEECCCCHHHHHHHHHHHHcc
Confidence 55 789999999999999999999999999986
|
| >d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} | Back information, alignment and structure |
|---|
| >d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} | Back information, alignment and structure |
|---|
| >d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} | Back information, alignment and structure |
|---|
| >d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} | Back information, alignment and structure |
|---|
| >d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]} | Back information, alignment and structure |
|---|
| >d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kzyc2 c.15.1.4 (C:1867-1972) 53BP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r8ja2 c.23.1.5 (A:1-135) N-terminal domain of the circadian clock protein KaiA {Synechococcus elongatus [TaxId: 32046]} | Back information, alignment and structure |
|---|