Citrus Sinensis ID: 004295
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 763 | 2.2.26 [Sep-21-2011] | |||||||
| Q9FNI6 | 1029 | Putative SWI/SNF-related | yes | no | 0.653 | 0.484 | 0.574 | 1e-163 | |
| Q9FIY7 | 1277 | Putative SWI/SNF-related | no | no | 0.352 | 0.210 | 0.638 | 1e-105 | |
| Q4IJ84 | 1154 | DNA repair protein RAD5 O | yes | no | 0.364 | 0.240 | 0.302 | 9e-35 | |
| Q4WVM1 | 1245 | DNA repair protein rad5 O | yes | no | 0.368 | 0.225 | 0.288 | 2e-33 | |
| Q14527 | 1009 | Helicase-like transcripti | yes | no | 0.326 | 0.246 | 0.322 | 3e-32 | |
| P0CQ67 | 1198 | DNA repair protein RAD5 O | N/A | no | 0.360 | 0.229 | 0.295 | 8e-32 | |
| P0CQ66 | 1198 | DNA repair protein RAD5 O | yes | no | 0.360 | 0.229 | 0.295 | 1e-31 | |
| Q5BHD6 | 1202 | DNA repair protein rad5 O | yes | no | 0.369 | 0.234 | 0.289 | 5e-31 | |
| Q6PCN7 | 1003 | Helicase-like transcripti | yes | no | 0.328 | 0.250 | 0.314 | 1e-29 | |
| Q9FF61 | 881 | Putative SWI/SNF-related | no | no | 0.330 | 0.286 | 0.295 | 2e-29 |
| >sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 575 bits (1482), Expect = e-163, Method: Compositional matrix adjust.
Identities = 298/519 (57%), Positives = 361/519 (69%), Gaps = 20/519 (3%)
Query: 1 MGTKVTDEVLSTVRSVVGPEFSNMDIIRALHMANHDPAAAINIIFDTPNFKTPEI----- 55
MGTKV+D+++STVRSVVG ++S+MDIIRALHMANHDP AAINIIFDTP+F P++
Sbjct: 1 MGTKVSDDLVSTVRSVVGSDYSDMDIIRALHMANHDPTAAINIIFDTPSFAKPDVATPTP 60
Query: 56 -------KPLAARRKLIISKENEIRASSENGTLAEAIAEGYSE---GSEWWFVGWGDVPA 105
+ + + + A+ E++ G E G+EWWFVG ++
Sbjct: 61 SGSNGGKRVDSGLKGCTFGDSGSVGANHRVEEENESVNGGGEESVSGNEWWFVGCSELAG 120
Query: 106 MSTSKGRKLRRGDEVTFTFPLKSFNSLSSKFPSKSFVRARQAVVPCSEIVRFSTKDAGEI 165
+ST KGRKL+ GDE+ FTFP + + F R R A+ S+IVRFSTKD+GEI
Sbjct: 121 LSTCKGRKLKSGDELVFTFPHSKGLKPETTPGKRGFGRGRPALRGASDIVRFSTKDSGEI 180
Query: 166 GRIPHEWSRCLLPLVRDKKVEILGCCKSAPEVLGIMDTIVLSIRVYINSSMFRKHHATSL 225
GRIP+EW+RCLLPLVRDKK+ I G CKSAPE L IMDTI+LS+ VYINSSMF+KH ATS
Sbjct: 181 GRIPNEWARCLLPLVRDKKIRIEGSCKSAPEALSIMDTILLSVSVYINSSMFQKHSATSF 240
Query: 226 KAGSNSAEDSVSLCHPLPNLFRLLGITPFKKAEFTPSDLYTRKRPLDSKDGCGLHASLLH 285
K SN+AE+S + HPLPNLFRLLG+ PFKKAEFTP D Y++KRPL SKDG + SLL
Sbjct: 241 KTASNTAEES--MFHPLPNLFRLLGLIPFKKAEFTPEDFYSKKRPLSSKDGSAIPTSLLQ 298
Query: 286 ANKSKVQSAKVNDVDDVEPISDSDVDNIVGVGYSSEIEEMEPPSTLKCELRPYQKQALHW 345
NK K + N ++ + ISD D+DNIVGVG SS ++EME P TL CELRPYQKQALHW
Sbjct: 299 LNKVKNMNQDANGDENEQCISDGDLDNIVGVGDSSGLKEMETPHTLLCELRPYQKQALHW 358
Query: 346 MVQLEKGRCLDEAATTLHPCWEAYRLLDERELVVYLNAFSGEATIEFPSTLQMARGGILA 405
M QLEKG C DEAAT LHPCWEAY L D+RELVVYLN+F+G+ATI FPSTLQMARGGILA
Sbjct: 359 MTQLEKGNCTDEAATMLHPCWEAYCLADKRELVVYLNSFTGDATIHFPSTLQMARGGILA 418
Query: 406 DAMGLGKTVMTIALLLTHSQRGGLSGIQSASQPSDGGIEGYDISDQSPNLMKKEPKSLSI 465
DAMGLGKTVMTI+LLL HS + +G + D I SP + K K L
Sbjct: 419 DAMGLGKTVMTISLLLAHSWKAASTGFLCPNYEGDKVISSSVDDLTSPPV--KATKFLGF 476
Query: 466 DK-LIKQTNTLINGGTLIICPMTLLGQWNKLIQKPYEEG 503
DK L++Q + L NGG LI+CPMTLLGQW I+ + G
Sbjct: 477 DKRLLEQKSVLQNGGNLIVCPMTLLGQWKTEIEMHAKPG 515
|
Possesses intrinsic ATP-dependent nucleosome-remodeling activity. This activity may be required for DNA repair. Arabidopsis thaliana (taxid: 3702) EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: - |
| >sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 763 | ||||||
| 255573018 | 1028 | DNA repair helicase rad5,16, putative [R | 0.653 | 0.485 | 0.623 | 0.0 | |
| 297734859 | 1025 | unnamed protein product [Vitis vinifera] | 0.650 | 0.483 | 0.617 | 1e-169 | |
| 225436359 | 1016 | PREDICTED: putative SWI/SNF-related matr | 0.651 | 0.489 | 0.622 | 1e-169 | |
| 359479470 | 1029 | PREDICTED: putative SWI/SNF-related matr | 0.650 | 0.482 | 0.613 | 1e-168 | |
| 45935136 | 1040 | putative DNA repair protein [Ipomoea tri | 0.642 | 0.471 | 0.582 | 1e-162 | |
| 15242960 | 1029 | DNA/RNA helicase protein RAD5 [Arabidops | 0.653 | 0.484 | 0.574 | 1e-161 | |
| 297812401 | 1029 | hypothetical protein ARALYDRAFT_489124 [ | 0.653 | 0.484 | 0.568 | 1e-157 | |
| 449501639 | 1040 | PREDICTED: putative SWI/SNF-related matr | 0.640 | 0.470 | 0.556 | 1e-151 | |
| 449443398 | 1040 | PREDICTED: putative SWI/SNF-related matr | 0.640 | 0.470 | 0.554 | 1e-151 | |
| 356543536 | 1008 | PREDICTED: putative SWI/SNF-related matr | 0.638 | 0.483 | 0.566 | 1e-150 |
| >gi|255573018|ref|XP_002527439.1| DNA repair helicase rad5,16, putative [Ricinus communis] gi|223533174|gb|EEF34931.1| DNA repair helicase rad5,16, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 646 bits (1666), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 323/518 (62%), Positives = 391/518 (75%), Gaps = 19/518 (3%)
Query: 1 MGTKVTDEVLSTVRSVVGPEFSNMDIIRALHMANHDPAAAINIIFDTPNF------KTPE 54
MG K+TDE+L+TVRS+VGPEFS+MDIIRALH++ +DP+AAINIIFDTPNF +TP
Sbjct: 1 MGNKMTDELLTTVRSIVGPEFSDMDIIRALHLSKNDPSAAINIIFDTPNFNSKLKPQTPY 60
Query: 55 IKPL-------AARRKLIISKENEIRASSENGTLAEAIAEG--YSEGSEWWFVGWGDVPA 105
P+ + ++SKENE R S + + + I + GSEWW+ G GDV
Sbjct: 61 KTPILENPNSNPTKEPKLVSKENENRNISVHNS--DNIEDNCINENGSEWWYAGSGDVAG 118
Query: 106 MSTSKGRKLRRGDEVTFTFPLKSFNSLSSKFPSKSFVRARQAVVPCSEIVRFSTKDAGEI 165
+STSKGRKL+ GD V FTFPLKS N+ +S K+F + RQ CSEIVRFST+D+GE+
Sbjct: 119 LSTSKGRKLKAGDGVIFTFPLKSSNTSNSPSQGKAFGKGRQPATACSEIVRFSTRDSGEV 178
Query: 166 GRIPHEWSRCLLPLVRDKKVEILGCCKSAPEVLGIMDTIVLSIRVYINSSMFRKHHATSL 225
GRIP+EW+RCLLPLVR KKV I G CKSAP++LGIMDTI+LSI VYINS++FR H TSL
Sbjct: 179 GRIPNEWARCLLPLVRYKKVRIEGYCKSAPDILGIMDTILLSISVYINSALFRMHQQTSL 238
Query: 226 KAGSNSAEDSVSLCHPLPNLFRLLGITPFKKAEFTPSDLYTRKRPLDSKDGCGLHASLLH 285
KA SN E+++ HPLPNLFRLLG+TPFKKAEFTP+DLYTRKRPL+SKDG G+ A LLH
Sbjct: 239 KAVSNPTEETI--VHPLPNLFRLLGLTPFKKAEFTPADLYTRKRPLNSKDGSGIPALLLH 296
Query: 286 ANKSKVQSAKVNDVDDVEPISDSDVDNIVGVGYSSEIEEMEPPSTLKCELRPYQKQALHW 345
NKSK QS ++V++ + ISD+D+DNIVGV SSE+EEM+PPSTL+CELRPYQKQAL W
Sbjct: 297 VNKSKNQSKDGSEVENEDSISDTDLDNIVGVRDSSELEEMDPPSTLQCELRPYQKQALQW 356
Query: 346 MVQLEKGRCLDEAATTLHPCWEAYRLLDERELVVYLNAFSGEATIEFPSTLQMARGGILA 405
M QLEKG+ DE AT LHPCWEAY L D+R+LVVYLN FSG+AT+EFPSTLQMARGGILA
Sbjct: 357 MYQLEKGKYTDEGATALHPCWEAYHLADQRQLVVYLNTFSGDATVEFPSTLQMARGGILA 416
Query: 406 DAMGLGKTVMTIALLLTHSQRGGLSGIQSASQPSDGGIEGYDISDQSPNLMKKEPKSLSI 465
D+MGLGKT+MTI+LLL HS+RGG S Q SQ S + D SDQ PN K +
Sbjct: 417 DSMGLGKTIMTISLLLAHSERGGTSSTQFMSQLSTENSDVNDTSDQLPNPPKNTKRFSGF 476
Query: 466 DKLIKQTNTLINGGTLIICPMTLLGQWNKLIQKPYEEG 503
DKL+KQ L+NGG L+ICPMTLLGQW I+ + G
Sbjct: 477 DKLMKQKKILVNGGNLLICPMTLLGQWKAEIETHTQPG 514
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297734859|emb|CBI17093.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225436359|ref|XP_002270098.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like isoform 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359479470|ref|XP_003632276.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|45935136|gb|AAS79594.1| putative DNA repair protein [Ipomoea trifida] gi|117166029|dbj|BAF36331.1| hypothetical protein [Ipomoea trifida] | Back alignment and taxonomy information |
|---|
| >gi|15242960|ref|NP_197667.1| DNA/RNA helicase protein RAD5 [Arabidopsis thaliana] gi|60390961|sp|Q9FNI6.1|SM3L2_ARATH RecName: Full=Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2; Short=SMARCA3-like protein 2 gi|10178249|dbj|BAB11681.1| DNA repair protein RAD5 protein [Arabidopsis thaliana] gi|110737306|dbj|BAF00599.1| hypothetical protein [Arabidopsis thaliana] gi|332005687|gb|AED93070.1| DNA/RNA helicase protein RAD5 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297812401|ref|XP_002874084.1| hypothetical protein ARALYDRAFT_489124 [Arabidopsis lyrata subsp. lyrata] gi|297319921|gb|EFH50343.1| hypothetical protein ARALYDRAFT_489124 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449501639|ref|XP_004161424.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449443398|ref|XP_004139464.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356543536|ref|XP_003540216.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 763 | ||||||
| TAIR|locus:2162504 | 1029 | RAD5 [Arabidopsis thaliana (ta | 0.651 | 0.482 | 0.581 | 5.7e-277 | |
| TAIR|locus:2158357 | 1277 | AT5G43530 [Arabidopsis thalian | 0.352 | 0.210 | 0.638 | 2e-183 | |
| ASPGD|ASPL0000056426 | 1202 | AN0044 [Emericella nidulans (t | 0.456 | 0.289 | 0.284 | 7.3e-49 | |
| POMBASE|SPAC13G6.01c | 1133 | rad8 "ubiquitin-protein ligase | 0.319 | 0.215 | 0.294 | 2.5e-43 | |
| CGD|CAL0004569 | 1084 | orf19.2097 [Candida albicans ( | 0.302 | 0.213 | 0.284 | 1.1e-37 | |
| ZFIN|ZDB-GENE-030131-3306 | 942 | hltf "helicase-like transcript | 0.152 | 0.123 | 0.393 | 1.7e-33 | |
| UNIPROTKB|H7C5K0 | 425 | HLTF "Helicase-like transcript | 0.334 | 0.6 | 0.328 | 1.9e-31 | |
| DICTYBASE|DDB_G0272082 | 1838 | DDB_G0272082 "CHR group protei | 0.159 | 0.066 | 0.392 | 4.5e-31 | |
| MGI|MGI:1196437 | 1003 | Hltf "helicase-like transcript | 0.331 | 0.252 | 0.305 | 6.2e-28 | |
| UNIPROTKB|E2R9I5 | 1007 | HLTF "Uncharacterized protein" | 0.331 | 0.251 | 0.298 | 1.2e-27 |
| TAIR|locus:2162504 RAD5 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1448 (514.8 bits), Expect = 5.7e-277, Sum P(2) = 5.7e-277
Identities = 303/521 (58%), Positives = 370/521 (71%)
Query: 1 MGTKVTDEVLSTVRSVVGPEFSNMDIIRALHMANHDPAAAINIIFDTPNFKTPEIK-PLA 59
MGTKV+D+++STVRSVVG ++S+MDIIRALHMANHDP AAINIIFDTP+F P++ P
Sbjct: 1 MGTKVSDDLVSTVRSVVGSDYSDMDIIRALHMANHDPTAAINIIFDTPSFAKPDVATPTP 60
Query: 60 ARRKLIISKENEIRASS--ENGTLA---------EAIAEGYSE---GSEWWFVGWGDVPA 105
+ ++ ++ + ++G++ E++ G E G+EWWFVG ++
Sbjct: 61 SGSNGGKRVDSGLKGCTFGDSGSVGANHRVEEENESVNGGGEESVSGNEWWFVGCSELAG 120
Query: 106 MSTSKGRKLRRGDEVTFTFPLKSFNSLSSKFPSK-SFVRARQAVVPCSEIVRFSTKDAGE 164
+ST KGRKL+ GDE+ FTFP S P K F R R A+ S+IVRFSTKD+GE
Sbjct: 121 LSTCKGRKLKSGDELVFTFP-HSKGLKPETTPGKRGFGRGRPALRGASDIVRFSTKDSGE 179
Query: 165 IGRIPHEWSRCLLPLVRDKKVEILGCCKSAPEVLGIMDTIVLSIRVYINSSMFRKHHATS 224
IGRIP+EW+RCLLPLVRDKK+ I G CKSAPE L IMDTI+LS+ VYINSSMF+KH ATS
Sbjct: 180 IGRIPNEWARCLLPLVRDKKIRIEGSCKSAPEALSIMDTILLSVSVYINSSMFQKHSATS 239
Query: 225 LKAGSNSAEDSVSLCHPLPNLFRLLGITPFKKAEFTPSDLYTRKRPLDSKDGCGLHASLL 284
K SN+AE+S + HPLPNLFRLLG+ PFKKAEFTP D Y++KRPL SKDG + SLL
Sbjct: 240 FKTASNTAEES--MFHPLPNLFRLLGLIPFKKAEFTPEDFYSKKRPLSSKDGSAIPTSLL 297
Query: 285 HANKSKVQSAKVNDVDDVEPISDSDVDNIVGVGYSSEIEEMEPPSTLKCELRPYQKQALH 344
NK K + N ++ + ISD D+DNIVGVG SS ++EME P TL CELRPYQKQALH
Sbjct: 298 QLNKVKNMNQDANGDENEQCISDGDLDNIVGVGDSSGLKEMETPHTLLCELRPYQKQALH 357
Query: 345 WMVQLEKGRCLDEAATTLHPCWEAYRLLDERELVVYLNAFSGEATIEFPSTLQMARGGIL 404
WM QLEKG C DEAAT LHPCWEAY L D+RELVVYLN+F+G+ATI FPSTLQMARGGIL
Sbjct: 358 WMTQLEKGNCTDEAATMLHPCWEAYCLADKRELVVYLNSFTGDATIHFPSTLQMARGGIL 417
Query: 405 ADAMGLGKTVMTIALLLTHSQRGGLSGIQSASQPSDGGIEGYDISD-QSPNLMKKEPKSL 463
ADAMGLGKTVMTI+LLL HS + +G + D I + D SP + K K L
Sbjct: 418 ADAMGLGKTVMTISLLLAHSWKAASTGFLCPNYEGDKVISS-SVDDLTSPPV--KATKFL 474
Query: 464 SIDK-LIKQTNTLINGGTLIICPMTLLGQWNKLIQKPYEEG 503
DK L++Q + L NGG LI+CPMTLLGQW I+ + G
Sbjct: 475 GFDKRLLEQKSVLQNGGNLIVCPMTLLGQWKTEIEMHAKPG 515
|
|
| TAIR|locus:2158357 AT5G43530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000056426 AN0044 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC13G6.01c rad8 "ubiquitin-protein ligase E3 Rad8" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0004569 orf19.2097 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-3306 hltf "helicase-like transcription factor" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H7C5K0 HLTF "Helicase-like transcription factor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0272082 DDB_G0272082 "CHR group protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1196437 Hltf "helicase-like transcription factor" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R9I5 HLTF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 6.3.2 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | RAD5 | RAD5; ATP binding / ATP-dependent helicase/ DNA binding / helicase/ hydrolase, acting on acid anhydrides, in phosphorus-containing anhydrides / nucleic acid binding / protein binding / zinc ion binding; DNA repair gene. gamma-radiation hypersensitive (RAD5) involved in stable transformation and T-DNA transfer ; Possesses intrinsic ATP-dependent nucleosome-remodeling activity. This activity may be required for DNA repair (By similarity) (1029 aa) | |||||||||
(Arabidopsis thaliana) | |||||||||||
 | UVH1 | • | • | 0.693 | |||||||
 | ATRAD51 | • | • | 0.678 | |||||||
 | UBC13 | • | 0.655 | ||||||||
 | AT3G19120 | • | 0.599 | ||||||||
 | RAD50 | • | 0.596 | ||||||||
 | MUS81 | • | 0.593 | ||||||||
 | RECQ4A | • | • | 0.587 | |||||||
 | PCNA1 | • | • | • | 0.547 | ||||||
 | AT4G17760 | • | 0.504 | ||||||||
 | APC11 | • | 0.468 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 763 | |||
| pfam00176 | 301 | pfam00176, SNF2_N, SNF2 family N-terminal domain | 7e-18 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 3e-11 | |
| COG0553 | 866 | COG0553, HepA, Superfamily II DNA/RNA helicases, S | 3e-11 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 3e-10 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 8e-10 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 1e-09 | |
| pfam08797 | 95 | pfam08797, HIRAN, HIRAN domain | 8e-09 | |
| smart00910 | 90 | smart00910, HIRAN, The HIRAN protein (HIP116, Rad5 | 1e-08 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 2e-08 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 2e-08 | |
| pfam00176 | 301 | pfam00176, SNF2_N, SNF2 family N-terminal domain | 2e-07 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 2e-07 | |
| COG0553 | 866 | COG0553, HepA, Superfamily II DNA/RNA helicases, S | 3e-06 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 2e-05 | |
| PHA02929 | 238 | PHA02929, PHA02929, N1R/p28-like protein; Provisio | 4e-04 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 0.001 | |
| PLN03142 | 1033 | PLN03142, PLN03142, Probable chromatin-remodeling | 0.002 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 0.002 |
| >gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain | Back alignment and domain information |
|---|
Score = 84.7 bits (210), Expect = 7e-18
Identities = 32/101 (31%), Positives = 55/101 (54%), Gaps = 6/101 (5%)
Query: 501 EEGDERGLKLVQSILKPIMLRRTKSSTDREGRPILVLPPADMQVIYCELTEAEKDFYEAL 560
E + G+ + +LKP +LRRTK ++ LPP V+YC L++ ++ Y+ L
Sbjct: 207 LEKGKEGINRLHKLLKPFLLRRTKDDVEKS------LPPKTEHVLYCNLSDEQRKLYKKL 260
Query: 561 FKRSKVKFDQFVEQGRILHNYASILELLLRLRQCCDHPFLV 601
+ ++ VE G AS+L L+++LR+ C+HP+L
Sbjct: 261 LTKRRLALSFAVEGGEKNVGIASLLNLIMQLRKICNHPYLF 301
|
This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g. ERCC6, RAD16, RAD5), DNA recombination (e.g. RAD54), and chromatin unwinding (e.g. ISWI) as well as a variety of other proteins with little functional information (e.g. lodestar, ETL1). Length = 301 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|220020 pfam08797, HIRAN, HIRAN domain | Back alignment and domain information |
|---|
| >gnl|CDD|214906 smart00910, HIRAN, The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 763 | |||
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 100.0 | |
| KOG0385 | 971 | consensus Chromatin remodeling complex WSTF-ISWI, | 100.0 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 100.0 | |
| KOG0389 | 941 | consensus SNF2 family DNA-dependent ATPase [Chroma | 100.0 | |
| KOG0387 | 923 | consensus Transcription-coupled repair protein CSB | 100.0 | |
| KOG4439 | 901 | consensus RNA polymerase II transcription terminat | 100.0 | |
| KOG0392 | 1549 | consensus SNF2 family DNA-dependent ATPase domain- | 100.0 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 100.0 | |
| KOG0384 | 1373 | consensus Chromodomain-helicase DNA-binding protei | 100.0 | |
| KOG0391 | 1958 | consensus SNF2 family DNA-dependent ATPase [Genera | 100.0 | |
| KOG0386 | 1157 | consensus Chromatin remodeling complex SWI/SNF, co | 100.0 | |
| KOG0388 | 1185 | consensus SNF2 family DNA-dependent ATPase [Replic | 100.0 | |
| KOG1015 | 1567 | consensus Transcription regulator XNP/ATRX, DEAD-b | 99.95 | |
| KOG0390 | 776 | consensus DNA repair protein, SNF2 family [Replica | 99.94 | |
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 99.93 | |
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 99.92 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 99.89 | |
| KOG1016 | 1387 | consensus Predicted DNA helicase, DEAD-box superfa | 99.86 | |
| KOG1000 | 689 | consensus Chromatin remodeling protein HARP/SMARCA | 99.76 | |
| PF08797 | 107 | HIRAN: HIRAN domain; InterPro: IPR014905 The HIRAN | 99.58 | |
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 99.5 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 99.42 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 98.82 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.77 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.56 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.56 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.56 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.45 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.41 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.38 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.31 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 98.29 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.29 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.24 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.22 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.18 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.17 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.05 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.05 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 97.97 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 97.95 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.94 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.92 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 97.9 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 97.86 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 97.81 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 97.8 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.69 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.64 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 97.62 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.53 | |
| PF11496 | 297 | HDA2-3: Class II histone deacetylase complex subun | 97.45 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.43 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.37 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.14 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.07 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 96.99 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.92 | |
| PF14555 | 43 | UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A | 96.87 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.85 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 96.82 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.74 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 96.65 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.6 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 96.55 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 96.54 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.42 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.32 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 96.28 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 96.18 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 96.06 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.91 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.6 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 95.47 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.34 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 95.09 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 95.02 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 94.91 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.91 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 94.8 | |
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 94.69 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 94.46 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 94.18 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 94.1 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 94.03 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 93.68 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 93.56 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 93.45 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 93.44 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.22 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 93.09 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 92.93 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.75 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 92.66 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 91.89 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 91.81 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 91.69 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 91.68 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 91.31 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 91.03 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 90.67 | |
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 90.39 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 89.59 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 89.52 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 88.54 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 88.43 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 87.48 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 86.66 | |
| PF02845 | 42 | CUE: CUE domain; InterPro: IPR003892 This domain m | 86.39 | |
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 86.12 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 86.08 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 85.13 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 84.72 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 84.36 | |
| smart00546 | 43 | CUE Domain that may be involved in binding ubiquit | 83.75 | |
| KOG1123 | 776 | consensus RNA polymerase II transcription initiati | 83.71 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 83.65 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.77 | |
| PHA03096 | 284 | p28-like protein; Provisional | 81.52 | |
| PF13872 | 303 | AAA_34: P-loop containing NTP hydrolase pore-1 | 80.81 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 80.19 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 80.07 |
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.3e-55 Score=463.44 Aligned_cols=354 Identities=34% Similarity=0.538 Sum_probs=277.0
Q ss_pred ccCCCCCccCCCCchHHHHhHHHHHhcccCCCcccccccCCccceeeeecCccceeEEeecccCcccccCCcccccccCc
Q 004295 323 EEMEPPSTLKCELRPYQKQALHWMVQLEKGRCLDEAATTLHPCWEAYRLLDERELVVYLNAFSGEATIEFPSTLQMARGG 402 (763)
Q Consensus 323 ~e~e~p~~l~~~LrpYQkqgl~WMl~rE~~~~~~~~~~~~~plW~~~~~~~~~~~~~Y~N~~sg~~s~~~P~~~~~~~GG 402 (763)
..++||..+...|.|||++||+|+...|.. ...||
T Consensus 173 e~aeqP~dlii~LL~fQkE~l~Wl~~QE~S---------------------------------------------s~~GG 207 (791)
T KOG1002|consen 173 ERAEQPDDLIIPLLPFQKEGLAWLTSQEES---------------------------------------------SVAGG 207 (791)
T ss_pred hcccCcccceecchhhhHHHHHHHHHhhhh---------------------------------------------hhccc
Confidence 347899999999999999999999988752 36799
Q ss_pred eeecCCCCchHHHHHHHHHhcccCCCCcccccCCCCCCCCcccccccc--------------------------------
Q 004295 403 ILADAMGLGKTVMTIALLLTHSQRGGLSGIQSASQPSDGGIEGYDISD-------------------------------- 450 (763)
Q Consensus 403 ILADEMGLGKTIq~LaLI~~~~~~~~~l~v~p~sl~~~w~~ei~~~~~-------------------------------- 450 (763)
|||||||||||||+|||+++.....++++++|+..+.+|.+||.....
T Consensus 208 iLADEMGMGKTIQtIaLllae~~ra~tLVvaP~VAlmQW~nEI~~~T~gslkv~~YhG~~R~~nikel~~YDvVLTty~v 287 (791)
T KOG1002|consen 208 ILADEMGMGKTIQTIALLLAEVDRAPTLVVAPTVALMQWKNEIERHTSGSLKVYIYHGAKRDKNIKELMNYDVVLTTYAV 287 (791)
T ss_pred eehhhhccchHHHHHHHHHhccccCCeeEEccHHHHHHHHHHHHHhccCceEEEEEecccccCCHHHhhcCcEEEEecHH
Confidence 999999999999999999999888899999999999999998765211
Q ss_pred ------------------------------------cCccccccCccccchHHHhhhccccccCceEEE-----------
Q 004295 451 ------------------------------------QSPNLMKKEPKSLSIDKLIKQTNTLINGGTLII----------- 483 (763)
Q Consensus 451 ------------------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLIV----------- 483 (763)
++|.++.+........-.+.+.++|+..||++.
T Consensus 288 vEs~yRk~~~GfrrKngv~ke~SlLHsi~~~RiIlDEAH~IK~R~snTArAV~~L~tt~rw~LSGTPLQNrigElySLiR 367 (791)
T KOG1002|consen 288 VESVYRKQDYGFRRKNGVDKEKSLLHSIKFYRIILDEAHNIKDRQSNTARAVFALETTYRWCLSGTPLQNRIGELYSLIR 367 (791)
T ss_pred HHHHHHhccccccccCCcccccchhhhceeeeeehhhhcccccccccHHHHHHhhHhhhhhhccCCcchhhHHHHHHHHH
Confidence 111111111111111113455677888888762
Q ss_pred ----cCcc-------------------------------hhhhhhhhcCCCcccC-----CHHHHHHHHHHHhhhheeec
Q 004295 484 ----CPMT-------------------------------LLGQWNKLIQKPYEEG-----DERGLKLVQSILKPIMLRRT 523 (763)
Q Consensus 484 ----~P~s-------------------------------ll~qW~~~i~~P~e~~-----~~~~~~~L~~iL~pi~LRRt 523 (763)
.|++ -.-.|+.+..+|+... ...++..++.+|+.+|||||
T Consensus 368 FL~i~Pfsyyfc~~cdc~~~~~~ftdr~~c~~c~h~~m~h~~~~n~~mlk~IqkfG~eGpGk~af~~~h~llk~ImlrrT 447 (791)
T KOG1002|consen 368 FLNINPFSYYFCTKCDCASLDWKFTDRMHCDHCSHNIMQHTCFFNHFMLKPIQKFGVEGPGKEAFNNIHTLLKNIMLRRT 447 (791)
T ss_pred HHccCcchhhhhhhccccccceeecccccCCcccchhhhhhhhhcccccccchhhcccCchHHHHHHHHHHHHHHHHHHh
Confidence 2321 0112377777887643 24678899999999999999
Q ss_pred ccccCcCCCccccCCCceEEEEEecCCHHHHHHHHHHHHHHHHHHHHHhhhcccccchHHHHHHHHHHHhhccCcccccc
Q 004295 524 KSSTDREGRPILVLPPADMQVIYCELTEAEKDFYEALFKRSKVKFDQFVEQGRILHNYASILELLLRLRQCCDHPFLVMS 603 (763)
Q Consensus 524 K~~v~~~G~pil~LPpk~~~vv~v~LS~~Er~lY~~i~~~~~~~~~~~~~~g~~~~~~~~il~~LlrLRqiC~HP~Lv~~ 603 (763)
|-....| +-|||+.+.+..=-|++.|.++|+.++...++.|+.+++.|.++.||++||.+|+||||+.+||+|+..
T Consensus 448 kl~RAdD----LgLPPRiv~vRrD~fn~eE~D~YeSLY~dSkrkfntyieeGvvlNNYAnIF~LitRmRQ~aDHP~LVl~ 523 (791)
T KOG1002|consen 448 KLERADD----LGLPPRIVTVRRDFFNEEEKDLYESLYKDSKRKFNTYIEEGVVLNNYANIFTLITRMRQAADHPDLVLY 523 (791)
T ss_pred hcccccc----cCCCccceeeehhhhhhHHHHHHHHHHHhhHHhhhhHHhhhhhhhhHHHHHHHHHHHHHhccCcceeee
Confidence 9998887 889999999999999999999999999999999999999999999999999999999999999999974
Q ss_pred cCCCcchHHHHHHHHHHhcCCCCCCcCCCCCCCcHHHHHHHHHHHhcCCCCCCCcccccccCceecCCcccccHHHHhhh
Q 004295 604 RGDTQDYSDLNKLAKRFLKGSSNALEGEDKDVPSRAYVQEVVEELQKGEQGECPICLEAFEDAVLTPCAHRLCRECLLGS 683 (763)
Q Consensus 604 ~~~~~~~~dl~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~eC~IC~~~~~~~~it~C~H~fC~~Ci~~~ 683 (763)
.... + ... .+.+..+|.+|.++.++++.+.|.|.||+-|+.+|
T Consensus 524 S~~~------------------n-~~~------------------enk~~~~C~lc~d~aed~i~s~ChH~FCrlCi~ey 566 (791)
T KOG1002|consen 524 SANA------------------N-LPD------------------ENKGEVECGLCHDPAEDYIESSCHHKFCRLCIKEY 566 (791)
T ss_pred hhhc------------------C-CCc------------------cccCceeecccCChhhhhHhhhhhHHHHHHHHHHH
Confidence 2100 0 000 01234799999999999999999999999999998
Q ss_pred hcCC---CCCCCCCCCccccccccccCCCC---Ccc-------ccccccccccchhHHHHHHHHHHHhcC--CCeEEEec
Q 004295 684 WKTP---TSGLCPVCRKTISRQDLITAPTG---SRF-------QVDIEKNWVESTKIAVLLKELENLCLS--GSKSILFS 748 (763)
Q Consensus 684 ~~~~---~~~~CP~Cr~~i~~~~l~~~~~~---~~~-------~~~~~~~~~~SsKi~aLl~~L~~l~~~--~~KvVVFS 748 (763)
+... ....||.|..+++.+.--....+ ..| +++. ++|++|+||+||++.|.-+++. ..|+||||
T Consensus 567 v~~f~~~~nvtCP~C~i~LsiDlse~alek~~l~~Fk~sSIlnRinm-~~~qsSTKIEAL~EEl~~l~~rd~t~KsIVFS 645 (791)
T KOG1002|consen 567 VESFMENNNVTCPVCHIGLSIDLSEPALEKTDLKGFKASSILNRINM-DDWQSSTKIEALVEELYFLRERDRTAKSIVFS 645 (791)
T ss_pred HHhhhcccCCCCccccccccccccchhhhhcchhhhhhHHHhhhcch-hhhcchhHHHHHHHHHHHHHHcccchhhhhHH
Confidence 8542 35889999998876522111110 011 2233 3799999999999999999877 88999999
Q ss_pred CchhHHHHhhhhccC
Q 004295 749 QWTAFLDLLQIPLSR 763 (763)
Q Consensus 749 Qfts~LDlIe~~L~r 763 (763)
|||||||||+..|.|
T Consensus 646 QFTSmLDLi~~rL~k 660 (791)
T KOG1002|consen 646 QFTSMLDLIEWRLGK 660 (791)
T ss_pred HHHHHHHHHHHHhhc
Confidence 999999999998865
|
|
| >KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] | Back alignment and domain information |
|---|
| >KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF08797 HIRAN: HIRAN domain; InterPro: IPR014905 The HIRAN protein (HIP116, Rad5p N-terminal) is found in the N-terminal regions of the SWI2/SNF2 proteins typified by HIP116 and Rad5p | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11496 HDA2-3: Class II histone deacetylase complex subunits 2 and 3; InterPro: IPR021006 This entry contains the class II histone deacetylase complex subunits HDA2 and HDA3 is found in fungi | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 763 | ||||
| 2jmd_A | 63 | Solution Structure Of The Ring Domain Of Human Traf | 6e-06 | ||
| 3hct_A | 118 | Crystal Structure Of Traf6 In Complex With Ubc13 In | 2e-05 | ||
| 3hcs_A | 170 | Crystal Structure Of The N-Terminal Domain Of Traf6 | 2e-05 | ||
| 1jm7_A | 112 | Solution Structure Of The Brca1/bard1 Ring-domain H | 4e-05 | ||
| 2eci_A | 86 | Solution Structure Of The Ring Domain Of The Human | 9e-05 | ||
| 2ecw_A | 85 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 1e-04 | ||
| 1z63_A | 500 | Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM | 6e-04 | ||
| 1z6a_A | 500 | Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN | 6e-04 | ||
| 2xeu_A | 64 | Ring Domain Length = 64 | 7e-04 | ||
| 4ap4_A | 133 | Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Le | 9e-04 |
| >pdb|2JMD|A Chain A, Solution Structure Of The Ring Domain Of Human Traf6 Length = 63 | Back alignment and structure |
|
| >pdb|3HCT|A Chain A, Crystal Structure Of Traf6 In Complex With Ubc13 In The P1 Space Group Length = 118 | Back alignment and structure |
| >pdb|3HCS|A Chain A, Crystal Structure Of The N-Terminal Domain Of Traf6 Length = 170 | Back alignment and structure |
| >pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 | Back alignment and structure |
| >pdb|2ECI|A Chain A, Solution Structure Of The Ring Domain Of The Human Tnf Receptor-Associated Factor 6 Protein Length = 86 | Back alignment and structure |
| >pdb|2ECW|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Tripartite Motif Protein 30 Length = 85 | Back alignment and structure |
| >pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 | Back alignment and structure |
| >pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 | Back alignment and structure |
| >pdb|2XEU|A Chain A, Ring Domain Length = 64 | Back alignment and structure |
| >pdb|4AP4|A Chain A, Rnf4 - Ubch5a - Ubiquitin Heterotrimeric Complex Length = 133 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 | Back alignment and structure |
|---|
Score = 83.8 bits (208), Expect = 5e-17
Identities = 33/127 (25%), Positives = 55/127 (43%), Gaps = 11/127 (8%)
Query: 488 LLG---QWNKLIQKPYEEGDERGLKLVQSILKPIMLRRTKSSTDREGRPILVLPPADMQV 544
LLG ++ P ++GD + +++I+ P +LRRTK + I LP
Sbjct: 206 LLGSYSEFKSKFATPIKKGDNMAKEELKAIISPFILRRTKY----DKAIINDLPDKIETN 261
Query: 545 IYCELTEAEKDFYEALFKRSKVKFDQFVEQGRILHNYASILELLLRLRQCCDHPFLVMSR 604
+YC LT + Y+A + ++ + IL LL+L+Q DHP L+
Sbjct: 262 VYCNLTPEQAAMYKAEVENLFNN----IDSVTGIKRKGMILSTLLKLKQIVDHPALLKGG 317
Query: 605 GDTQDYS 611
+ S
Sbjct: 318 EQSVRRS 324
|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Length = 271 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Length = 328 | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Length = 93 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 763 | |||
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 99.97 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 99.97 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 99.96 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 99.58 | |
| 3hgt_A | 328 | HDA1 complex subunit 3; RECA-like domain, SWI2/SNF | 99.44 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.4 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.08 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 98.81 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 98.77 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 98.74 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 98.74 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 98.73 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.73 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 98.73 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.72 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.71 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 98.71 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 98.71 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 98.7 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 98.68 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.68 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.67 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.66 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 98.65 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 98.65 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.65 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 98.64 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 98.62 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.62 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.61 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 98.59 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 98.58 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.56 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.55 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.55 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.54 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.52 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.51 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.51 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.5 | |
| 2l1i_A | 122 | HLTF protein; hiran domain, transcription factor, | 98.5 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.48 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.47 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.46 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.45 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.45 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.44 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 98.43 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.43 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.42 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.41 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.41 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.38 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.38 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.37 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.33 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.33 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.33 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.33 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.31 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.31 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.29 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.27 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.24 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.23 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.2 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.19 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.17 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.16 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 98.16 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.15 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.13 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.11 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.0 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 97.98 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 97.91 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 97.81 | |
| 3k2y_A | 109 | Uncharacterized protein LP_0118; nucleic acid bind | 97.72 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.68 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 97.59 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 97.56 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 97.36 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 97.06 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 96.95 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 96.88 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 96.87 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 96.72 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 96.71 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 96.6 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 96.56 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 96.51 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 96.32 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 96.24 | |
| 1v92_A | 46 | NSFL1 cofactor P47; 3-helix bundle, recombination; | 96.02 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 95.86 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 95.63 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 95.54 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 95.52 | |
| 2dal_A | 62 | Protein KIAA0794; FAS associted factor 1, UBA-like | 95.43 | |
| 2dam_A | 67 | ETEA protein; KIAA0887, UBA-like domain, structura | 94.93 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 94.83 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 94.8 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 94.78 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 94.63 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 94.32 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 94.25 | |
| 1wji_A | 63 | Tudor domain containing protein 3; UBA domain, str | 94.19 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 94.19 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 94.16 | |
| 2dzl_A | 66 | Protein FAM100B; UBA-like domain, structural genom | 93.89 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 93.15 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 93.15 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 93.03 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 92.84 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 92.71 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 92.2 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 92.08 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 91.69 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 91.27 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 91.16 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 91.02 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 90.64 | |
| 1ufz_A | 83 | Hypothetical protein BAB28515; HBS1-like domain, s | 90.42 | |
| 1dv0_A | 47 | DNA repair protein HHR23A; helical bundle, DNA bin | 90.15 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 89.58 | |
| 2jy5_A | 52 | Ubiquilin-1; UBA, alternative splicing, cytoplasm, | 89.54 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 89.45 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 88.83 | |
| 2bwb_A | 46 | Ubiquitin-like protein DSK2; UBA, signaling protei | 88.21 | |
| 3e21_A | 45 | HFAF1, FAS-associated factor 1; UBA, alternative s | 87.13 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 87.04 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 86.35 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 86.24 | |
| 1wiv_A | 73 | UBP14, ubiquitin-specific protease 14; ubiquitin a | 85.94 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 85.7 | |
| 2juj_A | 56 | E3 ubiquitin-protein ligase CBL; alpha helix, UBA | 84.47 | |
| 1wr1_B | 58 | Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu | 83.44 | |
| 2dna_A | 67 | Unnamed protein product; ubiquitin associated doma | 82.97 | |
| 2cpw_A | 64 | CBL-interacting protein STS-1 variant; ubiquitin a | 82.92 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 82.57 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 82.48 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 82.2 | |
| 1wgl_A | 59 | TOLL-interacting protein; CUE domain, structural g | 82.07 | |
| 2dai_A | 83 | Ubadc1, ubiquitin associated domain containing 1; | 81.96 | |
| 1vej_A | 74 | Riken cDNA 4931431F19; UBA domain, three helix bun | 81.9 | |
| 2oo9_A | 46 | E3 ubiquitin-protein ligase CBL; alpha-helical dom | 81.68 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 81.53 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 81.4 | |
| 2crn_A | 64 | Ubash3A protein; compact three-helix bundle, struc | 80.19 |
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=99.97 E-value=7.8e-32 Score=325.40 Aligned_cols=283 Identities=23% Similarity=0.331 Sum_probs=191.0
Q ss_pred CCCccCCCCchHHHHhHHHHHhcccCCCcccccccCCccceeeeecCccceeEEeecccCcccccCCcccccccCceeec
Q 004295 327 PPSTLKCELRPYQKQALHWMVQLEKGRCLDEAATTLHPCWEAYRLLDERELVVYLNAFSGEATIEFPSTLQMARGGILAD 406 (763)
Q Consensus 327 ~p~~l~~~LrpYQkqgl~WMl~rE~~~~~~~~~~~~~plW~~~~~~~~~~~~~Y~N~~sg~~s~~~P~~~~~~~GGILAD 406 (763)
||.....+|||||++||.||+.... ...||||||
T Consensus 229 p~~~~~~~Lr~yQ~egv~~l~~~~~----------------------------------------------~~~~~ILad 262 (800)
T 3mwy_W 229 PPFIKGGELRDFQLTGINWMAFLWS----------------------------------------------KGDNGILAD 262 (800)
T ss_dssp CTTCCSSCCCTHHHHHHHHHHHHHT----------------------------------------------TTCCEEECC
T ss_pred CCccCCCCcCHHHHHHHHHHHHHhh----------------------------------------------cCCCEEEEe
Confidence 4445568999999999999986522 256999999
Q ss_pred CCCCchHHHHHHHHHhc----ccCCCCcccccCCCCCCCCcccccccccCcc----------------------------
Q 004295 407 AMGLGKTVMTIALLLTH----SQRGGLSGIQSASQPSDGGIEGYDISDQSPN---------------------------- 454 (763)
Q Consensus 407 EMGLGKTIq~LaLI~~~----~~~~~~l~v~p~sl~~~w~~ei~~~~~~~~~---------------------------- 454 (763)
+||||||+|+|++|... ...++++++||.+++.+|..++.+|......
T Consensus 263 emGlGKT~~ai~~i~~l~~~~~~~~~~LIV~P~sll~qW~~E~~~~~p~~~v~~~~g~~~~r~~~~~~~~~~~~~~~~~~ 342 (800)
T 3mwy_W 263 EMGLGKTVQTVAFISWLIFARRQNGPHIIVVPLSTMPAWLDTFEKWAPDLNCICYMGNQKSRDTIREYEFYTNPRAKGKK 342 (800)
T ss_dssp CTTSSTTHHHHHHHHHHHHHHSCCSCEEEECCTTTHHHHHHHHHHHSTTCCEEECCCSSHHHHHHHHHHSCSCC-----C
T ss_pred CCCcchHHHHHHHHHHHHHhcCCCCCEEEEECchHHHHHHHHHHHHCCCceEEEEeCCHHHHHHHHHHHhhccccccccc
Confidence 99999999999998755 3356789999999999999998776532111
Q ss_pred ------------------------------------ccccCccccchHHHhhhccccccCceEEEcCcchhhhh--hhhc
Q 004295 455 ------------------------------------LMKKEPKSLSIDKLIKQTNTLINGGTLIICPMTLLGQW--NKLI 496 (763)
Q Consensus 455 ------------------------------------~~~~~~~~~~~~~~~~~~~~~~~~~TLIV~P~sll~qW--~~~i 496 (763)
.++..+........+....+++.+|||| ++++-..| -.|+
T Consensus 343 ~~~~dvvitTy~~l~~~~~~l~~~~w~~vIvDEaH~lkn~~s~~~~~l~~l~~~~rl~LTgTPi--qN~l~el~~ll~fL 420 (800)
T 3mwy_W 343 TMKFNVLLTTYEYILKDRAELGSIKWQFMAVDEAHRLKNAESSLYESLNSFKVANRMLITGTPL--QNNIKELAALVNFL 420 (800)
T ss_dssp CCCCSEEEECTTHHHHTHHHHHTSEEEEEEETTGGGGCCSSSHHHHHHTTSEEEEEEEECSCCC--SSCSHHHHHHHHHH
T ss_pred cccCCEEEecHHHHHhhHHHHhcCCcceeehhhhhhhcCchhHHHHHHHHhhhccEEEeeCCcC--CCCHHHHHHHHHHh
Confidence 0000000000001123345677889998 55555555 1221
Q ss_pred C-C--------CcccC---CHHHHHHHHHHHhhhheeecccccCcCCCccccCCCceEEEEEecCCHHHHHHHHHHHHHH
Q 004295 497 Q-K--------PYEEG---DERGLKLVQSILKPIMLRRTKSSTDREGRPILVLPPADMQVIYCELTEAEKDFYEALFKRS 564 (763)
Q Consensus 497 ~-~--------P~e~~---~~~~~~~L~~iL~pi~LRRtK~~v~~~G~pil~LPpk~~~vv~v~LS~~Er~lY~~i~~~~ 564 (763)
. . .+... ....+..|+.+++|+||||+|.++..+ ||++.+.+++|+||+.|+.+|+.++...
T Consensus 421 ~p~~~~~~~~~~~~~~~~~~~~~~~~L~~~l~p~~lRR~k~dv~~~------LP~k~~~~v~v~ls~~q~~~Y~~i~~~~ 494 (800)
T 3mwy_W 421 MPGRFTIDQEIDFENQDEEQEEYIHDLHRRIQPFILRRLKKDVEKS------LPSKTERILRVELSDVQTEYYKNILTKN 494 (800)
T ss_dssp CSCCC---------CCTTHHHHHHHHHHHTTGGGEEECCGGGGTTT------SCCEEEEEEEECCCHHHHHHHHHHHHHC
T ss_pred CccccCchhhhcccccchhHHHHHHHHHHHHhHHHhhhhHHhhhhc------cCCcEEEEEEeCCCHHHHHHHHHHHHHH
Confidence 1 1 11111 134678899999999999999999776 9999999999999999999999998765
Q ss_pred HHHHHHHhhhcccccchHHHHHHHHHHHhhccCcccccccCCCcchHHHHHHHHHHhcCCCCCCcCCCCCCCcHHHHHHH
Q 004295 565 KVKFDQFVEQGRILHNYASILELLLRLRQCCDHPFLVMSRGDTQDYSDLNKLAKRFLKGSSNALEGEDKDVPSRAYVQEV 644 (763)
Q Consensus 565 ~~~~~~~~~~g~~~~~~~~il~~LlrLRqiC~HP~Lv~~~~~~~~~~dl~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 644 (763)
...+..... .....++..+++||++|+||+|+.... .. ....... . .....
T Consensus 495 ~~~l~~~~~-----~~~~~~l~~l~~Lrk~~~hp~l~~~~~--------~~----~~~~~~~-----~-~~~~~------ 545 (800)
T 3mwy_W 495 YSALTAGAK-----GGHFSLLNIMNELKKASNHPYLFDNAE--------ER----VLQKFGD-----G-KMTRE------ 545 (800)
T ss_dssp CC---------------CTHHHHHHHHHHHHHCGGGSSSHH--------HH----HCCCC----------CCSH------
T ss_pred HHHHhhccc-----cchhhHHHHHHHHHHHhcChhhhcchH--------HH----HHHhccc-----c-cccHH------
Confidence 433322211 223468999999999999999985310 00 0000000 0 00000
Q ss_pred HHHHhcCCCCCCCcccccccCceecCCcccccHHHHhhhhcCCCCCCCCCCCccccccccccCCCCCccccccccccccc
Q 004295 645 VEELQKGEQGECPICLEAFEDAVLTPCAHRLCRECLLGSWKTPTSGLCPVCRKTISRQDLITAPTGSRFQVDIEKNWVES 724 (763)
Q Consensus 645 l~~l~~~~~~eC~IC~~~~~~~~it~C~H~fC~~Ci~~~~~~~~~~~CP~Cr~~i~~~~l~~~~~~~~~~~~~~~~~~~S 724 (763)
..+ ......|
T Consensus 546 ---------------------------------~~~-------------------------------------~~l~~~s 555 (800)
T 3mwy_W 546 ---------------------------------NVL-------------------------------------RGLIMSS 555 (800)
T ss_dssp ---------------------------------HHH-------------------------------------HHHHHTC
T ss_pred ---------------------------------HHH-------------------------------------HHhhhcC
Confidence 000 0012459
Q ss_pred hhHHHHHHHHHHHhcCCCeEEEecCchhHHHHhhhhcc
Q 004295 725 TKIAVLLKELENLCLSGSKSILFSQWTAFLDLLQIPLS 762 (763)
Q Consensus 725 sKi~aLl~~L~~l~~~~~KvVVFSQfts~LDlIe~~L~ 762 (763)
+|+.+|.++|.++...|+|+||||||+.+||+|+..|.
T Consensus 556 ~K~~~L~~lL~~~~~~g~kvLIFsq~~~~ld~L~~~L~ 593 (800)
T 3mwy_W 556 GKMVLLDQLLTRLKKDGHRVLIFSQMVRMLDILGDYLS 593 (800)
T ss_dssp HHHHHHHHHHHHHTTTTCCEEEEESCHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHHhhCCCeEEEEechHHHHHHHHHHHH
Confidence 99999999999998889999999999999999999874
|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l1i_A HLTF protein; hiran domain, transcription factor, DNA repair, transc regulation, transcription, structural genomics, structural consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3k2y_A Uncharacterized protein LP_0118; nucleic acid binding,zinc ION binding, structural genomics, PSI-2, protein structure initiative; 2.40A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ufz_A Hypothetical protein BAB28515; HBS1-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, translatio; NMR {Mus musculus} SCOP: a.5.9.1 | Back alignment and structure |
|---|
| >1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A | Back alignment and structure |
|---|
| >3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 763 | ||||
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 4e-14 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 1e-13 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 4e-13 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 1e-12 | |
| d1z63a1 | 230 | c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h | 1e-11 | |
| d1z3ix1 | 346 | c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fi | 2e-11 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 6e-11 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 3e-10 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 5e-09 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 2e-08 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 6e-08 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 7e-08 | |
| d1z3ix2 | 298 | c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis | 6e-07 | |
| d1z5za1 | 244 | c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 h | 1e-06 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 6e-06 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 7e-06 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 2e-05 | |
| d2fwra1 | 200 | c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar | 4e-05 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 4e-05 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 5e-04 |
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: CBL species: Human (Homo sapiens) [TaxId: 9606]
Score = 65.8 bits (160), Expect = 4e-14
Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 1/51 (1%)
Query: 656 CPICLEAFEDAVLTPCAHRLCRECLLGSWKTPTSGLCPVCRKTISRQDLIT 706
C IC E +D + PC H +C CL SW+ CP CR I + I
Sbjct: 26 CKICAENDKDVKIEPCGHLMCTSCLT-SWQESEGQGCPFCRCEIKGTEPIV 75
|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 346 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 244 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 763 | |||
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 99.89 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 99.81 | |
| d1z3ix1 | 346 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 99.5 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 99.44 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.9 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.89 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.85 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.77 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.7 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.68 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.64 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.63 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.62 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.6 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.57 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.46 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.44 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.36 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 98.29 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.1 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 97.94 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 97.65 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.54 | |
| d1v92a_ | 46 | NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { | 96.61 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 96.48 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 94.78 | |
| d2fwra1 | 200 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 94.62 | |
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 93.67 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 91.07 | |
| d1ufza_ | 83 | HBS1-like protein {Mouse (Mus musculus) [TaxId: 10 | 90.34 | |
| d1wiva_ | 73 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 89.6 | |
| d2bwba1 | 44 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 89.16 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 88.38 | |
| d1wgna_ | 63 | Ubiquitin-associated protein 1, UBAP1 {Human (Homo | 87.57 | |
| d1wj7a1 | 91 | Ubiquitin-associated protein 2-like Ubap2l {Mouse | 87.25 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 86.34 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 84.26 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 81.74 |
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Helicase of the SNF2/Rad54 hamily species: Sulfolobus solfataricus [TaxId: 2287]
Probab=99.89 E-value=8.8e-25 Score=222.60 Aligned_cols=158 Identities=27% Similarity=0.374 Sum_probs=114.4
Q ss_pred CCCCCccCCCCchHHHHhHHHHHhcccCCCcccccccCCccceeeeecCccceeEEeecccCcccccCCcccccccCcee
Q 004295 325 MEPPSTLKCELRPYQKQALHWMVQLEKGRCLDEAATTLHPCWEAYRLLDERELVVYLNAFSGEATIEFPSTLQMARGGIL 404 (763)
Q Consensus 325 ~e~p~~l~~~LrpYQkqgl~WMl~rE~~~~~~~~~~~~~plW~~~~~~~~~~~~~Y~N~~sg~~s~~~P~~~~~~~GGIL 404 (763)
.-+|+.|+.+|||||++||.||+.++. ...||||
T Consensus 3 ~~~P~~~~~~L~~yQ~~~v~~~~~~~~----------------------------------------------~~~g~iL 36 (230)
T d1z63a1 3 LLEPYNIKANLRPYQIKGFSWMRFMNK----------------------------------------------LGFGICL 36 (230)
T ss_dssp CCCCCSCSSCCCHHHHHHHHHHHHHHH----------------------------------------------TTCCEEE
T ss_pred CcCchhhhcchhHHHHHHHHHHHHhhh----------------------------------------------cCCCEEE
Confidence 346789999999999999999998754 2459999
Q ss_pred ecCCCCchHHHHHHHHHhcccC---CCCcccccCCCCCCCCcccccccc-------------------------------
Q 004295 405 ADAMGLGKTVMTIALLLTHSQR---GGLSGIQSASQPSDGGIEGYDISD------------------------------- 450 (763)
Q Consensus 405 ADEMGLGKTIq~LaLI~~~~~~---~~~l~v~p~sl~~~w~~ei~~~~~------------------------------- 450 (763)
|||||||||+|+|+++...... .+.+++||.++..+|..|+..|..
T Consensus 37 aDe~GlGKT~~~i~~~~~~~~~~~~~~~LIv~p~~l~~~W~~e~~~~~~~~~~~~~~~~~~~~~~~~~~vvi~~~~~~~~ 116 (230)
T d1z63a1 37 ADDMGLGKTLQTIAVFSDAKKENELTPSLVICPLSVLKNWEEELSKFAPHLRFAVFHEDRSKIKLEDYDIILTTYAVLLR 116 (230)
T ss_dssp CCCTTSCHHHHHHHHHHHHHHTTCCSSEEEEECSTTHHHHHHHHHHHCTTSCEEECSSSTTSCCGGGSSEEEEEHHHHTT
T ss_pred EeCCCCChHHHHHHhhhhhhhcccccccceecchhhhhHHHHHHHhhcccccceeeccccchhhccCcCEEEeeHHHHHh
Confidence 9999999999999998765543 468999999999999888655322
Q ss_pred ---------------cCccccccCccccchHHHhhhccccccCceEEEcCcchhh-----------------hhhhhcCC
Q 004295 451 ---------------QSPNLMKKEPKSLSIDKLIKQTNTLINGGTLIICPMTLLG-----------------QWNKLIQK 498 (763)
Q Consensus 451 ---------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TLIV~P~sll~-----------------qW~~~i~~ 498 (763)
++|..++..+........++...+++.+|||+ +.+..+ .|+..+..
T Consensus 117 ~~~l~~~~~~~vI~DEah~~k~~~s~~~~~~~~l~a~~r~~LTgTPi--~n~~~dl~~ll~~l~p~~~~~~~~F~~~~~~ 194 (230)
T d1z63a1 117 DTRLKEVEWKYIVIDEAQNIKNPQTKIFKAVKELKSKYRIALTGTPI--ENKVDDLWSIMTFLNPGLLGSYSEFKSKFAT 194 (230)
T ss_dssp CHHHHTCCEEEEEEETGGGGSCTTSHHHHHHHTSCEEEEEEECSSCS--TTCHHHHHHHHHHHSTTTTCCHHHHHTTTHH
T ss_pred HHHHhcccceEEEEEhhhcccccchhhhhhhhhhccceEEEEecchH--HhHHHHHHHHHHhhCCCcCCCHHHHHHHHhh
Confidence 22222221111111112233456788999998 333222 23555667
Q ss_pred CcccCCHHHHHHHHHHHhhhheeeccccc--CcC
Q 004295 499 PYEEGDERGLKLVQSILKPIMLRRTKSST--DRE 530 (763)
Q Consensus 499 P~e~~~~~~~~~L~~iL~pi~LRRtK~~v--~~~ 530 (763)
|++.++....+.|+.+|+|+|+||+|.++ ..|
T Consensus 195 ~~~~~~~~~~~~L~~~l~~~~lRr~K~d~~v~~d 228 (230)
T d1z63a1 195 PIKKGDNMAKEELKAIISPFILRRTKYDKAIIND 228 (230)
T ss_dssp HHHTTCHHHHHHHHHHHTTTEECCCTTCHHHHTT
T ss_pred hhhccCHHHHHHHHHHhhccEEEEecCCccHhhc
Confidence 77888888999999999999999999984 445
|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufza_ a.5.9.1 (A:) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|