Citrus Sinensis ID: 004319
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 761 | ||||||
| 359481176 | 734 | PREDICTED: transcription factor bHLH140- | 0.944 | 0.979 | 0.693 | 0.0 | |
| 224140455 | 718 | predicted protein [Populus trichocarpa] | 0.936 | 0.993 | 0.692 | 0.0 | |
| 255579308 | 749 | aprataxin, putative [Ricinus communis] g | 0.930 | 0.945 | 0.690 | 0.0 | |
| 356496191 | 734 | PREDICTED: transcription factor bHLH140- | 0.943 | 0.978 | 0.650 | 0.0 | |
| 296081123 | 678 | unnamed protein product [Vitis vinifera] | 0.879 | 0.986 | 0.647 | 0.0 | |
| 147867251 | 864 | hypothetical protein VITISV_005888 [Viti | 0.963 | 0.848 | 0.640 | 0.0 | |
| 449440255 | 712 | PREDICTED: transcription factor bHLH140- | 0.919 | 0.983 | 0.633 | 0.0 | |
| 449483719 | 712 | PREDICTED: transcription factor bHLH140- | 0.919 | 0.983 | 0.633 | 0.0 | |
| 15240948 | 912 | aprataxin [Arabidopsis thaliana] gi|7533 | 0.901 | 0.752 | 0.591 | 0.0 | |
| 297810265 | 898 | basic helix-loop-helix family protein [A | 0.919 | 0.779 | 0.579 | 0.0 |
| >gi|359481176|ref|XP_002270443.2| PREDICTED: transcription factor bHLH140-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1050 bits (2714), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 518/747 (69%), Positives = 605/747 (80%), Gaps = 28/747 (3%)
Query: 11 AKDEEKKWKQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTS 70
+K+ E + K I+V+++GAPGSGKSTFCEHV+RSS RPW R+CQDTI GK+GTK QCL S
Sbjct: 7 SKEGEGQGKPIVVLLMGAPGSGKSTFCEHVIRSSTRPWVRVCQDTIGNGKAGTKSQCLKS 66
Query: 71 ASSALKKGKSVFLDRCNLEREQRTDFVKLGGPEVDVHAVVLDLPAKLCISRSVKRIEHEG 130
A+SAL+ GKSVF+DRCNL+REQR +FVKLG P+V++HAVVLDLPA+LCISRSVKR HEG
Sbjct: 67 ATSALEDGKSVFIDRCNLDREQRAEFVKLGSPQVEMHAVVLDLPAQLCISRSVKRTGHEG 126
Query: 131 NLQGGKAAAVVNRMLQKKELPKLSEGFSRITLCQNENDVQAALDTYSGLGPLDTLPHGSF 190
NLQGGKAAAVVNRMLQKKELPKLSEGF RIT CQN++DVQ AL+TYS L LDTLP G F
Sbjct: 127 NLQGGKAAAVVNRMLQKKELPKLSEGFHRITFCQNDSDVQTALNTYSALSHLDTLPPGCF 186
Query: 191 GQKNPDAKIQLGIMKFLKKVDAPSNTGSTASSTQDPVPPQITEEKNSCLEGQEITSLLSD 250
GQKNPDAKIQLGIMKFLKKV+ P N G SS S
Sbjct: 187 GQKNPDAKIQLGIMKFLKKVEVPVNVGEDISS--------------------------SS 220
Query: 251 AAGEEVKGTENPEVASVNQNGSSSDVPTLAFPSLSTSDFQFNNEKASDVIIEKVEEFVNK 310
+E+KG E+ V SV+ SS D+PTLAFPS+ST+DFQFN+EKA+D+I+EKVEEFVNK
Sbjct: 221 GNAKEIKGGEDIVVHSVDGTVSSKDIPTLAFPSISTADFQFNHEKAADIILEKVEEFVNK 280
Query: 311 LGNARLVLVDLTQGSKILSLVRAKAAQKHINPKKFFTFVGDITRLYTGGGLCCNVIANAA 370
+ NARLVLVDL+ GSKILSLVRAKAAQ++I+ KFFTFVGDITRLY+ GGL CN IANAA
Sbjct: 281 VENARLVLVDLSHGSKILSLVRAKAAQRNIDSNKFFTFVGDITRLYSKGGLRCNAIANAA 340
Query: 371 NWRLKPGGGGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVI 430
NWRLKPGGGG NAAIFSAAGP LEV T +RA SL PG +++VPLPSTSPL REGVTHVI
Sbjct: 341 NWRLKPGGGGANAAIFSAAGPELEVETKKRAGSLIPGKALVVPLPSTSPLFSREGVTHVI 400
Query: 431 HVLGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEKLSKGCNEDIRLEPS 490
HVLGPNMN +RPNCL+ DYVKG ++LR+AYTSLFEGF SI+ +Q L +G +E++R E S
Sbjct: 401 HVLGPNMNRQRPNCLNNDYVKGSKVLREAYTSLFEGFASIMNTQGNLLEGSSENLRSELS 460
Query: 491 VSQDHSEDVHGNYISTGD-KIKRDGGHEYEQSKKCKT-QNEVGTDINLSRAANLSADNEK 548
VSQDH + H + D KIKR G +E E SKKCK Q+E D S+ +NEK
Sbjct: 461 VSQDHFKGNHIKNVPNHDQKIKRVGVYESETSKKCKGFQDEHEFDCTESKEGKDKLNNEK 520
Query: 549 IGVSTSKAWGSWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGL 608
IG + +K WGSWAQ+LY AM+PE+HKD+L+EISDDVVVLNDLYPKAQ+H+LVL+R +GL
Sbjct: 521 IGRNMTKTWGSWAQSLYHIAMHPEKHKDNLIEISDDVVVLNDLYPKAQRHLLVLARSEGL 580
Query: 609 DRLADVRNEHLQILQTMHAVGMKWAEKFLHEDASLAFRLGYHSAPSMRQLHLHVISQDFN 668
D LADV EHLQ+L+TMHAVG+KWAEKFL ED L FR+GYHSAPSMRQLHLHVISQDFN
Sbjct: 581 DCLADVGGEHLQLLRTMHAVGLKWAEKFLCEDELLVFRIGYHSAPSMRQLHLHVISQDFN 640
Query: 669 SKHLKNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRCHRCRSAHPSIP 728
SKHLKNKKHWNSFN+AFF DSVDV+EEI+NHG+AT+K DS LSMELRCHRCRSAHP++P
Sbjct: 641 SKHLKNKKHWNSFNSAFFRDSVDVIEEITNHGRATIKGEDSQLSMELRCHRCRSAHPNMP 700
Query: 729 RLKSHISSCRAPFPSSLLENGRLMLAP 755
RLKSHIS+C+A FP SLL+N RL+LAP
Sbjct: 701 RLKSHISNCQASFPPSLLQNDRLVLAP 727
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224140455|ref|XP_002323598.1| predicted protein [Populus trichocarpa] gi|222868228|gb|EEF05359.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255579308|ref|XP_002530499.1| aprataxin, putative [Ricinus communis] gi|223529956|gb|EEF31883.1| aprataxin, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356496191|ref|XP_003516953.1| PREDICTED: transcription factor bHLH140-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296081123|emb|CBI18255.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147867251|emb|CAN83280.1| hypothetical protein VITISV_005888 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449440255|ref|XP_004137900.1| PREDICTED: transcription factor bHLH140-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449483719|ref|XP_004156669.1| PREDICTED: transcription factor bHLH140-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|15240948|ref|NP_195751.1| aprataxin [Arabidopsis thaliana] gi|75335734|sp|Q9M041.1|BH140_ARATH RecName: Full=Transcription factor bHLH140; AltName: Full=Basic helix-loop-helix protein 140; Short=AtbHLH140; Short=bHLH 140; AltName: Full=Transcription factor EN 122; AltName: Full=bHLH transcription factor bHLH140 gi|7320709|emb|CAB81914.1| putative protein [Arabidopsis thaliana] gi|332002943|gb|AED90326.1| aprataxin [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297810265|ref|XP_002873016.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. lyrata] gi|297318853|gb|EFH49275.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 761 | ||||||
| TAIR|locus:2179122 | 912 | APTX "APRATAXIN-like" [Arabido | 0.325 | 0.271 | 0.648 | 2e-230 | |
| MGI|MGI:1913658 | 342 | Aptx "aprataxin" [Mus musculus | 0.244 | 0.543 | 0.451 | 3.8e-39 | |
| UNIPROTKB|F1SE72 | 342 | APTX "Aprataxin" [Sus scrofa ( | 0.307 | 0.684 | 0.4 | 9.8e-38 | |
| RGD|628740 | 329 | Aptx "aprataxin" [Rattus norve | 0.265 | 0.613 | 0.432 | 1.3e-37 | |
| UNIPROTKB|F1LMH1 | 331 | Aptx "Aprataxin" [Rattus norve | 0.265 | 0.610 | 0.432 | 1.3e-37 | |
| UNIPROTKB|Q8K4H4 | 329 | Aptx "Aprataxin" [Rattus norve | 0.265 | 0.613 | 0.432 | 1.3e-37 | |
| UNIPROTKB|P61797 | 342 | APTX "Aprataxin" [Canis lupus | 0.278 | 0.619 | 0.417 | 1.6e-37 | |
| UNIPROTKB|F1PHH9 | 352 | APTX "Aprataxin" [Canis lupus | 0.278 | 0.602 | 0.417 | 2.7e-37 | |
| UNIPROTKB|J9P6H4 | 342 | APTX "Aprataxin" [Canis lupus | 0.278 | 0.619 | 0.417 | 2.7e-37 | |
| UNIPROTKB|Q7YRZ1 | 356 | APTX "Aprataxin" [Sus scrofa ( | 0.307 | 0.657 | 0.395 | 3.4e-37 |
| TAIR|locus:2179122 APTX "APRATAXIN-like" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 799 (286.3 bits), Expect = 2.0e-230, Sum P(3) = 2.0e-230
Identities = 164/253 (64%), Positives = 196/253 (77%)
Query: 259 TENPEVASVNQNGSSSDVPTLAFPSLSTSDFQFNNEKASDVIIEKVEEFVNKLGNARLVL 318
T N V+ V GS+ VPTLAFPS+ST+DFQF+ EKASD+I+EK EEF++KLG ARLVL
Sbjct: 439 TANVRVSPVKL-GSADIVPTLAFPSISTADFQFDLEKASDIIVEKAEEFLSKLGTARLVL 497
Query: 319 VDLTQGSKILSLVRAKAAQKHINPKKFFTFVGDITRLYTGGGLCCNVIANAANWRLKPGG 378
VDL++GSKILSLV+AKA+QK+I+ KFFTFVGDIT+L + GGL CNVIANA NWRLKPGG
Sbjct: 498 VDLSRGSKILSLVKAKASQKNIDSAKFFTFVGDITKLRSEGGLHCNVIANATNWRLKPGG 557
Query: 379 GGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVIHVLGPNMN 438
GGVNAAIF AAGP LE AT RA +L PG +V+VPLPST PL EG+THVIHVLGPNMN
Sbjct: 558 GGVNAAIFKAAGPDLETATRVRANTLLPGKAVVVPLPSTCPLHNAEGITHVIHVLGPNMN 617
Query: 439 PRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEKLSKGCNEDIRLEPSVSQDHSED 498
P RP+ L+ DY KGC+ LR+AYTSLFEGFLS+V+ Q KL K ++ + S +D ED
Sbjct: 618 PNRPDNLNNDYTKGCKTLREAYTSLFEGFLSVVQDQSKLPKRSSQTA-VSDS-GEDIKED 675
Query: 499 VHGN--YISTGDK 509
N Y + DK
Sbjct: 676 SERNKKYKGSQDK 688
|
|
| MGI|MGI:1913658 Aptx "aprataxin" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SE72 APTX "Aprataxin" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|628740 Aptx "aprataxin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LMH1 Aptx "Aprataxin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8K4H4 Aptx "Aprataxin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P61797 APTX "Aprataxin" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PHH9 APTX "Aprataxin" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P6H4 APTX "Aprataxin" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7YRZ1 APTX "Aprataxin" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 761 | |||
| pfam13671 | 143 | pfam13671, AAA_33, AAA domain | 1e-27 | |
| pfam11969 | 113 | pfam11969, DcpS_C, Scavenger mRNA decapping enzyme | 1e-24 | |
| cd01278 | 104 | cd01278, aprataxin_related, aprataxin related: Apr | 1e-16 | |
| cd02908 | 165 | cd02908, Macro_Appr_pase_like, Macro domain, Appr- | 2e-11 | |
| TIGR01663 | 526 | TIGR01663, PNK-3'Pase, polynucleotide 5'-kinase 3' | 6e-10 | |
| smart00506 | 133 | smart00506, A1pp, Appr-1"-p processing enzyme | 1e-09 | |
| pfam01661 | 117 | pfam01661, Macro, Macro domain | 2e-09 | |
| COG2110 | 179 | COG2110, COG2110, Predicted phosphatase homologous | 3e-09 | |
| COG4639 | 168 | COG4639, COG4639, Predicted kinase [General functi | 2e-08 | |
| PRK00431 | 177 | PRK00431, PRK00431, RNase III inhibitor; Provision | 3e-08 | |
| TIGR04075 | 851 | TIGR04075, bacter_Pnkp, polynucleotide kinase-phos | 7e-08 | |
| cd02907 | 175 | cd02907, Macro_Af1521_BAL_like, Macro domain, Af15 | 1e-07 | |
| cd02749 | 147 | cd02749, Macro, Macro domain, a high-affinity ADP- | 3e-07 | |
| cd02903 | 137 | cd02903, Macro_BAL_like, Macro domain, BAL_like fa | 9e-07 | |
| pfam01230 | 97 | pfam01230, HIT, HIT domain | 6e-06 | |
| cd01276 | 104 | cd01276, PKCI_related, Protein Kinase C Interactin | 0.004 |
| >gnl|CDD|222307 pfam13671, AAA_33, AAA domain | Back alignment and domain information |
|---|
Score = 108 bits (272), Expect = 1e-27
Identities = 45/146 (30%), Positives = 65/146 (44%), Gaps = 19/146 (13%)
Query: 22 LVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKV---------------Q 66
L++MVG PGSGKSTF ++R + DT+ K G +
Sbjct: 1 LILMVGLPGSGKSTFARRLLR--ELGAVVLSSDTLRKRLRGDGPPDISYYARASGRVYQR 58
Query: 67 CLTSASSALKKGKSVFLDRCNLEREQRTDFVKLG-GPEVDVHAVVLDLPAKLCISRSVKR 125
L A AL+ G+ V +D NL RE+R + L V V L+ P ++ R+ +R
Sbjct: 59 LLELAREALRAGRPVIVDATNLSREERARLIDLARRYGAPVRIVYLEAPEEVLRERNAQR 118
Query: 126 IEHEGNLQGGKAAAVVNRMLQKKELP 151
E G AV++RML + E P
Sbjct: 119 -ERSGGDPSDVPEAVLDRMLARFEPP 143
|
This family of domains contain only a P-loop motif, that is characteristic of the AAA superfamily. Many of the proteins in this family are just short fragments so there is no Walker B motif. Length = 143 |
| >gnl|CDD|221348 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme C-term binding | Back alignment and domain information |
|---|
| >gnl|CDD|238609 cd01278, aprataxin_related, aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome | Back alignment and domain information |
|---|
| >gnl|CDD|239236 cd02908, Macro_Appr_pase_like, Macro domain, Appr-1"-pase_like family | Back alignment and domain information |
|---|
| >gnl|CDD|130724 TIGR01663, PNK-3'Pase, polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|214701 smart00506, A1pp, Appr-1"-p processing enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|216634 pfam01661, Macro, Macro domain | Back alignment and domain information |
|---|
| >gnl|CDD|225021 COG2110, COG2110, Predicted phosphatase homologous to the C-terminal domain of histone macroH2A1 [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|226986 COG4639, COG4639, Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234759 PRK00431, PRK00431, RNase III inhibitor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234457 TIGR04075, bacter_Pnkp, polynucleotide kinase-phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|239235 cd02907, Macro_Af1521_BAL_like, Macro domain, Af1521- and BAL-like family | Back alignment and domain information |
|---|
| >gnl|CDD|239150 cd02749, Macro, Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases) | Back alignment and domain information |
|---|
| >gnl|CDD|239231 cd02903, Macro_BAL_like, Macro domain, BAL_like family | Back alignment and domain information |
|---|
| >gnl|CDD|216377 pfam01230, HIT, HIT domain | Back alignment and domain information |
|---|
| >gnl|CDD|238607 cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 761 | |||
| KOG0562 | 184 | consensus Predicted hydrolase (HIT family) [Genera | 100.0 | |
| cd02905 | 140 | Macro_GDAP2_like Macro domain, GDAP2_like family. | 99.95 | |
| cd02904 | 186 | Macro_H2A_like Macro domain, Macro_H2A_like family | 99.94 | |
| PF11969 | 116 | DcpS_C: Scavenger mRNA decapping enzyme C-term bin | 99.94 | |
| PRK04143 | 264 | hypothetical protein; Provisional | 99.92 | |
| cd02906 | 147 | Macro_1 Macro domain, Unknown family 1. The macro | 99.91 | |
| cd02908 | 165 | Macro_Appr_pase_like Macro domain, Appr-1"-pase_li | 99.9 | |
| cd02907 | 175 | Macro_Af1521_BAL_like Macro domain, Af1521- and BA | 99.89 | |
| PRK00431 | 177 | RNase III inhibitor; Provisional | 99.88 | |
| cd02903 | 137 | Macro_BAL_like Macro domain, BAL_like family. The | 99.88 | |
| COG2110 | 179 | Predicted phosphatase homologous to the C-terminal | 99.87 | |
| KOG4359 | 166 | consensus Protein kinase C inhibitor-like protein | 99.84 | |
| cd03330 | 133 | Macro_2 Macro domain, Unknown family 2. The macro | 99.83 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 99.79 | |
| COG4639 | 168 | Predicted kinase [General function prediction only | 99.74 | |
| KOG3275 | 127 | consensus Zinc-binding protein of the histidine tr | 99.74 | |
| PRK10687 | 119 | purine nucleoside phosphoramidase; Provisional | 99.73 | |
| cd01278 | 104 | aprataxin_related aprataxin related: Aprataxin, a | 99.72 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 99.71 | |
| smart00506 | 133 | A1pp Appr-1"-p processing enzyme. Function determi | 99.71 | |
| cd02749 | 147 | Macro Macro domain, a high-affinity ADP-ribose bin | 99.7 | |
| cd01276 | 104 | PKCI_related Protein Kinase C Interacting protein | 99.67 | |
| COG0537 | 138 | Hit Diadenosine tetraphosphate (Ap4A) hydrolase an | 99.66 | |
| cd02900 | 186 | Macro_Appr_pase Macro domain, Appr-1"-pase family. | 99.66 | |
| KOG2633 | 200 | consensus Hismacro and SEC14 domain-containing pro | 99.64 | |
| PF01230 | 98 | HIT: HIT domain; InterPro: IPR001310 The Histidine | 99.62 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 99.61 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 99.6 | |
| PF01661 | 118 | Macro: Macro domain; InterPro: IPR002589 The Macro | 99.59 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 99.59 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 99.58 | |
| PF08433 | 270 | KTI12: Chromatin associated protein KTI12 ; InterP | 99.57 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 99.55 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 99.51 | |
| cd00468 | 86 | HIT_like HIT family: HIT (Histidine triad) protein | 99.49 | |
| TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 99.47 | |
| KOG3354 | 191 | consensus Gluconate kinase [Carbohydrate transport | 99.46 | |
| COG3265 | 161 | GntK Gluconate kinase [Carbohydrate transport and | 99.46 | |
| cd02904 | 186 | Macro_H2A_like Macro domain, Macro_H2A_like family | 99.44 | |
| cd01277 | 103 | HINT_subgroup HINT (histidine triad nucleotide-bin | 99.42 | |
| cd01275 | 126 | FHIT FHIT (fragile histidine family): FHIT protein | 99.41 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 99.37 | |
| PRK04143 | 264 | hypothetical protein; Provisional | 99.36 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 99.36 | |
| KOG3079 | 195 | consensus Uridylate kinase/adenylate kinase [Nucle | 99.35 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 99.34 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 99.31 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 99.3 | |
| COG0645 | 170 | Predicted kinase [General function prediction only | 99.29 | |
| cd02905 | 140 | Macro_GDAP2_like Macro domain, GDAP2_like family. | 99.28 | |
| cd02901 | 140 | Macro_Poa1p_like Macro domain, Poa1p_like family. | 99.27 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 99.26 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 99.22 | |
| PLN02674 | 244 | adenylate kinase | 99.21 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 99.21 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 99.2 | |
| PLN02200 | 234 | adenylate kinase family protein | 99.2 | |
| PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 99.19 | |
| PF08303 | 168 | tRNA_lig_kinase: tRNA ligase kinase domain; InterP | 99.19 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 99.19 | |
| PRK11545 | 163 | gntK gluconate kinase 1; Provisional | 99.18 | |
| PRK13808 | 333 | adenylate kinase; Provisional | 99.15 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 99.15 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 99.14 | |
| KOG2134 | 422 | consensus Polynucleotide kinase 3' phosphatase [Re | 99.14 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 99.14 | |
| TIGR00209 | 347 | galT_1 galactose-1-phosphate uridylyltransferase, | 99.13 | |
| KOG3379 | 150 | consensus Diadenosine polyphosphate hydrolase and | 99.13 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 99.11 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 99.11 | |
| PRK11720 | 346 | galactose-1-phosphate uridylyltransferase; Provisi | 99.1 | |
| cd02906 | 147 | Macro_1 Macro domain, Unknown family 1. The macro | 99.09 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 99.09 | |
| cd02908 | 165 | Macro_Appr_pase_like Macro domain, Appr-1"-pase_li | 99.08 | |
| PRK06217 | 183 | hypothetical protein; Validated | 99.08 | |
| PLN02459 | 261 | probable adenylate kinase | 99.07 | |
| PF01583 | 156 | APS_kinase: Adenylylsulphate kinase; InterPro: IPR | 99.06 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 99.04 | |
| cd02907 | 175 | Macro_Af1521_BAL_like Macro domain, Af1521- and BA | 99.03 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 99.03 | |
| cd02903 | 137 | Macro_BAL_like Macro domain, BAL_like family. The | 99.02 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 99.01 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 99.0 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 99.0 | |
| KOG3062 | 281 | consensus RNA polymerase II elongator associated p | 98.98 | |
| KOG2134 | 422 | consensus Polynucleotide kinase 3' phosphatase [Re | 98.97 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 98.97 | |
| TIGR00455 | 184 | apsK adenylylsulfate kinase (apsK). Important resi | 98.96 | |
| cd00608 | 329 | GalT Galactose-1-phosphate uridyl transferase (Gal | 98.94 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 98.94 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 98.91 | |
| COG0529 | 197 | CysC Adenylylsulfate kinase and related kinases [I | 98.9 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 98.9 | |
| PRK00431 | 177 | RNase III inhibitor; Provisional | 98.9 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 98.86 | |
| PRK06547 | 172 | hypothetical protein; Provisional | 98.85 | |
| PRK13946 | 184 | shikimate kinase; Provisional | 98.84 | |
| PF01591 | 222 | 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 | 98.84 | |
| KOG3969 | 310 | consensus Uncharacterized conserved protein [Funct | 98.84 | |
| PLN02643 | 336 | ADP-glucose phosphorylase | 98.83 | |
| PRK13948 | 182 | shikimate kinase; Provisional | 98.82 | |
| PRK03846 | 198 | adenylylsulfate kinase; Provisional | 98.81 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 98.8 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 98.8 | |
| PLN02842 | 505 | nucleotide kinase | 98.8 | |
| KOG4622 | 291 | consensus Predicted nucleotide kinase [General fun | 98.79 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 98.79 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 98.78 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 98.77 | |
| PRK13947 | 171 | shikimate kinase; Provisional | 98.77 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 98.77 | |
| PF07931 | 174 | CPT: Chloramphenicol phosphotransferase-like prote | 98.75 | |
| PRK05537 | 568 | bifunctional sulfate adenylyltransferase subunit 1 | 98.74 | |
| PRK05506 | 632 | bifunctional sulfate adenylyltransferase subunit 1 | 98.73 | |
| PRK03839 | 180 | putative kinase; Provisional | 98.72 | |
| cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 98.71 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 98.71 | |
| PRK05480 | 209 | uridine/cytidine kinase; Provisional | 98.7 | |
| PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 98.7 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 98.69 | |
| PRK06696 | 223 | uridine kinase; Validated | 98.69 | |
| COG4185 | 187 | Uncharacterized protein conserved in bacteria [Fun | 98.69 | |
| PRK08356 | 195 | hypothetical protein; Provisional | 98.68 | |
| COG2110 | 179 | Predicted phosphatase homologous to the C-terminal | 98.66 | |
| PRK12339 | 197 | 2-phosphoglycerate kinase; Provisional | 98.64 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 98.63 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 98.62 | |
| cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 98.61 | |
| PTZ00301 | 210 | uridine kinase; Provisional | 98.61 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 98.59 | |
| PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 98.56 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 98.55 | |
| KOG3347 | 176 | consensus Predicted nucleotide kinase/nuclear prot | 98.55 | |
| PRK00300 | 205 | gmk guanylate kinase; Provisional | 98.54 | |
| COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 98.52 | |
| PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 98.51 | |
| KOG2633 | 200 | consensus Hismacro and SEC14 domain-containing pro | 98.5 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 98.5 | |
| COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 98.49 | |
| PRK04040 | 188 | adenylate kinase; Provisional | 98.49 | |
| PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 98.47 | |
| COG1936 | 180 | Predicted nucleotide kinase (related to CMP and AM | 98.47 | |
| PRK04182 | 180 | cytidylate kinase; Provisional | 98.46 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 98.44 | |
| TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 98.43 | |
| TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 98.43 | |
| cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 98.43 | |
| PRK07667 | 193 | uridine kinase; Provisional | 98.42 | |
| PRK13975 | 196 | thymidylate kinase; Provisional | 98.42 | |
| cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 98.42 | |
| PRK14021 | 542 | bifunctional shikimate kinase/3-dehydroquinate syn | 98.4 | |
| TIGR00152 | 188 | dephospho-CoA kinase. This model produces scores i | 98.39 | |
| cd03330 | 133 | Macro_2 Macro domain, Unknown family 2. The macro | 98.38 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 98.37 | |
| PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 98.37 | |
| PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 98.37 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 98.35 | |
| PLN02348 | 395 | phosphoribulokinase | 98.34 | |
| PHA02595 | 154 | tk.4 hypothetical protein; Provisional | 98.32 | |
| PRK14732 | 196 | coaE dephospho-CoA kinase; Provisional | 98.32 | |
| cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 98.31 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 98.29 | |
| cd01673 | 193 | dNK Deoxyribonucleoside kinase (dNK) catalyzes the | 98.29 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 98.28 | |
| PLN02422 | 232 | dephospho-CoA kinase | 98.27 | |
| PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 98.27 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 98.26 | |
| cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 98.25 | |
| KOG0635 | 207 | consensus Adenosine 5'-phosphosulfate kinase [Inor | 98.24 | |
| cd02030 | 219 | NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO | 98.23 | |
| PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 98.23 | |
| PRK12338 | 319 | hypothetical protein; Provisional | 98.23 | |
| PLN02924 | 220 | thymidylate kinase | 98.22 | |
| PRK14734 | 200 | coaE dephospho-CoA kinase; Provisional | 98.18 | |
| PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 98.18 | |
| PLN02199 | 303 | shikimate kinase | 98.17 | |
| PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 98.16 | |
| PF01202 | 158 | SKI: Shikimate kinase; InterPro: IPR000623 Shikima | 98.16 | |
| PTZ00451 | 244 | dephospho-CoA kinase; Provisional | 98.15 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 98.14 | |
| COG3709 | 192 | Uncharacterized component of phosphonate metabolis | 98.11 | |
| PRK07429 | 327 | phosphoribulokinase; Provisional | 98.1 | |
| PLN02772 | 398 | guanylate kinase | 98.09 | |
| PRK15453 | 290 | phosphoribulokinase; Provisional | 98.07 | |
| PRK05439 | 311 | pantothenate kinase; Provisional | 98.06 | |
| KOG3078 | 235 | consensus Adenylate kinase [Nucleotide transport a | 98.04 | |
| COG5075 | 305 | Uncharacterized conserved protein [Function unknow | 98.03 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 98.02 | |
| PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 97.99 | |
| PF01121 | 180 | CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th | 97.96 | |
| cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 97.93 | |
| PRK13951 | 488 | bifunctional shikimate kinase/3-dehydroquinate syn | 97.93 | |
| PF01661 | 118 | Macro: Macro domain; InterPro: IPR002589 The Macro | 97.91 | |
| cd02900 | 186 | Macro_Appr_pase Macro domain, Appr-1"-pase family. | 97.9 | |
| PRK06761 | 282 | hypothetical protein; Provisional | 97.89 | |
| cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 97.87 | |
| TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 97.87 | |
| PLN02318 | 656 | phosphoribulokinase/uridine kinase | 97.84 | |
| cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 97.84 | |
| PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 97.81 | |
| cd02749 | 147 | Macro Macro domain, a high-affinity ADP-ribose bin | 97.79 | |
| PRK07933 | 213 | thymidylate kinase; Validated | 97.78 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 97.77 | |
| COG1428 | 216 | Deoxynucleoside kinases [Nucleotide transport and | 97.76 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.76 | |
| TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 97.74 | |
| COG0237 | 201 | CoaE Dephospho-CoA kinase [Coenzyme metabolism] | 97.72 | |
| PF02223 | 186 | Thymidylate_kin: Thymidylate kinase; InterPro: IPR | 97.71 | |
| PRK03333 | 395 | coaE dephospho-CoA kinase/protein folding accessor | 97.69 | |
| PRK13974 | 212 | thymidylate kinase; Provisional | 97.69 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 97.67 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 97.59 | |
| PLN02165 | 334 | adenylate isopentenyltransferase | 97.58 | |
| COG0125 | 208 | Tmk Thymidylate kinase [Nucleotide transport and m | 97.53 | |
| KOG3877 | 393 | consensus NADH:ubiquinone oxidoreductase, NDUFA10/ | 97.53 | |
| PF03668 | 284 | ATP_bind_2: P-loop ATPase protein family; InterPro | 97.5 | |
| smart00506 | 133 | A1pp Appr-1"-p processing enzyme. Function determi | 97.49 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 97.48 | |
| COG3896 | 205 | Chloramphenicol 3-O-phosphotransferase [Defense me | 97.38 | |
| PRK00023 | 225 | cmk cytidylate kinase; Provisional | 97.36 | |
| COG5324 | 758 | Uncharacterized conserved protein [Function unknow | 97.34 | |
| COG1085 | 338 | GalT Galactose-1-phosphate uridylyltransferase [En | 97.28 | |
| COG0283 | 222 | Cmk Cytidylate kinase [Nucleotide transport and me | 97.26 | |
| PLN02748 | 468 | tRNA dimethylallyltransferase | 97.21 | |
| COG1072 | 283 | CoaA Panthothenate kinase [Coenzyme metabolism] | 97.2 | |
| cd02901 | 140 | Macro_Poa1p_like Macro domain, Poa1p_like family. | 97.18 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 97.17 | |
| COG2019 | 189 | AdkA Archaeal adenylate kinase [Nucleotide transpo | 97.17 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 97.15 | |
| PRK13976 | 209 | thymidylate kinase; Provisional | 97.12 | |
| PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 97.1 | |
| KOG3308 | 225 | consensus Uncharacterized protein of the uridine k | 97.09 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.08 | |
| KOG3220 | 225 | consensus Similar to bacterial dephospho-CoA kinas | 97.05 | |
| COG2074 | 299 | 2-phosphoglycerate kinase [Carbohydrate transport | 97.04 | |
| KOG4238 | 627 | consensus Bifunctional ATP sulfurylase/adenosine 5 | 97.03 | |
| KOG1384 | 348 | consensus tRNA delta(2)-isopentenylpyrophosphate t | 97.0 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 96.97 | |
| PRK09087 | 226 | hypothetical protein; Validated | 96.95 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 96.86 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.86 | |
| COG1660 | 286 | Predicted P-loop-containing kinase [General functi | 96.85 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.85 | |
| PF02744 | 166 | GalP_UDP_tr_C: Galactose-1-phosphate uridyl transf | 96.84 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.79 | |
| COG0541 | 451 | Ffh Signal recognition particle GTPase [Intracellu | 96.79 | |
| PRK11860 | 661 | bifunctional 3-phosphoshikimate 1-carboxyvinyltran | 96.77 | |
| KOG1969 | 877 | consensus DNA replication checkpoint protein CHL12 | 96.75 | |
| PF04677 | 121 | CwfJ_C_1: Protein similar to CwfJ C-terminus 1; In | 96.74 | |
| KOG0744 | 423 | consensus AAA+-type ATPase [Posttranslational modi | 96.68 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 96.66 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 96.65 | |
| KOG0707 | 231 | consensus Guanylate kinase [Nucleotide transport a | 96.65 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 96.64 | |
| PF13173 | 128 | AAA_14: AAA domain | 96.64 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 96.6 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.56 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 96.53 | |
| PLN02840 | 421 | tRNA dimethylallyltransferase | 96.53 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 96.53 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 96.52 | |
| PF14519 | 280 | Macro_2: Macro-like domain; PDB: 1TXZ_A 1TY8_A 1NJ | 96.49 | |
| KOG0738 | 491 | consensus AAA+-type ATPase [Posttranslational modi | 96.47 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 96.46 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.46 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 96.46 | |
| KOG0234 | 438 | consensus Fructose-6-phosphate 2-kinase/fructose-2 | 96.44 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 96.44 | |
| KOG2720 | 431 | consensus Predicted hydrolase (HIT family) [Genera | 96.43 | |
| PHA03132 | 580 | thymidine kinase; Provisional | 96.42 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 96.42 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 96.4 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.4 | |
| PRK06620 | 214 | hypothetical protein; Validated | 96.35 | |
| KOG2958 | 354 | consensus Galactose-1-phosphate uridylyltransferas | 96.34 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 96.34 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 96.33 | |
| KOG0739 | 439 | consensus AAA+-type ATPase [Posttranslational modi | 96.32 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 96.31 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 96.3 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 96.29 | |
| KOG2702 | 323 | consensus Predicted panthothenate kinase/uridine k | 96.22 | |
| KOG0733 | 802 | consensus Nuclear AAA ATPase (VCP subfamily) [Post | 96.2 | |
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 96.2 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 96.18 | |
| PRK12377 | 248 | putative replication protein; Provisional | 96.17 | |
| KOG0780 | 483 | consensus Signal recognition particle, subunit Srp | 96.14 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 96.12 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.09 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 96.09 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.08 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 96.05 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.05 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 96.04 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 96.0 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 95.99 | |
| TIGR00174 | 287 | miaA tRNA isopentenyltransferase (miaA). Catalyzes | 95.97 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 95.91 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 95.88 | |
| PHA02244 | 383 | ATPase-like protein | 95.85 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 95.84 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.84 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 95.82 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 95.81 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 95.81 | |
| PRK08116 | 268 | hypothetical protein; Validated | 95.8 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 95.77 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 95.73 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 95.73 | |
| PLN03103 | 403 | GDP-L-galactose-hexose-1-phosphate guanyltransfera | 95.72 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 95.66 | |
| PRK08727 | 233 | hypothetical protein; Validated | 95.66 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 95.63 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 95.61 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 95.59 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 95.58 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 95.56 | |
| KOG1533 | 290 | consensus Predicted GTPase [General function predi | 95.55 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 95.54 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 95.54 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.49 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 95.48 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 95.48 | |
| PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 95.46 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 95.45 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 95.37 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 95.37 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 95.36 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 95.36 | |
| PLN02796 | 347 | D-glycerate 3-kinase | 95.32 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 95.32 | |
| KOG0730 | 693 | consensus AAA+-type ATPase [Posttranslational modi | 95.3 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 95.27 | |
| cd03331 | 152 | Macro_Poa1p_like_SNF2 Macro domain, Poa1p_like fam | 95.27 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 95.27 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 95.25 | |
| cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 95.25 | |
| KOG4235 | 244 | consensus Mitochondrial thymidine kinase 2/deoxygu | 95.24 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 95.2 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 95.18 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 95.16 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 95.12 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 95.11 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 95.11 | |
| PF13521 | 163 | AAA_28: AAA domain; PDB: 1LW7_A. | 95.03 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 95.01 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 94.99 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 94.98 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 94.98 | |
| PF05729 | 166 | NACHT: NACHT domain | 94.96 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 94.95 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 94.94 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.94 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 94.92 | |
| COG0324 | 308 | MiaA tRNA delta(2)-isopentenylpyrophosphate transf | 94.91 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 94.9 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 94.88 | |
| PRK08181 | 269 | transposase; Validated | 94.88 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 94.87 | |
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 94.86 | |
| KOG0741 | 744 | consensus AAA+-type ATPase [Posttranslational modi | 94.85 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 94.85 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 94.84 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 94.84 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 94.84 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 94.83 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 94.82 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 94.81 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 94.8 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 94.79 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 94.77 | |
| cd04163 | 168 | Era Era subfamily. Era (E. coli Ras-like protein) | 94.77 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 94.76 | |
| cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 94.75 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 94.75 | |
| KOG1532 | 366 | consensus GTPase XAB1, interacts with DNA repair p | 94.7 | |
| cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 94.68 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 94.68 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 94.66 | |
| PRK06526 | 254 | transposase; Provisional | 94.65 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 94.65 | |
| PF02367 | 123 | UPF0079: Uncharacterised P-loop hydrolase UPF0079; | 94.65 | |
| KOG0651 | 388 | consensus 26S proteasome regulatory complex, ATPas | 94.64 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 94.63 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 94.63 | |
| COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 94.63 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 94.62 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 94.62 | |
| PF13189 | 179 | Cytidylate_kin2: Cytidylate kinase-like family; PD | 94.6 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 94.6 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 94.58 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 94.58 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 94.56 | |
| KOG0731 | 774 | consensus AAA+-type ATPase containing the peptidas | 94.55 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 94.51 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 94.5 | |
| PF13191 | 185 | AAA_16: AAA ATPase domain; PDB: 2V1U_A. | 94.5 | |
| KOG0734 | 752 | consensus AAA+-type ATPase containing the peptidas | 94.48 | |
| PRK08099 | 399 | bifunctional DNA-binding transcriptional repressor | 94.45 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.42 | |
| COG5192 | 1077 | BMS1 GTP-binding protein required for 40S ribosome | 94.41 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 94.37 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 94.37 | |
| PRK14729 | 300 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 94.34 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 94.34 | |
| PTZ00202 | 550 | tuzin; Provisional | 94.33 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 94.32 | |
| COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 94.32 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 94.28 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 94.26 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 94.25 | |
| cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 94.24 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 94.23 | |
| cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 94.22 | |
| KOG0737 | 386 | consensus AAA+-type ATPase [Posttranslational modi | 94.2 | |
| TIGR03707 | 230 | PPK2_P_aer polyphosphate kinase 2, PA0141 family. | 94.17 | |
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.13 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 94.12 | |
| TIGR00101 | 199 | ureG urease accessory protein UreG. This model rep | 94.1 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 94.1 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 94.09 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 94.08 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 94.07 | |
| PRK09169 | 2316 | hypothetical protein; Validated | 94.04 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 94.02 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 94.0 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.0 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 93.98 | |
| COG4240 | 300 | Predicted kinase [General function prediction only | 93.98 | |
| PF08477 | 119 | Miro: Miro-like protein; InterPro: IPR013684 Mitoc | 93.98 | |
| KOG0735 | 952 | consensus AAA+-type ATPase [Posttranslational modi | 93.95 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 93.92 | |
| PRK13768 | 253 | GTPase; Provisional | 93.91 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 93.9 | |
| TIGR00672 | 250 | cdh CDP-diacylglycerol pyrophosphatase, bacterial | 93.89 | |
| KOG2004 | 906 | consensus Mitochondrial ATP-dependent protease PIM | 93.88 | |
| cd01918 | 149 | HprK_C HprK/P, the bifunctional histidine-containi | 93.85 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 93.84 | |
| PRK05471 | 252 | CDP-diacylglycerol pyrophosphatase; Provisional | 93.8 | |
| COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 93.79 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 93.77 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 93.7 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 93.66 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 93.66 | |
| PF13479 | 213 | AAA_24: AAA domain | 93.65 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 93.63 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 93.6 | |
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 93.6 | |
| PRK12269 | 863 | bifunctional cytidylate kinase/ribosomal protein S | 93.57 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 93.54 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 93.53 | |
| PF02611 | 222 | CDH: CDP-diacylglycerol pyrophosphatase; InterPro: | 93.53 | |
| PF01926 | 116 | MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I | 93.47 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 93.46 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 93.46 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 93.45 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 93.45 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 93.44 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 93.43 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 93.42 | |
| TIGR03709 | 264 | PPK2_rel_1 polyphosphate:nucleotide phosphotransfe | 93.38 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 93.38 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 93.37 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 93.37 | |
| PRK10463 | 290 | hydrogenase nickel incorporation protein HypB; Pro | 93.34 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 93.33 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 93.29 | |
| KOG1534 | 273 | consensus Putative transcription factor FET5 [Tran | 93.27 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 93.25 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 93.23 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 93.22 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 93.18 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 93.15 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 93.15 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 93.14 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 93.11 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 93.09 | |
| PRK00089 | 292 | era GTPase Era; Reviewed | 93.02 | |
| KOG0727 | 408 | consensus 26S proteasome regulatory complex, ATPas | 93.01 | |
| TIGR03708 | 493 | poly_P_AMP_trns polyphosphate:AMP phosphotransfera | 92.99 | |
| PRK15455 | 644 | PrkA family serine protein kinase; Provisional | 92.96 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 92.92 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 92.83 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 92.82 | |
| TIGR01526 | 325 | nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr | 92.82 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 92.8 | |
| KOG0742 | 630 | consensus AAA+-type ATPase [Posttranslational modi | 92.79 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 92.78 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 92.76 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 92.74 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 92.73 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 92.73 | |
| PRK14490 | 369 | putative bifunctional molybdopterin-guanine dinucl | 92.72 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 92.71 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 92.67 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 92.66 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 92.64 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 92.59 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 92.52 | |
| PRK10646 | 153 | ADP-binding protein; Provisional | 92.49 |
| >KOG0562 consensus Predicted hydrolase (HIT family) [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-47 Score=359.59 Aligned_cols=181 Identities=46% Similarity=0.754 Sum_probs=162.1
Q ss_pred hhHHHHHhhhcCCCCCCCcEEEEc-CcEEEEecCCCCCCceEEEEeCCCCCCChhcCCHHHHHHHHHHHHHHHHHHHHhh
Q 004319 559 SWAQALYRTAMYPERHKDDLLEIS-DDVVVLNDLYPKAQKHILVLSRFDGLDRLADVRNEHLQILQTMHAVGMKWAEKFL 637 (761)
Q Consensus 559 ~w~~~L~~~~~~Pe~~p~~vvyed-d~~vai~D~~Pka~~H~LVIPk~~hi~~l~dl~~e~l~lL~~m~~~~~~~~~~~~ 637 (761)
+|+.++..++..||. |+.+. |++|+|+|.||||+.|+||+||...|+++.++..+++.+|.+|..++..|.....
T Consensus 2 sw~~~i~~~i~k~e~----V~~es~d~vvvIrD~fPKa~~H~LvLpr~s~i~~l~~~~qe~l~ll~~~h~~~~~~v~~~~ 77 (184)
T KOG0562|consen 2 SWHEAIVMDIPKPEN----VYIESPDDVVVIRDKFPKARMHLLVLPRRSSIDSLFSVVQEHLSLLKEDHAVGPCWVDQLT 77 (184)
T ss_pred chhhhhhhcCCccce----eeccCcccEEEEcccCccceeEEEEecccchhHHHHHHHHHHhhHhHHHhhcCchHHHHhc
Confidence 688777766666665 55555 7999999999999999999997678999999999999999999999999998876
Q ss_pred ccCCceeeeecccCCCcccceeeeeecCCcccccccccccccccCcccccCHHHHHHHHHhcCCCCccchhhhccCCccc
Q 004319 638 HEDASLAFRLGYHSAPSMRQLHLHVISQDFNSKHLKNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRC 717 (761)
Q Consensus 638 ~~~~~~~~~~G~ha~pSv~HLHlHVIs~d~~s~~lk~kkH~nsF~t~fFv~~~~v~~~l~~~g~~~~~~~~~~l~~~l~C 717 (761)
.++....|++||||+|||.||||||||+||+|++||||||||||||+||++++++.+++.+.|+.+..... ||+.||+|
T Consensus 78 ~~~~~~~f~vG~HavPSM~~LHLHVISkDf~S~sLKNKKHwnSFnT~fFv~~~~~~~~~~~~G~~t~~~~~-llk~dLrC 156 (184)
T KOG0562|consen 78 NEALCNYFRVGFHAVPSMNNLHLHVISKDFVSPSLKNKKHWNSFNTEFFVKSDDVTENVPTRGTATVLFTT-LLKEDLRC 156 (184)
T ss_pred chhhhhheeeeeccCcchhheeEEEeecccCCchhccchhhcccCccceeeccchhhhhhccccchhhhhh-hhccceee
Confidence 66666789999999999999999999999999999999999999999999999999999999998765544 99999999
Q ss_pred ccCCCCCCChHHHHHHHhhcCCCCCcc
Q 004319 718 HRCRSAHPSIPRLKSHISSCRAPFPSS 744 (761)
Q Consensus 718 ~~C~~~~~n~~~LK~Hl~~~~~~~~~~ 744 (761)
|||+..-++||+||+||+.|-..+|.+
T Consensus 157 ~~Cq~~~~~~~kLK~Hl~~~~~q~~d~ 183 (184)
T KOG0562|consen 157 WRCQTFGPHFPKLKAHLREEYDQWLDK 183 (184)
T ss_pred hhhhhcccccHHHHHHHHHHHhhcccc
Confidence 999943356999999999999888865
|
|
| >cd02905 Macro_GDAP2_like Macro domain, GDAP2_like family | Back alignment and domain information |
|---|
| >cd02904 Macro_H2A_like Macro domain, Macro_H2A_like family | Back alignment and domain information |
|---|
| >PF11969 DcpS_C: Scavenger mRNA decapping enzyme C-term binding; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B 1XQU_B | Back alignment and domain information |
|---|
| >PRK04143 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02906 Macro_1 Macro domain, Unknown family 1 | Back alignment and domain information |
|---|
| >cd02908 Macro_Appr_pase_like Macro domain, Appr-1"-pase_like family | Back alignment and domain information |
|---|
| >cd02907 Macro_Af1521_BAL_like Macro domain, Af1521- and BAL-like family | Back alignment and domain information |
|---|
| >PRK00431 RNase III inhibitor; Provisional | Back alignment and domain information |
|---|
| >cd02903 Macro_BAL_like Macro domain, BAL_like family | Back alignment and domain information |
|---|
| >COG2110 Predicted phosphatase homologous to the C-terminal domain of histone macroH2A1 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4359 consensus Protein kinase C inhibitor-like protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd03330 Macro_2 Macro domain, Unknown family 2 | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >COG4639 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3275 consensus Zinc-binding protein of the histidine triad (HIT) family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10687 purine nucleoside phosphoramidase; Provisional | Back alignment and domain information |
|---|
| >cd01278 aprataxin_related aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >smart00506 A1pp Appr-1"-p processing enzyme | Back alignment and domain information |
|---|
| >cd02749 Macro Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases) | Back alignment and domain information |
|---|
| >cd01276 PKCI_related Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides | Back alignment and domain information |
|---|
| >COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >cd02900 Macro_Appr_pase Macro domain, Appr-1"-pase family | Back alignment and domain information |
|---|
| >KOG2633 consensus Hismacro and SEC14 domain-containing proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >PF01230 HIT: HIT domain; InterPro: IPR001310 The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [] | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01661 Macro: Macro domain; InterPro: IPR002589 The Macro or A1pp domain is a module of about 180 amino acids which can bind ADP-ribose, an NAD metabolite or related ligands | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides | Back alignment and domain information |
|---|
| >TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
|---|
| >KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd02904 Macro_H2A_like Macro domain, Macro_H2A_like family | Back alignment and domain information |
|---|
| >cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides | Back alignment and domain information |
|---|
| >cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK04143 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG0645 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd02905 Macro_GDAP2_like Macro domain, GDAP2_like family | Back alignment and domain information |
|---|
| >cd02901 Macro_Poa1p_like Macro domain, Poa1p_like family | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
|---|
| >PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >PRK11545 gntK gluconate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 | Back alignment and domain information |
|---|
| >KOG3379 consensus Diadenosine polyphosphate hydrolase and related proteins of the histidine triad (HIT) family [Nucleotide transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11720 galactose-1-phosphate uridylyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd02906 Macro_1 Macro domain, Unknown family 1 | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >cd02908 Macro_Appr_pase_like Macro domain, Appr-1"-pase_like family | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02907 Macro_Af1521_BAL_like Macro domain, Af1521- and BAL-like family | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd02903 Macro_BAL_like Macro domain, BAL_like family | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00455 apsK adenylylsulfate kinase (apsK) | Back alignment and domain information |
|---|
| >cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00431 RNase III inhibitor; Provisional | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 | Back alignment and domain information |
|---|
| >KOG3969 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN02643 ADP-glucose phosphorylase | Back alignment and domain information |
|---|
| >PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02842 nucleotide kinase | Back alignment and domain information |
|---|
| >KOG4622 consensus Predicted nucleotide kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae | Back alignment and domain information |
|---|
| >PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated | Back alignment and domain information |
|---|
| >PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK06696 uridine kinase; Validated | Back alignment and domain information |
|---|
| >COG4185 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2110 Predicted phosphatase homologous to the C-terminal domain of histone macroH2A1 [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12339 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
|---|
| >PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG2633 consensus Hismacro and SEC14 domain-containing proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >TIGR00235 udk uridine kinase | Back alignment and domain information |
|---|
| >TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
|---|
| >cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
|---|
| >PRK07667 uridine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13975 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
|---|
| >PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR00152 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >cd03330 Macro_2 Macro domain, Unknown family 2 | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
|---|
| >PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PLN02348 phosphoribulokinase | Back alignment and domain information |
|---|
| >PHA02595 tk | Back alignment and domain information |
|---|
| >PRK14732 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >PLN02422 dephospho-CoA kinase | Back alignment and domain information |
|---|
| >PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
|---|
| >KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) | Back alignment and domain information |
|---|
| >PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02924 thymidylate kinase | Back alignment and domain information |
|---|
| >PRK14734 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02199 shikimate kinase | Back alignment and domain information |
|---|
| >PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 | Back alignment and domain information |
|---|
| >PTZ00451 dephospho-CoA kinase; Provisional | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PLN02772 guanylate kinase | Back alignment and domain information |
|---|
| >PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
|---|
| >PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3078 consensus Adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG5075 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
|---|
| >PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 | Back alignment and domain information |
|---|
| >cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
|---|
| >PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
|---|
| >PF01661 Macro: Macro domain; InterPro: IPR002589 The Macro or A1pp domain is a module of about 180 amino acids which can bind ADP-ribose, an NAD metabolite or related ligands | Back alignment and domain information |
|---|
| >cd02900 Macro_Appr_pase Macro domain, Appr-1"-pase family | Back alignment and domain information |
|---|
| >PRK06761 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
|---|
| >PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
|---|
| >cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
|---|
| >PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >cd02749 Macro Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases) | Back alignment and domain information |
|---|
| >PRK07933 thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
|---|
| >COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 | Back alignment and domain information |
|---|
| >PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK13974 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
|---|
| >COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins | Back alignment and domain information |
|---|
| >smart00506 A1pp Appr-1"-p processing enzyme | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >COG3896 Chloramphenicol 3-O-phosphotransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK00023 cmk cytidylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG5324 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd02901 Macro_Poa1p_like Macro domain, Poa1p_like family | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PRK13976 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
|---|
| >KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4238 consensus Bifunctional ATP sulfurylase/adenosine 5'-phosphosulfate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1384 consensus tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >COG1660 Predicted P-loop-containing kinase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PF02744 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transferase, C-terminal domain; InterPro: IPR005850 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF04677 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; InterPro: IPR006768 This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 (Q09909 from SWISSPROT) and its homologues | Back alignment and domain information |
|---|
| >KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >KOG0707 consensus Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PLN02840 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PF14519 Macro_2: Macro-like domain; PDB: 1TXZ_A 1TY8_A 1NJR_A | Back alignment and domain information |
|---|
| >KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >KOG0234 consensus Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >KOG2720 consensus Predicted hydrolase (HIT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03132 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG2958 consensus Galactose-1-phosphate uridylyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >TIGR00174 miaA tRNA isopentenyltransferase (miaA) | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PLN03103 GDP-L-galactose-hexose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >KOG1533 consensus Predicted GTPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >cd03331 Macro_Poa1p_like_SNF2 Macro domain, Poa1p_like family, SNF2 subfamily | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
|---|
| >KOG4235 consensus Mitochondrial thymidine kinase 2/deoxyguanosine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PF13521 AAA_28: AAA domain; PDB: 1LW7_A | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd04163 Era Era subfamily | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop | Back alignment and domain information |
|---|
| >KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A | Back alignment and domain information |
|---|
| >KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00202 tuzin; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
|---|
| >KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03707 PPK2_P_aer polyphosphate kinase 2, PA0141 family | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >TIGR00101 ureG urease accessory protein UreG | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK09169 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >COG4240 Predicted kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases | Back alignment and domain information |
|---|
| >KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >TIGR00672 cdh CDP-diacylglycerol pyrophosphatase, bacterial type | Back alignment and domain information |
|---|
| >KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >PRK05471 CDP-diacylglycerol pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF02611 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: IPR003763 The CDP-diacylglycerol pyrophosphatases 3 | Back alignment and domain information |
|---|
| >PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >TIGR03709 PPK2_rel_1 polyphosphate:nucleotide phosphotransferase, PPK2 family | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >PRK10463 hydrogenase nickel incorporation protein HypB; Provisional | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >KOG1534 consensus Putative transcription factor FET5 [Transcription] | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PRK00089 era GTPase Era; Reviewed | Back alignment and domain information |
|---|
| >KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase | Back alignment and domain information |
|---|
| >PRK15455 PrkA family serine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK10646 ADP-binding protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 761 | ||||
| 3spd_A | 204 | Crystal Structure Of Aprataxin Ortholog Hnt3 In Com | 2e-11 | ||
| 3sp4_A | 204 | Crystal Structure Of Aprataxin Ortholog Hnt3 From S | 3e-11 | ||
| 3szq_A | 206 | Structure Of An S. Pombe AptxDNAAMPZN COMPLEX Lengt | 3e-11 | ||
| 3zvn_A | 416 | The Structural Basis For Substrate Recognition By M | 5e-06 | ||
| 3zvl_A | 416 | The Structural Basis For Substrate Recognition By M | 5e-06 | ||
| 3u7e_B | 381 | Crystal Structure Of Mpnkp Catalytic Fragment (D170 | 7e-06 | ||
| 3zvm_A | 416 | The Structural Basis For Substrate Recognition By M | 9e-06 | ||
| 1yj5_A | 383 | Molecular Architecture Of Mammalian Polynucleotide | 1e-05 | ||
| 3u7g_A | 379 | Crystal Structure Of Mpnkp Catalytic Fragment (D170 | 1e-05 | ||
| 4gp6_A | 171 | Polynucleotide Kinase Length = 171 | 6e-04 |
| >pdb|3SPD|A Chain A, Crystal Structure Of Aprataxin Ortholog Hnt3 In Complex With Dna Length = 204 | Back alignment and structure |
|
| >pdb|3SP4|A Chain A, Crystal Structure Of Aprataxin Ortholog Hnt3 From Schizosaccharomyces Pombe Length = 204 | Back alignment and structure |
| >pdb|3SZQ|A Chain A, Structure Of An S. Pombe AptxDNAAMPZN COMPLEX Length = 206 | Back alignment and structure |
| >pdb|3ZVN|A Chain A, The Structural Basis For Substrate Recognition By Mammalian Polynucleotide Kinase 3' Phosphatase Length = 416 | Back alignment and structure |
| >pdb|3ZVL|A Chain A, The Structural Basis For Substrate Recognition By Mammalian Polynucleotide Kinase 3' Phosphatase Length = 416 | Back alignment and structure |
| >pdb|3U7E|B Chain B, Crystal Structure Of Mpnkp Catalytic Fragment (D170a) Length = 381 | Back alignment and structure |
| >pdb|3ZVM|A Chain A, The Structural Basis For Substrate Recognition By Mammalian Polynucleotide Kinase 3' Phosphatase Length = 416 | Back alignment and structure |
| >pdb|1YJ5|A Chain A, Molecular Architecture Of Mammalian Polynucleotide Kinase, A Dna Repair Enzyme Length = 383 | Back alignment and structure |
| >pdb|3U7G|A Chain A, Crystal Structure Of Mpnkp Catalytic Fragment (D170a) Bound To Single- Stranded Dna (Tcctap) Length = 379 | Back alignment and structure |
| >pdb|4GP6|A Chain A, Polynucleotide Kinase Length = 171 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 761 | |||
| 3sp4_A | 204 | Aprataxin-like protein; HIT domain, zinc finger, D | 1e-48 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 2e-22 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 2e-20 | |
| 3ejf_A | 176 | Non-structural protein 3; IBV, coronavirus, X-doma | 5e-19 | |
| 1vlr_A | 350 | MRNA decapping enzyme; 16740816, structural genomi | 3e-18 | |
| 3bl9_A | 301 | Scavenger mRNA-decapping enzyme DCPS; ligand compl | 4e-17 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 2e-16 | |
| 3ejg_A | 193 | Non-structural protein 3; HCOV 229E, X-domain, mac | 4e-16 | |
| 2vri_A | 174 | Non-structural protein 3; RNA replication, nucleot | 7e-16 | |
| 3gqe_A | 168 | Non-structural protein 3; macro domain, X domain, | 8e-16 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 1e-15 | |
| 3q71_A | 221 | Poly [ADP-ribose] polymerase 14; structural genomi | 2e-15 | |
| 1vhu_A | 211 | Hypothetical protein AF1521; structural genomics, | 3e-15 | |
| 3eti_A | 168 | X (ADRP) domain, macro domain of non-structural pr | 8e-14 | |
| 1spv_A | 184 | Putative polyprotein/phosphatase; structural genom | 2e-13 | |
| 2acf_A | 182 | Replicase polyprotein 1AB; ADRP domain, SARS NSP-3 | 2e-13 | |
| 3gpg_A | 168 | NSP3, non-structural protein 3; macro domain, X do | 3e-13 | |
| 2dx6_A | 159 | Hypothetical protein TTHA0132; conserved hypotheti | 3e-13 | |
| 3q6z_A | 214 | Poly [ADP-ribose] polymerase 14; structural genomi | 4e-13 | |
| 3kh6_A | 199 | Poly [ADP-ribose] polymerase 15; macro, PARP, BAL3 | 2e-12 | |
| 2xd7_A | 193 | Core histone macro-H2A.2; chromosomal protein, nuc | 2e-12 | |
| 1yd9_A | 193 | Core histone macro-H2A.1; alpha-beta structure, A1 | 4e-12 | |
| 2x47_A | 235 | Macro domain-containing protein 1; signaling prote | 9e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 3e-09 | |
| 1njr_A | 284 | 32.1 kDa protein in ADH3-RCA1 intergenic region; s | 3e-08 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 4e-07 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 3e-05 | |
| 3o1c_A | 126 | Histidine triad nucleotide-binding protein 1; hydr | 8e-05 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 1e-04 | |
| 3oj7_A | 117 | Putative histidine triad family protein; hydrolase | 2e-04 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 2e-04 | |
| 3n1s_A | 119 | HIT-like protein HINT; histidine triad nucleotide | 6e-04 |
| >3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Length = 204 | Back alignment and structure |
|---|
Score = 169 bits (429), Expect = 1e-48
Identities = 47/194 (24%), Positives = 89/194 (45%), Gaps = 22/194 (11%)
Query: 559 SWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLD--RLADVRN 616
S+ L PE +K+ ++ DDVV++ D++PK++ H+L+++R L ++
Sbjct: 5 SFRDNLKVYIESPESYKN-VIYYDDDVVLVRDMFPKSKMHLLLMTRDPHLTHVHPLEIMM 63
Query: 617 EHLQILQTMHAVGMKWAEKFLHEDA-------------SLAFRLGYHSAPSMRQLHLHVI 663
+H +++ + + + ++A ++G+H+ PSM LHLH++
Sbjct: 64 KHRSLVEKLVSYVQGDLSGLIFDEARNCLSQQLTNEALCNYIKVGFHAGPSMNNLHLHIM 123
Query: 664 SQDFNSKHLKNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRCHRC-RS 722
+ D S LKN H+ SF + FF + G SL +L+C RC +
Sbjct: 124 TLDHVSPSLKNSAHYISFTSPFFVKIDTPTSNLPTRGT-----LTSLFQEDLKCWRCGET 178
Query: 723 AHPSIPRLKSHISS 736
+LK+H+
Sbjct: 179 FGRHFTKLKAHLQE 192
|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Length = 416 | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 | Back alignment and structure |
|---|
| >3ejf_A Non-structural protein 3; IBV, coronavirus, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting; 1.60A {Avian infectious bronchitis virus} PDB: 3eke_A* 3ewo_A 3ewp_A* Length = 176 | Back alignment and structure |
|---|
| >1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* Length = 350 | Back alignment and structure |
|---|
| >3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Length = 301 | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 | Back alignment and structure |
|---|
| >3ejg_A Non-structural protein 3; HCOV 229E, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting, RNA-binding; 1.78A {Human coronavirus 229E} PDB: 3ewr_A* 3ewq_A* Length = 193 | Back alignment and structure |
|---|
| >2vri_A Non-structural protein 3; RNA replication, nucleotide-binding, endonuclease, macro domain, viral protein, ATP-binding, exonuclease; 1.8A {Human coronavirus NL63} Length = 174 | Back alignment and structure |
|---|
| >3gqe_A Non-structural protein 3; macro domain, X domain, venezuelan equine encephalitis virus alphavirus; HET: BCN; 2.30A {Venezuelan equine encephalitis virus} PDB: 3gqo_A* Length = 168 | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 | Back alignment and structure |
|---|
| >3q71_A Poly [ADP-ribose] polymerase 14; structural genomics, structural genomics consortium, SGC, transferase, PARP14 macro 2; HET: AR6; 2.20A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >1vhu_A Hypothetical protein AF1521; structural genomics, unknown function; HET: MSE MES; 1.34A {Archaeoglobus fulgidus} SCOP: c.50.1.2 PDB: 2bfq_A* 1hjz_A* 2bfr_A* Length = 211 | Back alignment and structure |
|---|
| >3eti_A X (ADRP) domain, macro domain of non-structural protein 3; coronavirus, X domain, RNA binding protein; 2.20A {Feline infectious peritonitis virus} PDB: 3ew5_A* 3jzt_A* Length = 168 | Back alignment and structure |
|---|
| >1spv_A Putative polyprotein/phosphatase; structural genomoics, alpha/beta monomeric protein, structural genomics, PSI, protein structure initiative; HET: MES; 2.00A {Escherichia coli} SCOP: c.50.1.2 Length = 184 | Back alignment and structure |
|---|
| >2acf_A Replicase polyprotein 1AB; ADRP domain, SARS NSP-3, APPR-1-P phosphatase, structural GE joint center for structural genomics, JCSG; 1.40A {Sars coronavirus TOR2} SCOP: c.50.1.2 PDB: 2fav_A* Length = 182 | Back alignment and structure |
|---|
| >3gpg_A NSP3, non-structural protein 3; macro domain, X domain, alphavirus, VIZI enzymes involved in replication, ATP-binding, cell membrane endosome; 1.65A {Chikungunya virus} PDB: 3gpo_A* 3gpq_A Length = 168 | Back alignment and structure |
|---|
| >2dx6_A Hypothetical protein TTHA0132; conserved hypothetical protein, structural genomics, NPPSFA; 1.78A {Thermus thermophilus} PDB: 3v45_A Length = 159 | Back alignment and structure |
|---|
| >3q6z_A Poly [ADP-ribose] polymerase 14; structural genomics consortium, SGC, ADP-ribose binding, TRA; HET: APR; 2.23A {Homo sapiens} Length = 214 | Back alignment and structure |
|---|
| >2xd7_A Core histone macro-H2A.2; chromosomal protein, nucleosome core, chromatin regulator, nucleus, DNA-binding protein, phosphoprotein; 2.09A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >1yd9_A Core histone macro-H2A.1; alpha-beta structure, A1PP domain, macro-domain, structural protein; 1.60A {Rattus norvegicus} SCOP: c.50.1.2 PDB: 1zr3_A* 2fxk_A 3iid_A* 3iif_A* 1zr5_A Length = 193 | Back alignment and structure |
|---|
| >2x47_A Macro domain-containing protein 1; signaling protein, signal transduction, estrogen signaling; 1.70A {Homo sapiens} Length = 235 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 | Back alignment and structure |
|---|
| >1njr_A 32.1 kDa protein in ADH3-RCA1 intergenic region; structural genomics, dimer, two domain organization, PSI, PR structure initiative; HET: XYL; 1.90A {Saccharomyces cerevisiae} SCOP: c.50.1.2 PDB: 1txz_A* 1ty8_A* Length = 284 | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191 | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Length = 189 | Back alignment and structure |
|---|
| >3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Length = 126 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 253 | Back alignment and structure |
|---|
| >3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} PDB: 3omf_A* 3oxk_A* Length = 117 | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Length = 178 | Back alignment and structure |
|---|
| >3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} PDB: 3n1t_A* Length = 119 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 761 | |||
| 3sp4_A | 204 | Aprataxin-like protein; HIT domain, zinc finger, D | 100.0 | |
| 3q71_A | 221 | Poly [ADP-ribose] polymerase 14; structural genomi | 99.93 | |
| 3eti_A | 168 | X (ADRP) domain, macro domain of non-structural pr | 99.93 | |
| 3q6z_A | 214 | Poly [ADP-ribose] polymerase 14; structural genomi | 99.93 | |
| 1spv_A | 184 | Putative polyprotein/phosphatase; structural genom | 99.93 | |
| 2xd7_A | 193 | Core histone macro-H2A.2; chromosomal protein, nuc | 99.92 | |
| 1yd9_A | 193 | Core histone macro-H2A.1; alpha-beta structure, A1 | 99.92 | |
| 4abl_A | 183 | Poly [ADP-ribose] polymerase 14; transferase, PARP | 99.92 | |
| 2x47_A | 235 | Macro domain-containing protein 1; signaling prote | 99.92 | |
| 3ejg_A | 193 | Non-structural protein 3; HCOV 229E, X-domain, mac | 99.91 | |
| 3kh6_A | 199 | Poly [ADP-ribose] polymerase 15; macro, PARP, BAL3 | 99.9 | |
| 2acf_A | 182 | Replicase polyprotein 1AB; ADRP domain, SARS NSP-3 | 99.89 | |
| 2dx6_A | 159 | Hypothetical protein TTHA0132; conserved hypotheti | 99.89 | |
| 3gqe_A | 168 | Non-structural protein 3; macro domain, X domain, | 99.89 | |
| 3gpg_A | 168 | NSP3, non-structural protein 3; macro domain, X do | 99.89 | |
| 1vhu_A | 211 | Hypothetical protein AF1521; structural genomics, | 99.89 | |
| 2vri_A | 174 | Non-structural protein 3; RNA replication, nucleot | 99.89 | |
| 3ejf_A | 176 | Non-structural protein 3; IBV, coronavirus, X-doma | 99.88 | |
| 1njr_A | 284 | 32.1 kDa protein in ADH3-RCA1 intergenic region; s | 99.86 | |
| 4gua_A | 670 | Non-structural polyprotein; viral precursor polypr | 99.85 | |
| 3bl9_A | 301 | Scavenger mRNA-decapping enzyme DCPS; ligand compl | 99.83 | |
| 1vlr_A | 350 | MRNA decapping enzyme; 16740816, structural genomi | 99.82 | |
| 3n1s_A | 119 | HIT-like protein HINT; histidine triad nucleotide | 99.74 | |
| 4egu_A | 119 | Histidine triad (HIT) protein; structural genomics | 99.73 | |
| 3o1c_A | 126 | Histidine triad nucleotide-binding protein 1; hydr | 99.71 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 99.69 | |
| 3oj7_A | 117 | Putative histidine triad family protein; hydrolase | 99.69 | |
| 2jyc_A | 160 | Uncharacterized protein C6ORF130; macro domain, A1 | 99.66 | |
| 2eee_A | 149 | Uncharacterized protein C6ORF130; macro domain, A1 | 99.65 | |
| 1xqu_A | 147 | HIT family hydrolase; protein STRU initiative, PSI | 99.63 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 99.62 | |
| 3o0m_A | 149 | HIT family protein; ssgcid, NIH, niaid, SBRI, UW, | 99.61 | |
| 2fg1_A | 158 | Conserved hypothetical protein BT1257; structural | 99.61 | |
| 3ano_A | 218 | AP-4-A phosphorylase; diadenosine polyphosphate, H | 99.58 | |
| 1fit_A | 147 | FragIle histidine protein; FHIT, fragIle histidine | 99.57 | |
| 3imi_A | 147 | HIT family protein; structural genomics, infectiou | 99.57 | |
| 3ksv_A | 149 | Uncharacterized protein; HIT family, structural ge | 99.56 | |
| 3p0t_A | 138 | Uncharacterized protein; ssgcid, HIT-like protein, | 99.56 | |
| 2eo4_A | 149 | 150AA long hypothetical histidine triad nucleotid | 99.56 | |
| 3lb5_A | 161 | HIT-like protein involved in cell-cycle regulatio; | 99.56 | |
| 3l7x_A | 173 | SMU.412C, putative HIT-like protein involved in ce | 99.55 | |
| 1y23_A | 145 | HIT, histidine triad protein; HIT protein, PKCI-1, | 99.53 | |
| 2oik_A | 154 | Histidine triad (HIT) protein; HIT-like fold, stru | 99.52 | |
| 3r6f_A | 135 | HIT family protein; structural genomics, seattle s | 99.51 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 99.49 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 99.48 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 99.46 | |
| 3ohe_A | 137 | Histidine triad (HIT) protein; structural genomics | 99.35 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 99.35 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 99.35 | |
| 3q71_A | 221 | Poly [ADP-ribose] polymerase 14; structural genomi | 99.34 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 99.33 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 99.32 | |
| 1ems_A | 440 | Nitfhit, NIT-fragIle histidine triad fusion protei | 99.31 | |
| 3i24_A | 149 | HIT family hydrolase; structural genomics, PSI-2, | 99.31 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 99.3 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 99.29 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 99.28 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 99.28 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 99.27 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 99.26 | |
| 3q6z_A | 214 | Poly [ADP-ribose] polymerase 14; structural genomi | 99.25 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 99.21 | |
| 3nrd_A | 135 | Histidine triad (HIT) protein; structural genomics | 99.21 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 99.21 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 99.2 | |
| 4abl_A | 183 | Poly [ADP-ribose] polymerase 14; transferase, PARP | 99.2 | |
| 1spv_A | 184 | Putative polyprotein/phosphatase; structural genom | 99.18 | |
| 1z84_A | 351 | Galactose-1-phosphate uridyl transferase-like prot | 99.18 | |
| 1gup_A | 348 | Galactose-1-phosphate uridylyltransferase; nucleot | 99.18 | |
| 2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 99.17 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 99.17 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 99.17 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 99.17 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 99.17 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 99.16 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 99.15 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 99.15 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 99.14 | |
| 2xd7_A | 193 | Core histone macro-H2A.2; chromosomal protein, nuc | 99.14 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 99.14 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 99.14 | |
| 1yd9_A | 193 | Core histone macro-H2A.1; alpha-beta structure, A1 | 99.13 | |
| 3kh6_A | 199 | Poly [ADP-ribose] polymerase 15; macro, PARP, BAL3 | 99.12 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 99.1 | |
| 2x47_A | 235 | Macro domain-containing protein 1; signaling prote | 99.08 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 99.03 | |
| 3i4s_A | 149 | Histidine triad protein; hydrolase, phosphatase, H | 99.01 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 99.01 | |
| 3eti_A | 168 | X (ADRP) domain, macro domain of non-structural pr | 98.99 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 98.96 | |
| 2dx6_A | 159 | Hypothetical protein TTHA0132; conserved hypotheti | 98.95 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 98.95 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 98.94 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 98.93 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 98.91 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 98.91 | |
| 1vhu_A | 211 | Hypothetical protein AF1521; structural genomics, | 98.89 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 98.88 | |
| 3ejf_A | 176 | Non-structural protein 3; IBV, coronavirus, X-doma | 98.88 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 98.88 | |
| 1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 98.86 | |
| 2acf_A | 182 | Replicase polyprotein 1AB; ADRP domain, SARS NSP-3 | 98.86 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 98.83 | |
| 1njr_A | 284 | 32.1 kDa protein in ADH3-RCA1 intergenic region; s | 98.83 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 98.81 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 98.8 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 98.8 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 98.79 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 98.78 | |
| 3gpg_A | 168 | NSP3, non-structural protein 3; macro domain, X do | 98.78 | |
| 1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 98.78 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 98.75 | |
| 3ejg_A | 193 | Non-structural protein 3; HCOV 229E, X-domain, mac | 98.74 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 98.72 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 98.69 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 98.68 | |
| 3gqe_A | 168 | Non-structural protein 3; macro domain, X domain, | 98.67 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 98.66 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 98.66 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 98.66 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 98.66 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 98.64 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 98.62 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 98.6 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 98.59 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 98.59 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 98.58 | |
| 1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 98.58 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 98.58 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 98.57 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 98.57 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 98.57 | |
| 2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 98.53 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 98.51 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 98.49 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 98.49 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 98.48 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 98.47 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 98.47 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 98.44 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 98.38 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 98.37 | |
| 2vri_A | 174 | Non-structural protein 3; RNA replication, nucleot | 98.36 | |
| 4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 98.35 | |
| 4gua_A | 670 | Non-structural polyprotein; viral precursor polypr | 98.34 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 98.34 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 98.34 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 98.32 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 98.31 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 98.31 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 98.31 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 98.29 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 98.28 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 98.25 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 98.22 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 98.21 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 98.21 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 98.2 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 98.19 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 98.19 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 98.15 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 98.15 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 98.14 | |
| 2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 98.14 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 98.12 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 98.09 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 98.08 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 98.07 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 98.06 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 97.96 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 97.92 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 97.92 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 97.92 | |
| 3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 97.9 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 97.89 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 97.88 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 97.82 | |
| 1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 97.8 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 97.78 | |
| 2jyc_A | 160 | Uncharacterized protein C6ORF130; macro domain, A1 | 97.75 | |
| 3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 97.75 | |
| 3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 97.65 | |
| 2eee_A | 149 | Uncharacterized protein C6ORF130; macro domain, A1 | 97.64 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 97.63 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 97.55 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 97.49 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 97.47 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 97.46 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 97.45 | |
| 2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 97.45 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 97.41 | |
| 2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 97.38 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 97.35 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 97.21 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.15 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 97.14 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 97.12 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 97.11 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 97.1 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 97.03 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 97.02 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.02 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 96.88 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 96.86 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 96.78 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 96.76 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 96.73 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 96.73 | |
| 1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 96.71 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.68 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 96.67 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 96.65 | |
| 2fg1_A | 158 | Conserved hypothetical protein BT1257; structural | 96.61 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 96.57 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 96.55 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.54 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 96.52 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.5 | |
| 3kfv_A | 308 | Tight junction protein ZO-3; structural genomics c | 96.49 | |
| 1p6x_A | 334 | Thymidine kinase; P-loop, LID, transferase; HET: T | 96.48 | |
| 3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 96.43 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.37 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 96.34 | |
| 1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 96.33 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.31 | |
| 3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 96.28 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 96.26 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 96.25 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 96.22 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 96.21 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.21 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.2 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.13 | |
| 3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 96.12 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 96.08 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 96.05 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 96.05 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 95.96 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 95.95 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 95.92 | |
| 3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 95.9 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 95.8 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 95.8 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 95.79 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 95.78 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 95.77 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 95.76 | |
| 3czq_A | 304 | Putative polyphosphate kinase 2; structural genomi | 95.76 | |
| 2xkx_A | 721 | Disks large homolog 4; structural protein, scaffol | 95.74 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 95.72 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 95.72 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 95.7 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 95.7 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 95.7 | |
| 1of1_A | 376 | Thymidine kinase; transferase, antiviral drug, enz | 95.67 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 95.55 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 95.54 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 95.52 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 95.44 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.43 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 95.43 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 95.38 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 95.38 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 95.38 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 95.3 | |
| 2pof_A | 227 | CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM0 | 95.22 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 95.18 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.14 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 95.09 | |
| 2xxa_A | 433 | Signal recognition particle protein; protein trans | 95.08 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 95.08 | |
| 1e2k_A | 331 | Thymidine kinase; transferase, antiviral drug, enz | 95.03 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 95.01 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 95.01 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 94.93 | |
| 1z84_A | 351 | Galactose-1-phosphate uridyl transferase-like prot | 94.9 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 94.87 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 94.84 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 94.79 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 94.76 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 94.7 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 94.66 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 94.65 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 94.54 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 94.54 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 94.49 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 94.44 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 94.4 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 94.38 | |
| 1klr_A | 30 | Zinc finger Y-chromosomal protein; transcription; | 94.37 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 94.36 | |
| 1znf_A | 27 | 31ST zinc finger from XFIN; zinc finger DNA bindin | 94.34 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 94.33 | |
| 2kvh_A | 27 | Zinc finger and BTB domain-containing protein 32; | 94.32 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 94.28 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 94.27 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 94.22 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 94.19 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 94.16 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 94.14 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 94.12 | |
| 4dey_A | 337 | Voltage-dependent L-type calcium channel subunit; | 94.11 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 94.05 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 94.0 | |
| 1ard_A | 29 | Yeast transcription factor ADR1; transcription reg | 93.97 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 93.93 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 93.84 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 93.84 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 93.84 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 93.83 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 93.81 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 93.74 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 93.73 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 93.66 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 93.65 | |
| 2m0d_A | 30 | Zinc finger and BTB domain-containing protein 17; | 93.63 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 93.62 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 93.61 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.6 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 93.52 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.48 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 93.44 | |
| 2m0e_A | 29 | Zinc finger and BTB domain-containing protein 17; | 93.42 | |
| 2kvg_A | 27 | Zinc finger and BTB domain-containing protein 32; | 93.4 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 93.39 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 93.36 | |
| 2kvf_A | 28 | Zinc finger and BTB domain-containing protein 32; | 93.35 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 93.31 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 93.3 | |
| 1rik_A | 29 | E6APC1 peptide; E6-binding domain, zinc finger, hu | 93.28 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 93.25 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 93.15 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 93.15 | |
| 3rhf_A | 289 | Putative polyphosphate kinase 2 family protein; PS | 93.14 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 93.13 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 93.1 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 93.07 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 93.06 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 93.05 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 93.03 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 92.99 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 92.97 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 92.94 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 92.91 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 92.86 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 92.85 | |
| 1osn_A | 341 | Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra | 92.85 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 92.75 | |
| 3czp_A | 500 | Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 | 92.75 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 92.75 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 92.75 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 92.73 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.71 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 92.71 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.7 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.7 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 92.69 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.66 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 92.63 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 92.62 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 92.59 | |
| 2m0f_A | 29 | Zinc finger and BTB domain-containing protein 17; | 92.52 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 92.52 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 92.5 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 92.46 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 92.46 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 92.45 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 92.43 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.41 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 92.41 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 92.41 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 92.38 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 92.37 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 92.37 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 92.37 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.36 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.35 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 92.34 | |
| 3sig_A | 277 | PArg, poly(ADP-ribose) glycohydrolase; HET: AR6; 1 | 92.32 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 92.3 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 92.3 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 92.3 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 92.3 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 92.29 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 92.29 | |
| 1dek_A | 241 | Deoxynucleoside monophosphate kinase; transferase, | 92.27 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 92.26 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 92.25 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 92.23 | |
| 1paa_A | 30 | Yeast transcription factor ADR1; transcription reg | 92.22 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 92.2 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 92.18 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 92.17 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 92.17 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 92.15 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.14 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 92.13 | |
| 2lvu_A | 26 | Zinc finger and BTB domain-containing protein 17; | 91.36 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 92.08 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 92.07 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 92.03 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 92.02 | |
| 2lvt_A | 29 | Zinc finger and BTB domain-containing protein 17; | 91.25 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.99 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.98 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 91.97 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 91.96 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 91.96 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 91.95 | |
| 3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 91.93 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 91.92 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.86 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.85 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.84 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.84 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 91.8 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 91.78 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 91.77 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 91.77 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 91.77 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 91.75 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 91.73 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 91.71 | |
| 2lvr_A | 30 | Zinc finger and BTB domain-containing protein 17; | 90.99 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 91.7 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.69 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.65 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 91.64 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.62 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 91.61 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 91.61 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 91.6 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 91.59 | |
| 1sp2_A | 31 | SP1F2; zinc finger, transcription activation; NMR | 91.57 | |
| 2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 91.57 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.53 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 91.52 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.51 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 91.5 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.48 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 91.45 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 91.44 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.43 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.43 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 91.41 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.41 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 91.41 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 91.41 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 91.39 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 91.37 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 91.36 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.35 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.35 | |
| 1zfd_A | 32 | SWI5; DNA binding motif, zinc finger DNA binding d | 91.33 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 91.33 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 91.32 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 91.32 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.31 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 91.28 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 91.27 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 91.27 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 91.26 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 91.26 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 91.23 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.21 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 91.21 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 91.2 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 91.19 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 91.18 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 91.18 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.18 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 91.15 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 91.12 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 91.11 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 91.11 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 91.09 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 91.08 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.06 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 91.06 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 91.05 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 91.05 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 91.05 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 91.04 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 91.04 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 91.03 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 91.03 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.97 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 90.97 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 90.97 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 90.95 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 90.93 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 90.93 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 90.93 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 90.92 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.86 | |
| 2epp_A | 66 | POZ-, at HOOK-, and zinc finger-containing protein | 90.81 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 90.79 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 90.79 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 90.75 |
| >3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2.4e-49 Score=396.53 Aligned_cols=173 Identities=27% Similarity=0.457 Sum_probs=147.7
Q ss_pred cchhHHHHHhhhcCCCCCCCcEEEEcCcEEEEecCCCCCCceEEEEeCCCCCCChhcCCH---HHHHHHHHHHHHHH-HH
Q 004319 557 WGSWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLDRLADVRN---EHLQILQTMHAVGM-KW 632 (761)
Q Consensus 557 ~~~w~~~L~~~~~~Pe~~p~~vvyedd~~vai~D~~Pka~~H~LVIPk~~hi~~l~dl~~---e~l~lL~~m~~~~~-~~ 632 (761)
-.+||++|+.||.+||++|. +|||||.++||+|+||+|++|+||||| +|+.++.++.+ ++.+++.+|..++. +.
T Consensus 3 ~msw~~~L~~yi~~Pe~~p~-~v~edd~~~af~D~~P~a~~H~LVIPk-~h~~~~~~p~~al~d~~~Ll~~m~~la~~~~ 80 (204)
T 3sp4_A 3 HMSFRDNLKVYIESPESYKN-VIYYDDDVVLVRDMFPKSKMHLLLMTR-DPHLTHVHPLEIMMKHRSLVEKLVSYVQGDL 80 (204)
T ss_dssp CCSGGGTTHHHHHCGGGCTT-EEEECSSEEEEECSSCSSSSEEEEEEC-CTTTTTSCHHHHHHHCHHHHHHHHHHHHTTT
T ss_pred CCcHHHHHHHHhcChhhCCC-EEEEcCCEEEEeCCCCCCCccEEEEec-cccCcccchhhhhhhhHHHHHHHHHHHHHHH
Confidence 35799999999999999999 999999999999999999999999999 79999886554 46888999999888 64
Q ss_pred HHHhhc------------cCCceeeeecccCCCcccceeeeeecCCcccccccccccccccCcccccCHHHHHHHHHhcC
Q 004319 633 AEKFLH------------EDASLAFRLGYHSAPSMRQLHLHVISQDFNSKHLKNKKHWNSFNTAFFCDSVDVLEEISNHG 700 (761)
Q Consensus 633 ~~~~~~------------~~~~~~~~~G~ha~pSv~HLHlHVIs~d~~s~~lk~kkH~nsF~t~fFv~~~~v~~~l~~~g 700 (761)
+++... .+....|++|||++|||+||||||||+||+|++||+|||||||||+|||+++ ..|+..+
T Consensus 81 l~~~~~~~~~~~~~~~~~~~~~~~i~~GfHa~PSm~HLHLHVIS~Df~s~~lK~kkH~NSF~T~fFv~~~---~~l~~~~ 157 (204)
T 3sp4_A 81 SGLIFDEARNCLSQQLTNEALCNYIKVGFHAGPSMNNLHLHIMTLDHVSPSLKNSAHYISFTSPFFVKID---TPTSNLP 157 (204)
T ss_dssp HHHHHHHHHHHSCTTCCHHHHHTTEEEEEESSCSSSSCCEEEEESCCCCTTCCSHHHHHHHHSTTEEETT---CCGGGCC
T ss_pred HHHHHhhhhhhhcccCCcCCeeeeEeccCCCCCcccceeEEEeccCCCChhhCccchhcccChhhhccch---hhhhhcc
Confidence 443221 1112379999999999999999999999999999999999999999999999 2345555
Q ss_pred CCCccchhhhc-cCCcccccCCCCCCC-hHHHHHHHhhc
Q 004319 701 KATLKDYDSLL-SMELRCHRCRSAHPS-IPRLKSHISSC 737 (761)
Q Consensus 701 ~~~~~~~~~~l-~~~l~C~~C~~~~~n-~~~LK~Hl~~~ 737 (761)
+.... .+| ++||+||+|+++|+| ||+||+||+.+
T Consensus 158 ~~~~~---~~l~~~~L~C~~C~~~f~n~~~~LK~HL~~e 193 (204)
T 3sp4_A 158 TRGTL---TSLFQEDLKCWRCGETFGRHFTKLKAHLQEE 193 (204)
T ss_dssp CGGGG---GGGGGSCCBCTTTCCBCTTCHHHHHHHHHHH
T ss_pred ccCHh---hhhcCCCceeCCCCchhhcccHHHHHHHHHH
Confidence 43322 556 999999999999999 99999999865
|
| >3q71_A Poly [ADP-ribose] polymerase 14; structural genomics, structural genomics consortium, SGC, transferase, PARP14 macro 2; HET: AR6; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3eti_A X (ADRP) domain, macro domain of non-structural protein 3; coronavirus, X domain, RNA binding protein; 2.20A {Feline infectious peritonitis virus} PDB: 3ew5_A* 3jzt_A* | Back alignment and structure |
|---|
| >3q6z_A Poly [ADP-ribose] polymerase 14; structural genomics consortium, SGC, ADP-ribose binding, TRA; HET: APR; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >1spv_A Putative polyprotein/phosphatase; structural genomoics, alpha/beta monomeric protein, structural genomics, PSI, protein structure initiative; HET: MES; 2.00A {Escherichia coli} SCOP: c.50.1.2 | Back alignment and structure |
|---|
| >2xd7_A Core histone macro-H2A.2; chromosomal protein, nucleosome core, chromatin regulator, nucleus, DNA-binding protein, phosphoprotein; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >1yd9_A Core histone macro-H2A.1; alpha-beta structure, A1PP domain, macro-domain, structural protein; 1.60A {Rattus norvegicus} SCOP: c.50.1.2 PDB: 1zr3_A* 2fxk_A 3iid_A* 3iif_A* 1zr5_A | Back alignment and structure |
|---|
| >4abl_A Poly [ADP-ribose] polymerase 14; transferase, PARP14; 1.15A {Homo sapiens} PDB: 4abk_A | Back alignment and structure |
|---|
| >2x47_A Macro domain-containing protein 1; signaling protein, signal transduction, estrogen signaling; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ejg_A Non-structural protein 3; HCOV 229E, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting, RNA-binding; 1.78A {Human coronavirus 229E} PDB: 3ewr_A* 3ewq_A* | Back alignment and structure |
|---|
| >2acf_A Replicase polyprotein 1AB; ADRP domain, SARS NSP-3, APPR-1-P phosphatase, structural GE joint center for structural genomics, JCSG; 1.40A {Sars coronavirus TOR2} SCOP: c.50.1.2 PDB: 2fav_A* | Back alignment and structure |
|---|
| >2dx6_A Hypothetical protein TTHA0132; conserved hypothetical protein, structural genomics, NPPSFA; 1.78A {Thermus thermophilus} PDB: 3v45_A | Back alignment and structure |
|---|
| >3gqe_A Non-structural protein 3; macro domain, X domain, venezuelan equine encephalitis virus alphavirus; HET: BCN; 2.30A {Venezuelan equine encephalitis virus} PDB: 3gqo_A* | Back alignment and structure |
|---|
| >3gpg_A NSP3, non-structural protein 3; macro domain, X domain, alphavirus, VIZI enzymes involved in replication, ATP-binding, cell membrane endosome; 1.65A {Chikungunya virus} PDB: 3gpo_A* 3gpq_A | Back alignment and structure |
|---|
| >1vhu_A Hypothetical protein AF1521; structural genomics, unknown function; HET: MSE MES; 1.34A {Archaeoglobus fulgidus} SCOP: c.50.1.2 PDB: 2bfq_A* 1hjz_A* 2bfr_A* | Back alignment and structure |
|---|
| >2vri_A Non-structural protein 3; RNA replication, nucleotide-binding, endonuclease, macro domain, viral protein, ATP-binding, exonuclease; 1.8A {Human coronavirus NL63} | Back alignment and structure |
|---|
| >3ejf_A Non-structural protein 3; IBV, coronavirus, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting; 1.60A {Avian infectious bronchitis virus} PDB: 3eke_A* 3ewo_A 3ewp_A* | Back alignment and structure |
|---|
| >1njr_A 32.1 kDa protein in ADH3-RCA1 intergenic region; structural genomics, dimer, two domain organization, PSI, PR structure initiative; HET: XYL; 1.90A {Saccharomyces cerevisiae} SCOP: c.50.1.2 PDB: 1txz_A* 1ty8_A* | Back alignment and structure |
|---|
| >4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus} | Back alignment and structure |
|---|
| >3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* | Back alignment and structure |
|---|
| >1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* | Back alignment and structure |
|---|
| >3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} SCOP: d.13.1.0 PDB: 3n1t_A* | Back alignment and structure |
|---|
| >4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} | Back alignment and structure |
|---|
| >3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} SCOP: d.13.1.1 PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} SCOP: d.13.1.0 PDB: 3omf_A* 3oxk_A* | Back alignment and structure |
|---|
| >2eee_A Uncharacterized protein C6ORF130; macro domain, A1PP domain, ADP-ribose binding, rossmann fold, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l8r_A* | Back alignment and structure |
|---|
| >1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >2fg1_A Conserved hypothetical protein BT1257; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.25A {Bacteroides thetaiotaomicron} SCOP: c.50.1.2 PDB: 2afc_A | Back alignment and structure |
|---|
| >3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* | Back alignment and structure |
|---|
| >3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} SCOP: d.13.1.1 | Back alignment and structure |
|---|
| >3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} SCOP: d.13.1.0 | Back alignment and structure |
|---|
| >3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 | Back alignment and structure |
|---|
| >2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 | Back alignment and structure |
|---|
| >3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >3q71_A Poly [ADP-ribose] polymerase 14; structural genomics, structural genomics consortium, SGC, transferase, PARP14 macro 2; HET: AR6; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 | Back alignment and structure |
|---|
| >3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3q6z_A Poly [ADP-ribose] polymerase 14; structural genomics consortium, SGC, ADP-ribose binding, TRA; HET: APR; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >4abl_A Poly [ADP-ribose] polymerase 14; transferase, PARP14; 1.15A {Homo sapiens} PDB: 4abk_A | Back alignment and structure |
|---|
| >1spv_A Putative polyprotein/phosphatase; structural genomoics, alpha/beta monomeric protein, structural genomics, PSI, protein structure initiative; HET: MES; 2.00A {Escherichia coli} SCOP: c.50.1.2 | Back alignment and structure |
|---|
| >1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* | Back alignment and structure |
|---|
| >1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* | Back alignment and structure |
|---|
| >2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >2xd7_A Core histone macro-H2A.2; chromosomal protein, nucleosome core, chromatin regulator, nucleus, DNA-binding protein, phosphoprotein; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1yd9_A Core histone macro-H2A.1; alpha-beta structure, A1PP domain, macro-domain, structural protein; 1.60A {Rattus norvegicus} SCOP: c.50.1.2 PDB: 1zr3_A* 2fxk_A 3iid_A* 3iif_A* 1zr5_A | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >2x47_A Macro domain-containing protein 1; signaling protein, signal transduction, estrogen signaling; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3eti_A X (ADRP) domain, macro domain of non-structural protein 3; coronavirus, X domain, RNA binding protein; 2.20A {Feline infectious peritonitis virus} PDB: 3ew5_A* 3jzt_A* | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2dx6_A Hypothetical protein TTHA0132; conserved hypothetical protein, structural genomics, NPPSFA; 1.78A {Thermus thermophilus} PDB: 3v45_A | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1vhu_A Hypothetical protein AF1521; structural genomics, unknown function; HET: MSE MES; 1.34A {Archaeoglobus fulgidus} SCOP: c.50.1.2 PDB: 2bfq_A* 1hjz_A* 2bfr_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3ejf_A Non-structural protein 3; IBV, coronavirus, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting; 1.60A {Avian infectious bronchitis virus} PDB: 3eke_A* 3ewo_A 3ewp_A* | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
|---|
| >2acf_A Replicase polyprotein 1AB; ADRP domain, SARS NSP-3, APPR-1-P phosphatase, structural GE joint center for structural genomics, JCSG; 1.40A {Sars coronavirus TOR2} SCOP: c.50.1.2 PDB: 2fav_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1njr_A 32.1 kDa protein in ADH3-RCA1 intergenic region; structural genomics, dimer, two domain organization, PSI, PR structure initiative; HET: XYL; 1.90A {Saccharomyces cerevisiae} SCOP: c.50.1.2 PDB: 1txz_A* 1ty8_A* | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3gpg_A NSP3, non-structural protein 3; macro domain, X domain, alphavirus, VIZI enzymes involved in replication, ATP-binding, cell membrane endosome; 1.65A {Chikungunya virus} PDB: 3gpo_A* 3gpq_A | Back alignment and structure |
|---|
| >1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >3ejg_A Non-structural protein 3; HCOV 229E, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting, RNA-binding; 1.78A {Human coronavirus 229E} PDB: 3ewr_A* 3ewq_A* | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3gqe_A Non-structural protein 3; macro domain, X domain, venezuelan equine encephalitis virus alphavirus; HET: BCN; 2.30A {Venezuelan equine encephalitis virus} PDB: 3gqo_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2vri_A Non-structural protein 3; RNA replication, nucleotide-binding, endonuclease, macro domain, viral protein, ATP-binding, exonuclease; 1.8A {Human coronavirus NL63} | Back alignment and structure |
|---|
| >4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
|---|
| >4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus} | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
|---|
| >3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
|---|
| >2eee_A Uncharacterized protein C6ORF130; macro domain, A1PP domain, ADP-ribose binding, rossmann fold, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l8r_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2fg1_A Conserved hypothetical protein BT1257; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.25A {Bacteroides thetaiotaomicron} SCOP: c.50.1.2 PDB: 2afc_A | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* | Back alignment and structure |
|---|
| >3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >2pof_A CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM02611, PSI-2, phospholipid biosynthesis structural genomics, protein structure initiative; 1.40A {Escherichia coli} SCOP: d.13.1.4 | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3sig_A PArg, poly(ADP-ribose) glycohydrolase; HET: AR6; 1.28A {Thermomonospora curvata} PDB: 3sih_A 3sii_A* 3sij_A | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A | Back alignment and structure |
|---|
| >2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 761 | ||||
| d1yj5a2 | 172 | c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p | 2e-16 | |
| d1vlra1 | 192 | d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C- | 2e-16 | |
| d1vhua_ | 192 | c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeo | 2e-09 | |
| d2acfa1 | 168 | c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SA | 6e-09 | |
| d1njra_ | 264 | c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker' | 2e-08 | |
| d1yd9a1 | 188 | c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Ratt | 1e-06 | |
| d1ly1a_ | 152 | c.37.1.1 (A:) Polynucleotide kinase, kinase domain | 1e-06 | |
| d1spva_ | 172 | c.50.1.2 (A:) Hypothetical protein YmbD {Escherich | 4e-06 | |
| d1emsa1 | 160 | d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-te | 1e-05 | |
| d1kpfa_ | 111 | d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 | 2e-05 | |
| d1y23a_ | 139 | d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423] | 4e-05 | |
| d1xqua_ | 113 | d.13.1.1 (A:) Putative hydrolase {Clostridium ther | 6e-05 | |
| d1fita_ | 146 | d.13.1.1 (A:) FHIT (fragile histidine triad protei | 2e-04 | |
| d1qhxa_ | 178 | c.37.1.3 (A:) Chloramphenicol phosphotransferase { | 7e-04 | |
| d1zp6a1 | 176 | c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { | 8e-04 | |
| d2fg1a1 | 154 | c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Ba | 0.002 |
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nucleotide and nucleoside kinases domain: 5' polynucleotide kinase-3' phosphatase, C-terminal domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 75.7 bits (185), Expect = 2e-16
Identities = 33/143 (23%), Positives = 61/143 (42%), Gaps = 9/143 (6%)
Query: 22 LVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTSASSALKKGKSV 81
+V+ VG PG+GKSTF + + + + + +DT+ +C++S +AL++GK V
Sbjct: 16 VVVAVGFPGAGKSTFIQEHLV--SAGYVHVNRDTLGS-----WQRCVSSCQAALRQGKRV 68
Query: 82 FLDRCNLEREQRTDFVKLG-GPEVDVHAVVLDLPAKLCISRSVKRIEHEGNLQGGKAAAV 140
+D N + R +++ V + + R E + V
Sbjct: 69 VIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFR-EMTDPSHAPVSDMV 127
Query: 141 VNRMLQKKELPKLSEGFSRITLC 163
+ ++ E P L+EGF I
Sbjct: 128 MFSYRKQFEPPTLAEGFLEILEI 150
|
| >d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 192 | Back information, alignment and structure |
|---|
| >d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 192 | Back information, alignment and structure |
|---|
| >d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]} Length = 168 | Back information, alignment and structure |
|---|
| >d1njra_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 264 | Back information, alignment and structure |
|---|
| >d1yd9a1 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 188 | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 | Back information, alignment and structure |
|---|
| >d1spva_ c.50.1.2 (A:) Hypothetical protein YmbD {Escherichia coli [TaxId: 562]} Length = 172 | Back information, alignment and structure |
|---|
| >d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 160 | Back information, alignment and structure |
|---|
| >d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Length = 139 | Back information, alignment and structure |
|---|
| >d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Length = 113 | Back information, alignment and structure |
|---|
| >d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 | Back information, alignment and structure |
|---|
| >d2fg1a1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 154 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 761 | |||
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 99.89 | |
| d1yd9a1 | 188 | Histone macro-H2a1.1 {Rat (Rattus norvegicus) [Tax | 99.88 | |
| d1spva_ | 172 | Hypothetical protein YmbD {Escherichia coli [TaxId | 99.87 | |
| d1vhua_ | 192 | Hypothetical protein AF1521 {Archaeon Archaeoglobu | 99.86 | |
| d2acfa1 | 168 | Replicase polyprotein 1ab {SARS coronavirus [TaxId | 99.81 | |
| d1kpfa_ | 111 | Protein kinase C inhibitor-1, PKCI-1 {Human (Homo | 99.76 | |
| d1vlra1 | 192 | mRNA decapping enzyme DcpS C-terminal domain {Mous | 99.76 | |
| d1xqua_ | 113 | Putative hydrolase {Clostridium thermocellum [TaxI | 99.7 | |
| d1emsa1 | 160 | NIT-FHIT fusion protein, C-terminal domain {Nemato | 99.7 | |
| d1njra_ | 264 | Hypothetical protein Ymr087W {Baker's yeast (Sacch | 99.65 | |
| d1fita_ | 146 | FHIT (fragile histidine triad protein) {Human (Hom | 99.64 | |
| d1y23a_ | 139 | Hit {Bacillus subtilis [TaxId: 1423]} | 99.64 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 99.62 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 99.51 | |
| d2oika1 | 139 | Histidine triad protein Mfla2506 {Methylobacillus | 99.48 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 99.43 | |
| d1z84a2 | 156 | Galactose-1-phosphate uridylyltransferase {Thale c | 99.36 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 99.35 | |
| d1guqa2 | 171 | Galactose-1-phosphate uridylyltransferase {Escheri | 99.33 | |
| d2fg1a1 | 154 | Hypothetical protein BT1257 {Bacteroides thetaiota | 99.26 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 99.24 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 99.18 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 99.14 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 99.12 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 99.11 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 99.1 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 99.09 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 99.09 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 99.06 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 99.06 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 99.05 | |
| d1yd9a1 | 188 | Histone macro-H2a1.1 {Rat (Rattus norvegicus) [Tax | 99.04 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 98.97 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 98.91 | |
| d1spva_ | 172 | Hypothetical protein YmbD {Escherichia coli [TaxId | 98.91 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 98.88 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 98.87 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 98.87 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 98.84 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 98.82 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 98.79 | |
| d1vhua_ | 192 | Hypothetical protein AF1521 {Archaeon Archaeoglobu | 98.78 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 98.77 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 98.72 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 98.7 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 98.66 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 98.62 | |
| d2acfa1 | 168 | Replicase polyprotein 1ab {SARS coronavirus [TaxId | 98.57 | |
| d1njra_ | 264 | Hypothetical protein Ymr087W {Baker's yeast (Sacch | 98.57 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 98.55 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 98.51 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 98.5 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 98.5 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 98.49 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 98.39 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 98.33 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 98.25 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 98.21 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 98.2 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 98.12 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 98.11 | |
| d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 98.07 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 98.03 | |
| d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 98.02 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 97.98 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 97.97 | |
| d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 97.87 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 97.62 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 97.58 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 97.53 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 97.46 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 97.46 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 97.45 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.35 | |
| d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 97.33 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 97.3 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 97.25 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.17 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.16 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.15 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.1 | |
| d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 97.08 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.03 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 96.98 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.92 | |
| d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 96.88 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.84 | |
| d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 96.82 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 96.75 | |
| d2fg1a1 | 154 | Hypothetical protein BT1257 {Bacteroides thetaiota | 96.74 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 96.72 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.44 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 96.33 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.3 | |
| d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 96.26 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 96.25 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 96.09 | |
| d2axpa1 | 164 | Hypothetical protein YorR {Bacillus subtilis [TaxI | 96.01 | |
| d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 95.99 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 95.93 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 95.91 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.7 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 95.59 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 95.58 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 95.56 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 95.46 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 95.4 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 95.27 | |
| d1kjwa2 | 199 | Guanylate kinase-like domain of Psd-95 {Rat (Rattu | 95.05 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 95.05 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 94.97 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 94.95 | |
| d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 94.93 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 94.86 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 94.78 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 94.51 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 94.5 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 94.45 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 94.44 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 94.43 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 94.42 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 94.35 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 94.34 | |
| d2pofa1 | 220 | CDP-diacylglycerol pyrophosphatase CDH {Escherichi | 94.34 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 94.26 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 94.18 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 94.17 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 94.1 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 94.05 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 94.01 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 93.88 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 93.83 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 93.73 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 93.58 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 93.57 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.55 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 93.5 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 93.42 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 93.26 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 93.07 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 93.03 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 92.96 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 92.94 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 92.89 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 92.73 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 92.71 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 92.68 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 92.61 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.61 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 92.45 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 92.38 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 92.35 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 92.29 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 92.25 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 92.15 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 92.15 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 92.08 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 92.08 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 92.08 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 92.03 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 91.99 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 91.91 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 91.91 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 91.89 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 91.88 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 91.86 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 91.83 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 91.76 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 91.75 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 91.72 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 91.65 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 91.63 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 91.58 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 91.46 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 91.45 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 91.21 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 91.19 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 91.16 | |
| d1z84a1 | 173 | Galactose-1-phosphate uridylyltransferase {Thale c | 91.16 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 91.07 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 91.01 | |
| d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 90.95 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 90.87 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 90.83 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 90.8 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 90.79 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 90.72 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 90.69 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 90.61 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 90.61 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 90.57 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 90.51 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 90.48 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 90.43 | |
| d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 90.41 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 90.38 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 90.3 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 90.29 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 90.23 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 90.18 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 90.16 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 90.14 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 90.06 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 89.96 | |
| d2ctda2 | 30 | Zinc finger protein 512, ZNF512 {Human (Homo sapie | 89.86 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 89.79 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 89.73 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 89.73 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 89.71 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 89.59 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 89.4 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 89.35 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 89.22 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 89.17 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 89.14 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 89.13 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 89.12 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 89.1 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 89.06 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 89.03 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 89.02 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 89.0 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 88.92 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 88.78 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 88.77 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 88.77 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 88.63 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 88.63 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 88.58 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 88.49 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 88.49 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 88.44 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 88.39 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 88.18 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 88.13 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 88.12 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 87.99 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 87.94 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 87.83 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 87.69 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 87.66 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 87.64 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 87.64 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 87.47 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 87.45 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 87.32 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 87.28 | |
| d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 87.22 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 87.2 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 87.08 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 87.08 | |
| d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 86.87 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 86.86 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 86.54 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 86.35 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 86.29 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 86.26 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 86.03 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 85.89 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 85.79 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 85.73 | |
| d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 85.35 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 84.96 | |
| d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 84.73 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 84.65 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 84.63 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 84.56 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 84.52 | |
| d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 84.3 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 83.95 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 83.07 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 83.0 | |
| d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 82.98 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 82.89 | |
| d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 82.64 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 82.45 | |
| d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 81.97 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 81.76 | |
| d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 81.62 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 81.11 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 80.91 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 80.68 |
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Nucleotide and nucleoside kinases domain: 5' polynucleotide kinase-3' phosphatase, C-terminal domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.89 E-value=3.9e-23 Score=201.57 Aligned_cols=141 Identities=24% Similarity=0.360 Sum_probs=127.8
Q ss_pred ccCccEEEEEEcCCCCcHHHHHHHHHHHcCCCeEEEecccccCCCCCcHHHHHHHHHHHHHCCCcEEEeCCCCCHHHHHH
Q 004319 16 KKWKQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTSASSALKKGKSVFLDRCNLEREQRTD 95 (761)
Q Consensus 16 ~~~~~~LIvLvG~PGSGKSTfA~~L~~~~~~~~~~I~~D~i~~~~~~~~~~~~~~~~~~L~~g~~VIID~tn~~~~~R~~ 95 (761)
..+.|.||+|+|+|||||||||++++...+ +.+|+.|.+ .++..+...+..+|..|.+||+|+||....+|..
T Consensus 10 ~~~~p~liil~G~pGsGKST~a~~l~~~~~--~~~i~~D~~-----~~~~~~~~~~~~~l~~g~~vIiD~t~~~~~~R~~ 82 (172)
T d1yj5a2 10 LSPNPEVVVAVGFPGAGKSTFIQEHLVSAG--YVHVNRDTL-----GSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRAR 82 (172)
T ss_dssp SCSSCCEEEEECCTTSSHHHHHHHHTGGGT--CEEEEHHHH-----CSHHHHHHHHHHHHHTTCCEEEESCCCSHHHHHH
T ss_pred CCCCCEEEEEECCCCCCHHHHHHHHHHhcC--CEEEchHHH-----HHHHHHHHHHHHHHHCCCCceeeCcCCCHHHHHH
Confidence 457899999999999999999999998887 889999998 4577788999999999999999999999999999
Q ss_pred HHHh-CCCCceEEEEEEeCCHHHHHHHHHhcccccCCCCCCChHHHHHHHHhhhcCCCccCCceEEEEcC
Q 004319 96 FVKL-GGPEVDVHAVVLDLPAKLCISRSVKRIEHEGNLQGGKAAAVVNRMLQKKELPKLSEGFSRITLCQ 164 (761)
Q Consensus 96 ~~~l-~~~~~~v~vV~Ld~p~e~~~~R~~~R~~~~~~~~~~v~~~vI~r~~~~~e~P~~~EgFd~V~vv~ 164 (761)
|+++ +.+++.+++|+|++|.++|.+|+.+|..+... ...+++.++.+|.+.|++|...|||+.|+.++
T Consensus 83 ~~~~a~~~~~~~~~v~l~~~~e~~~~Rn~~R~~~~~~-~~~v~~~~~~~~~~~fe~P~~~Egf~~i~~i~ 151 (172)
T d1yj5a2 83 YIQCAKDAGVPCRCFNFCATIEQARHNNRFREMTDPS-HAPVSDMVMFSYRKQFEPPTLAEGFLEILEIP 151 (172)
T ss_dssp HHHHHHHHTCCEEEEEECCCHHHHHHHHHHHHHHCTT-CCCCCHHHHHHHHHHCCCCCGGGSCSCEEEEC
T ss_pred HHHHHHhcCCCEEEEEeCCCHHHHHHHHHHhcccCcc-cCccHHHHHHHHHHhCCCCCcccCCcEEEEEC
Confidence 9999 88999999999999999999999999765332 23588999999999999999999999999875
|
| >d1yd9a1 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1spva_ c.50.1.2 (A:) Hypothetical protein YmbD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]} | Back information, alignment and structure |
|---|
| >d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1njra_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fg1a1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1yd9a1 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1spva_ c.50.1.2 (A:) Hypothetical protein YmbD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]} | Back information, alignment and structure |
|---|
| >d1njra_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d2fg1a1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2pofa1 d.13.1.4 (A:31-250) CDP-diacylglycerol pyrophosphatase CDH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|