Citrus Sinensis ID: 004319


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-
MDTDIDDTCKAKDEEKKWKQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTSASSALKKGKSVFLDRCNLEREQRTDFVKLGGPEVDVHAVVLDLPAKLCISRSVKRIEHEGNLQGGKAAAVVNRMLQKKELPKLSEGFSRITLCQNENDVQAALDTYSGLGPLDTLPHGSFGQKNPDAKIQLGIMKFLKKVDAPSNTGSTASSTQDPVPPQITEEKNSCLEGQEITSLLSDAAGEEVKGTENPEVASVNQNGSSSDVPTLAFPSLSTSDFQFNNEKASDVIIEKVEEFVNKLGNARLVLVDLTQGSKILSLVRAKAAQKHINPKKFFTFVGDITRLYTGGGLCCNVIANAANWRLKPGGGGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVIHVLGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEKLSKGCNEDIRLEPSVSQDHSEDVHGNYISTGDKIKRDGGHEYEQSKKCKTQNEVGTDINLSRAANLSADNEKIGVSTSKAWGSWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLDRLADVRNEHLQILQTMHAVGMKWAEKFLHEDASLAFRLGYHSAPSMRQLHLHVISQDFNSKHLKNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRCHRCRSAHPSIPRLKSHISSCRAPFPSSLLENGRLMLAPRNTAQP
ccccccccccccccccccccEEEEEEccccccHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccccEEEEEcccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEEccccccccccccEEEEEcccccccccccccccHHHHHHccHHHHHHHHHHHcccccccEEEEEccccccccccccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccEEEEcccEEEEEccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHccccccccccccccccHHHHHHHHHHHHccccccccccccEEccccccccc
ccccccccccccccccccccEEEEEEccccccccHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccEEEEEEcccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccHHccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHcccccHcEEEEEccHHHHcccccccHHHEEEcHcccccccccHHHHHHHHHccHHHHHHHHHHHcccccccEEEEEcccccccccccccEEEEEEEccccccccccHccccHHHHHHHHHHHHHHHHHHHHHHHHcHHcccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccHHccccEEEEcccEEEEEccccccEEEEEEEccccccccHHHccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccEEEEEEcccccHcccccccccccccccEEcHHHHHHHHHHccccccccHHHHHccccEEcccccccccHHHHHHHHHHccccccHHHHccccEEEcccccccc
MDTDIDDTCKAKDEEKKWKQILVIMVgapgsgkstFCEHVMRSSARPWARICQDtinkgksgtkvQCLTSASSAlkkgksvfldrcnlereqrtdfvklggpevdvHAVVLDLPAKLCISRSVKRiehegnlqggKAAAVVNRMLQkkelpklsegfsriTLCQNENDVQAALDtysglgpldtlphgsfgqknpdAKIQLGIMKFLkkvdapsntgstasstqdpvppqiteeknsclegqEITSLLSdaageevkgtenpevasvnqngsssdvptlafpslstsdfqfnnekaSDVIIEKVEEFVNKLGNARLVLVDLTQGSKILSLVRAKAAQkhinpkkfftfvgDITRLYTGGGLCCNVIANAanwrlkpggggvnaAIFSAAGPALEVATAErakslypgnsvivplpstsplcgregvTHVIHvlgpnmnprrpncldgdyvKGCEILRKAYTSLFEGFLSIVRSQEKlskgcnedirlepsvsqdhsedvhgnyistgdkikrdggheyeqskkcktqnevgtdinlsraanlsadnekigvstSKAWGSWAQALYRTamyperhkddlleisddvvvLNDLYPKAQKHILVLSRFDGLDRLADVRNEHLQILQTMHAVGMKWAEKFLHEDASLAFRlgyhsapsmrQLHLHVISqdfnskhlknkkhwnsfntaffcdsVDVLEEISNHGKATLKDYDSLLSMELRchrcrsahpsiprlkshisscrapfpssllengrlmlaprntaqp
mdtdiddtckakdeekkwkQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTinkgksgtkvQCLTSassalkkgksvfldrcnLEREQRTDFVKLGGPEVDVHAVVLDLPAKLCISRSVKRiehegnlqggkaaAVVNRMLQKKELPKLSEGFSRITLCQNENDVQAALDTYSGLGPLDTLPHGSFGQKNPDAKIQLGIMKFLKKVDAPSNTgstasstqdpvppQITEEKNSCLEGQEITSLLSDAAGEEVKGTENPEVASVNQNGSSSDVPTLAFPSLSTSDFQFNNEKASDVIIEKVEEFVNKLGNARLVLVDLTQGSKILSLVRAkaaqkhinpkkfftfvGDITRLYTGGGLCCNVIANAANWRLKPGGGGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVIHvlgpnmnprrpnCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEKLSKGCNEDIRlepsvsqdhsedvhgnYISTGDKIKRDGGHEyeqskkcktqnevgtdinlsraanlsadnekigvstskawgsWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLDRLADVRNEHLQILQTMHAVGMKWAEKFLHEDASLAFRLGYHSAPSMRQLHLHVISQDFNSKHLKNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRCHRCRSAHpsiprlkshissCRAPFPssllengrlmlaprntaqp
MDTDIDDTCKAKDEEKKWKQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTSASSALKKGKSVFLDRCNLEREQRTDFVKLGGPEVDVHAVVLDLPAKLCISRSVKRIEHEGNLQGGKAAAVVNRMLQKKELPKLSEGFSRITLCQNENDVQAALDTYSGLGPLDTLPHGSFGQKNPDAKIQLGIMKFLKKVDAPSNTGSTASSTQDPVPPQITEEKNSCLEGQEITSLLSDAAGEEVKGTENPEVASVNQNGSSSDVPTLAFPSLSTSDFQFNNEKASDVIIEKVEEFVNKLGNARLVLVDLTQGSKILSLVRAKAAQKHINPKKFFTFVGDITRLYTGGGLCCNVIANAANWRLKPGGGGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVIHVLGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEKLSKGCNEDIRLEPSVSQDHSEDVHGNYISTGDKIKRDGGHEYEQSKKCKTQNEVGTDINLSRAANLSADNEKIGVSTSKAWGSWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLDRLADVRNEHLQILQTMHAVGMKWAEKFLHEDASLAFRLGYHSAPSMRQLHLHVISQDFNSKHLKNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRCHRCRSAHPSIPRLKSHISSCRAPFPSSLLENGRLMLAPRNTAQP
****************KWKQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTIN***********************************RTDFVKLGGPEVDVHAVVLDLPAKLCISRSVKRIEHEGNLQGGKAAAVVNRMLQ******LSEGFSRITLCQNENDVQAALDTYSGLGPLDTL************KIQLGIMKFL***************************************************************************************KASDVIIEKVEEFVNKLGNARLVLVDLTQGSKILSLVRAKAAQKHINPKKFFTFVGDITRLYTGGGLCCNVIANAANWRLKPGGGGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVIHVLGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRS***************************************************************************IGVSTSKAWGSWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLDRLADVRNEHLQILQTMHAVGMKWAEKFLHEDASLAFRLGYHSAPSMRQLHLHVISQDFNSKHLKNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRCHRCR****************************************
*********************LVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTSASSALKKGKSVFLDRCNLEREQRTDFVKLGGPEVDVHAVVLDLPAKLCISRSVKRI********GK*AAVVNRMLQKKELPKLSEGFSRITLCQNENDVQAALDTYSGLGPL*************************************************************************************************AFPSLSTSDFQFNNEKASDVIIEKVEEFVNKLGNARLVLVDLTQGSKIL*************PKKFFTFVGDITRLYTGGGLCCNVIANAANWRLKPGGGGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVIHVLGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGFLS********************************************************************************************QALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLDRLADVRNEHLQILQTMHAVGMKWAEKFLHEDASLAFRLGYHSAPSMRQLHLHVISQDF***HLKNKKHWNSFNTAFFCDSVDVLE****************LSMELRCHRCRSAHPSIPRLKSHISSCRAPFPSSLLENG************
MDTDIDDTCKAKDEEKKWKQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTSASSALKKGKSVFLDRCNLEREQRTDFVKLGGPEVDVHAVVLDLPAKLCISRSVKRIEHEGNLQGGKAAAVVNRMLQKKELPKLSEGFSRITLCQNENDVQAALDTYSGLGPLDTLPHGSFGQKNPDAKIQLGIMKFLKKV*******************QITEEKNSCLEGQEITSLLSDA**********PEVASVNQNGSSSDVPTLAFPSLSTSDFQFNNEKASDVIIEKVEEFVNKLGNARLVLVDLTQGSKILSLVRAKAAQKHINPKKFFTFVGDITRLYTGGGLCCNVIANAANWRLKPGGGGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVIHVLGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEKLSKGCNEDIRLEP********DVHGNYISTGDKIKRDGGHEYEQSKKCKTQNEVGTDINLSRAANLSADNEKIGVSTSKAWGSWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLDRLADVRNEHLQILQTMHAVGMKWAEKFLHEDASLAFRLGYHSAPSMRQLHLHVISQDFNSKHLKNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRCHRCRSAHPSIPRLKSHISSCRAPFPSSLLENGRLMLAPRNTAQP
****************KWKQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTSASSALKKGKSVFLDRCNLEREQRTDFVKLGGPEVDVHAVVLDLPAKLCISRSVKRIEHEGNLQGGKAAAVVNRMLQKKELPKLSEGFSRITLCQNENDVQAALDTYSGLGPLDTLPHGSFGQKNPDAKIQLGIMKFLKKVD***************************************************************DVPTLAFPSLSTSDFQFNNEKASDVIIEKVEEFVNKLGNARLVLVDLTQGSKILSLVRAKAAQKHINPKKFFTFVGDITRLYTGGGLCCNVIANAANWRLKPGGGGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVIHVLGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEK********************************************************************************WGSWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLDRLADVRNEHLQILQTMHAVGMKWAEKFLHEDASLAFRLGYHSAPSMRQLHLHVISQDFNSKHLKNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRCHRCRSAHPSIPRLKSHISSCRAPFPSSLLENGRLMLAP******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTDIDDTCKAKDEEKKWKQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTSASSALKKGKSVFLDRCNLEREQRTDFVKLGGPEVDVHAVVLDLPAKLCISRSVKRIEHEGNLQGGKAAAVVNRMLQKKELPKLSEGFSRITLCQNENDVQAALDTYSGLGPLDTLPHGSFGQKNPDAKIQLGIMKFLKKVDAPSNTGSTASSTQDPVPPQITEEKNSCLEGQEITSLLSDAAGEEVKGTENPEVASVNQNGSSSDVPTLAFPSLSTSDFQFNNEKASDVIIEKVEEFVNKLGNARLVLVDLTQGSKILSLVRAKAAQKHINPKKFFTFVGDITRLYTGGGLCCNVIANAANWRLKPGGGGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVIHVLGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEKLSKGCNEDIRLEPSVSQDHSEDVHGNYISTGDKIKRDGGHEYEQSKKCKTQNEVGTDINLSRAANLSADNEKIGVSTSKAWGSWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLDRLADVRNEHLQILQTMHAVGMKWAEKFLHEDASLAFRLGYHSAPSMRQLHLHVISQDFNSKHLKNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRCHRCRSAHPSIPRLKSHISSCRAPFPSSLLENGRLMLAPRNTAQP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query761 2.2.26 [Sep-21-2011]
Q9M041912 Transcription factor bHLH yes no 0.901 0.752 0.591 0.0
Q7TQC5342 Aprataxin OS=Mus musculus yes no 0.244 0.543 0.451 6e-38
P61797342 Aprataxin OS=Canis famili yes no 0.278 0.619 0.417 1e-37
Q8K4H4329 Aprataxin OS=Rattus norve yes no 0.244 0.565 0.451 3e-37
Q9BGQ0356 Aprataxin OS=Macaca fasci N/A no 0.278 0.595 0.417 4e-37
Q7YRZ1356 Aprataxin OS=Sus scrofa G yes no 0.279 0.598 0.406 5e-37
P61798316 Aprataxin (Fragment) OS=G yes no 0.222 0.534 0.472 2e-36
Q7Z2E3356 Aprataxin OS=Homo sapiens yes no 0.277 0.592 0.402 4e-36
P61801347 Aprataxin OS=Xenopus trop yes no 0.235 0.515 0.453 5e-36
Q7YRZ2356 Aprataxin OS=Bos taurus G yes no 0.222 0.474 0.466 5e-36
>sp|Q9M041|BH140_ARATH Transcription factor bHLH140 OS=Arabidopsis thaliana GN=BHLH140 PE=4 SV=1 Back     alignment and function desciption
 Score =  867 bits (2241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/740 (59%), Positives = 543/740 (73%), Gaps = 54/740 (7%)

Query: 14  EEKKWKQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTSASS 73
           E  K KQI+V+++G PGSGKSTFC+  MRSS RPW+RICQD +N GK+GTK QCL  A+ 
Sbjct: 221 EADKAKQIVVLLIGPPGSGKSTFCDTAMRSSHRPWSRICQDIVNNGKAGTKAQCLKMATD 280

Query: 74  ALKKGKSVFLDRCNLEREQRTDFVKLGGPEVDVHAVVLDLPAKLCISRSVKRIEHEGNLQ 133
           +L++GKSVF+DRCNL+REQR++F+KLGGPE +VHAVVL+LPA++CISRSVKR  HEGNLQ
Sbjct: 281 SLREGKSVFIDRCNLDREQRSEFIKLGGPEFEVHAVVLELPAQVCISRSVKRTGHEGNLQ 340

Query: 134 GGKAAAVVNRMLQKKELPKLSEGFSRITLCQNENDVQAALDTYSGLGPLDTLPHGSFGQK 193
           GG+AAAVVN+MLQ KELPK++EGFSRI  C ++ DV  A++ Y+ LGP+DTLP G FG+K
Sbjct: 341 GGRAAAVVNKMLQSKELPKVNEGFSRIMFCYSDADVDNAVNMYNKLGPMDTLPSGCFGEK 400

Query: 194 NPDAKIQLGIMKFLKKVDA-PSNTGSTASSTQDPVPPQITEEKNSCLEGQEITSLLSDAA 252
             D K Q GIMKF KKV A P+++ + A+              N+  +  E+T+      
Sbjct: 401 KLDTKSQPGIMKFFKKVSALPASSSNEAT--------------NTTRKADEMTA------ 440

Query: 253 GEEVKGTENPEVASVNQNGSSSDVPTLAFPSLSTSDFQFNNEKASDVIIEKVEEFVNKLG 312
                   N  V+ V + GS+  VPTLAFPS+ST+DFQF+ EKASD+I+EK EEF++KLG
Sbjct: 441 --------NVRVSPV-KLGSADIVPTLAFPSISTADFQFDLEKASDIIVEKAEEFLSKLG 491

Query: 313 NARLVLVDLTQGSKILSLVRAKAAQKHINPKKFFTFVGDITRLYTGGGLCCNVIANAANW 372
            ARLVLVDL++GSKILSLV+AKA+QK+I+  KFFTFVGDIT+L + GGL CNVIANA NW
Sbjct: 492 TARLVLVDLSRGSKILSLVKAKASQKNIDSAKFFTFVGDITKLRSEGGLHCNVIANATNW 551

Query: 373 RLKPGGGGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVIHV 432
           RLKPGGGGVNAAIF AAGP LE AT  RA +L PG +V+VPLPST PL   EG+THVIHV
Sbjct: 552 RLKPGGGGVNAAIFKAAGPDLETATRVRANTLLPGKAVVVPLPSTCPLHNAEGITHVIHV 611

Query: 433 LGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEKLSKGCNEDIRLEPSVS 492
           LGPNMNP RP+ L+ DY KGC+ LR+AYTSLFEGFLS+V+ Q KL K      R   +  
Sbjct: 612 LGPNMNPNRPDNLNNDYTKGCKTLREAYTSLFEGFLSVVQDQSKLPK------RSSQTAV 665

Query: 493 QDHSEDVHGNYISTGDKIKRDGGHEYEQSKKCKTQNEVGTDINLSRAANLSADNEKIGVS 552
            D  ED           IK D     E++KK K   +     NL   +    D    G  
Sbjct: 666 SDSGED-----------IKEDS----ERNKKYKGSQDKAVTNNLESES--LEDTRGSGKK 708

Query: 553 TSKAWGSWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLDRLA 612
            SK W +WA AL+  AM+PERH++ +LE  D++VV+ND YPKA+KH+LVL+R + LD L 
Sbjct: 709 MSKGWNTWALALHSIAMHPERHENVVLEYLDNIVVINDQYPKARKHVLVLARQESLDGLE 768

Query: 613 DVRNEHLQILQTMHAVGMKWAEKFLHEDASLAFRLGYHSAPSMRQLHLHVISQDFNSKHL 672
           DVR E+LQ+LQ MH VG+KW ++F +EDASL FRLGYHS PSMRQLHLHVISQDFNS  L
Sbjct: 769 DVRKENLQLLQEMHNVGLKWVDRFQNEDASLIFRLGYHSVPSMRQLHLHVISQDFNSDSL 828

Query: 673 KNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRCHRCRSAHPSIPRLKS 732
           KNKKHWNSF T+FF DSVDVLEE+++ GKA +   D LL  ELRC+RCRSAHP+IP+LKS
Sbjct: 829 KNKKHWNSFTTSFFRDSVDVLEEVNSQGKANVASED-LLKGELRCNRCRSAHPNIPKLKS 887

Query: 733 HISSCRAPFPSSLLENGRLM 752
           H+ SC + FP  LL+N RL+
Sbjct: 888 HVRSCHSQFPDHLLQNNRLV 907





Arabidopsis thaliana (taxid: 3702)
>sp|Q7TQC5|APTX_MOUSE Aprataxin OS=Mus musculus GN=Aptx PE=2 SV=2 Back     alignment and function description
>sp|P61797|APTX_CANFA Aprataxin OS=Canis familiaris GN=APTX PE=2 SV=1 Back     alignment and function description
>sp|Q8K4H4|APTX_RAT Aprataxin OS=Rattus norvegicus GN=Aptx PE=2 SV=1 Back     alignment and function description
>sp|Q9BGQ0|APTX_MACFA Aprataxin OS=Macaca fascicularis GN=APTX PE=2 SV=1 Back     alignment and function description
>sp|Q7YRZ1|APTX_PIG Aprataxin OS=Sus scrofa GN=APTX PE=2 SV=1 Back     alignment and function description
>sp|P61798|APTX_CHICK Aprataxin (Fragment) OS=Gallus gallus GN=APTX PE=2 SV=1 Back     alignment and function description
>sp|Q7Z2E3|APTX_HUMAN Aprataxin OS=Homo sapiens GN=APTX PE=1 SV=2 Back     alignment and function description
>sp|P61801|APTX_XENTR Aprataxin OS=Xenopus tropicalis GN=aptx PE=2 SV=1 Back     alignment and function description
>sp|Q7YRZ2|APTX_BOVIN Aprataxin OS=Bos taurus GN=APTX PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query761
359481176734 PREDICTED: transcription factor bHLH140- 0.944 0.979 0.693 0.0
224140455718 predicted protein [Populus trichocarpa] 0.936 0.993 0.692 0.0
255579308749 aprataxin, putative [Ricinus communis] g 0.930 0.945 0.690 0.0
356496191734 PREDICTED: transcription factor bHLH140- 0.943 0.978 0.650 0.0
296081123678 unnamed protein product [Vitis vinifera] 0.879 0.986 0.647 0.0
147867251 864 hypothetical protein VITISV_005888 [Viti 0.963 0.848 0.640 0.0
449440255712 PREDICTED: transcription factor bHLH140- 0.919 0.983 0.633 0.0
449483719712 PREDICTED: transcription factor bHLH140- 0.919 0.983 0.633 0.0
15240948 912 aprataxin [Arabidopsis thaliana] gi|7533 0.901 0.752 0.591 0.0
297810265 898 basic helix-loop-helix family protein [A 0.919 0.779 0.579 0.0
>gi|359481176|ref|XP_002270443.2| PREDICTED: transcription factor bHLH140-like [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1050 bits (2714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/747 (69%), Positives = 605/747 (80%), Gaps = 28/747 (3%)

Query: 11  AKDEEKKWKQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTS 70
           +K+ E + K I+V+++GAPGSGKSTFCEHV+RSS RPW R+CQDTI  GK+GTK QCL S
Sbjct: 7   SKEGEGQGKPIVVLLMGAPGSGKSTFCEHVIRSSTRPWVRVCQDTIGNGKAGTKSQCLKS 66

Query: 71  ASSALKKGKSVFLDRCNLEREQRTDFVKLGGPEVDVHAVVLDLPAKLCISRSVKRIEHEG 130
           A+SAL+ GKSVF+DRCNL+REQR +FVKLG P+V++HAVVLDLPA+LCISRSVKR  HEG
Sbjct: 67  ATSALEDGKSVFIDRCNLDREQRAEFVKLGSPQVEMHAVVLDLPAQLCISRSVKRTGHEG 126

Query: 131 NLQGGKAAAVVNRMLQKKELPKLSEGFSRITLCQNENDVQAALDTYSGLGPLDTLPHGSF 190
           NLQGGKAAAVVNRMLQKKELPKLSEGF RIT CQN++DVQ AL+TYS L  LDTLP G F
Sbjct: 127 NLQGGKAAAVVNRMLQKKELPKLSEGFHRITFCQNDSDVQTALNTYSALSHLDTLPPGCF 186

Query: 191 GQKNPDAKIQLGIMKFLKKVDAPSNTGSTASSTQDPVPPQITEEKNSCLEGQEITSLLSD 250
           GQKNPDAKIQLGIMKFLKKV+ P N G   SS                          S 
Sbjct: 187 GQKNPDAKIQLGIMKFLKKVEVPVNVGEDISS--------------------------SS 220

Query: 251 AAGEEVKGTENPEVASVNQNGSSSDVPTLAFPSLSTSDFQFNNEKASDVIIEKVEEFVNK 310
              +E+KG E+  V SV+   SS D+PTLAFPS+ST+DFQFN+EKA+D+I+EKVEEFVNK
Sbjct: 221 GNAKEIKGGEDIVVHSVDGTVSSKDIPTLAFPSISTADFQFNHEKAADIILEKVEEFVNK 280

Query: 311 LGNARLVLVDLTQGSKILSLVRAKAAQKHINPKKFFTFVGDITRLYTGGGLCCNVIANAA 370
           + NARLVLVDL+ GSKILSLVRAKAAQ++I+  KFFTFVGDITRLY+ GGL CN IANAA
Sbjct: 281 VENARLVLVDLSHGSKILSLVRAKAAQRNIDSNKFFTFVGDITRLYSKGGLRCNAIANAA 340

Query: 371 NWRLKPGGGGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVI 430
           NWRLKPGGGG NAAIFSAAGP LEV T +RA SL PG +++VPLPSTSPL  REGVTHVI
Sbjct: 341 NWRLKPGGGGANAAIFSAAGPELEVETKKRAGSLIPGKALVVPLPSTSPLFSREGVTHVI 400

Query: 431 HVLGPNMNPRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEKLSKGCNEDIRLEPS 490
           HVLGPNMN +RPNCL+ DYVKG ++LR+AYTSLFEGF SI+ +Q  L +G +E++R E S
Sbjct: 401 HVLGPNMNRQRPNCLNNDYVKGSKVLREAYTSLFEGFASIMNTQGNLLEGSSENLRSELS 460

Query: 491 VSQDHSEDVHGNYISTGD-KIKRDGGHEYEQSKKCKT-QNEVGTDINLSRAANLSADNEK 548
           VSQDH +  H   +   D KIKR G +E E SKKCK  Q+E   D   S+      +NEK
Sbjct: 461 VSQDHFKGNHIKNVPNHDQKIKRVGVYESETSKKCKGFQDEHEFDCTESKEGKDKLNNEK 520

Query: 549 IGVSTSKAWGSWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGL 608
           IG + +K WGSWAQ+LY  AM+PE+HKD+L+EISDDVVVLNDLYPKAQ+H+LVL+R +GL
Sbjct: 521 IGRNMTKTWGSWAQSLYHIAMHPEKHKDNLIEISDDVVVLNDLYPKAQRHLLVLARSEGL 580

Query: 609 DRLADVRNEHLQILQTMHAVGMKWAEKFLHEDASLAFRLGYHSAPSMRQLHLHVISQDFN 668
           D LADV  EHLQ+L+TMHAVG+KWAEKFL ED  L FR+GYHSAPSMRQLHLHVISQDFN
Sbjct: 581 DCLADVGGEHLQLLRTMHAVGLKWAEKFLCEDELLVFRIGYHSAPSMRQLHLHVISQDFN 640

Query: 669 SKHLKNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRCHRCRSAHPSIP 728
           SKHLKNKKHWNSFN+AFF DSVDV+EEI+NHG+AT+K  DS LSMELRCHRCRSAHP++P
Sbjct: 641 SKHLKNKKHWNSFNSAFFRDSVDVIEEITNHGRATIKGEDSQLSMELRCHRCRSAHPNMP 700

Query: 729 RLKSHISSCRAPFPSSLLENGRLMLAP 755
           RLKSHIS+C+A FP SLL+N RL+LAP
Sbjct: 701 RLKSHISNCQASFPPSLLQNDRLVLAP 727




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224140455|ref|XP_002323598.1| predicted protein [Populus trichocarpa] gi|222868228|gb|EEF05359.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255579308|ref|XP_002530499.1| aprataxin, putative [Ricinus communis] gi|223529956|gb|EEF31883.1| aprataxin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356496191|ref|XP_003516953.1| PREDICTED: transcription factor bHLH140-like [Glycine max] Back     alignment and taxonomy information
>gi|296081123|emb|CBI18255.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147867251|emb|CAN83280.1| hypothetical protein VITISV_005888 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449440255|ref|XP_004137900.1| PREDICTED: transcription factor bHLH140-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449483719|ref|XP_004156669.1| PREDICTED: transcription factor bHLH140-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15240948|ref|NP_195751.1| aprataxin [Arabidopsis thaliana] gi|75335734|sp|Q9M041.1|BH140_ARATH RecName: Full=Transcription factor bHLH140; AltName: Full=Basic helix-loop-helix protein 140; Short=AtbHLH140; Short=bHLH 140; AltName: Full=Transcription factor EN 122; AltName: Full=bHLH transcription factor bHLH140 gi|7320709|emb|CAB81914.1| putative protein [Arabidopsis thaliana] gi|332002943|gb|AED90326.1| aprataxin [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297810265|ref|XP_002873016.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. lyrata] gi|297318853|gb|EFH49275.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query761
TAIR|locus:2179122912 APTX "APRATAXIN-like" [Arabido 0.325 0.271 0.648 2e-230
MGI|MGI:1913658342 Aptx "aprataxin" [Mus musculus 0.244 0.543 0.451 3.8e-39
UNIPROTKB|F1SE72342 APTX "Aprataxin" [Sus scrofa ( 0.307 0.684 0.4 9.8e-38
RGD|628740329 Aptx "aprataxin" [Rattus norve 0.265 0.613 0.432 1.3e-37
UNIPROTKB|F1LMH1331 Aptx "Aprataxin" [Rattus norve 0.265 0.610 0.432 1.3e-37
UNIPROTKB|Q8K4H4329 Aptx "Aprataxin" [Rattus norve 0.265 0.613 0.432 1.3e-37
UNIPROTKB|P61797342 APTX "Aprataxin" [Canis lupus 0.278 0.619 0.417 1.6e-37
UNIPROTKB|F1PHH9352 APTX "Aprataxin" [Canis lupus 0.278 0.602 0.417 2.7e-37
UNIPROTKB|J9P6H4342 APTX "Aprataxin" [Canis lupus 0.278 0.619 0.417 2.7e-37
UNIPROTKB|Q7YRZ1356 APTX "Aprataxin" [Sus scrofa ( 0.307 0.657 0.395 3.4e-37
TAIR|locus:2179122 APTX "APRATAXIN-like" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 799 (286.3 bits), Expect = 2.0e-230, Sum P(3) = 2.0e-230
 Identities = 164/253 (64%), Positives = 196/253 (77%)

Query:   259 TENPEVASVNQNGSSSDVPTLAFPSLSTSDFQFNNEKASDVIIEKVEEFVNKLGNARLVL 318
             T N  V+ V   GS+  VPTLAFPS+ST+DFQF+ EKASD+I+EK EEF++KLG ARLVL
Sbjct:   439 TANVRVSPVKL-GSADIVPTLAFPSISTADFQFDLEKASDIIVEKAEEFLSKLGTARLVL 497

Query:   319 VDLTQGSKILSLVRAKAAQKHINPKKFFTFVGDITRLYTGGGLCCNVIANAANWRLKPGG 378
             VDL++GSKILSLV+AKA+QK+I+  KFFTFVGDIT+L + GGL CNVIANA NWRLKPGG
Sbjct:   498 VDLSRGSKILSLVKAKASQKNIDSAKFFTFVGDITKLRSEGGLHCNVIANATNWRLKPGG 557

Query:   379 GGVNAAIFSAAGPALEVATAERAKSLYPGNSVIVPLPSTSPLCGREGVTHVIHVLGPNMN 438
             GGVNAAIF AAGP LE AT  RA +L PG +V+VPLPST PL   EG+THVIHVLGPNMN
Sbjct:   558 GGVNAAIFKAAGPDLETATRVRANTLLPGKAVVVPLPSTCPLHNAEGITHVIHVLGPNMN 617

Query:   439 PRRPNCLDGDYVKGCEILRKAYTSLFEGFLSIVRSQEKLSKGCNEDIRLEPSVSQDHSED 498
             P RP+ L+ DY KGC+ LR+AYTSLFEGFLS+V+ Q KL K  ++   +  S  +D  ED
Sbjct:   618 PNRPDNLNNDYTKGCKTLREAYTSLFEGFLSVVQDQSKLPKRSSQTA-VSDS-GEDIKED 675

Query:   499 VHGN--YISTGDK 509
                N  Y  + DK
Sbjct:   676 SERNKKYKGSQDK 688


GO:0003824 "catalytic activity" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
GO:0006790 "sulfur compound metabolic process" evidence=IDA
GO:0009150 "purine ribonucleotide metabolic process" evidence=IDA
GO:0047627 "adenylylsulfatase activity" evidence=IDA
GO:0000278 "mitotic cell cycle" evidence=RCA
GO:0006259 "DNA metabolic process" evidence=RCA
GO:0006310 "DNA recombination" evidence=RCA
GO:0006396 "RNA processing" evidence=RCA
GO:0007062 "sister chromatid cohesion" evidence=RCA
GO:0007126 "meiosis" evidence=RCA
GO:0007131 "reciprocal meiotic recombination" evidence=RCA
GO:0010332 "response to gamma radiation" evidence=RCA
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0032204 "regulation of telomere maintenance" evidence=RCA
GO:0033044 "regulation of chromosome organization" evidence=RCA
GO:0042138 "meiotic DNA double-strand break formation" evidence=RCA
GO:0043247 "telomere maintenance in response to DNA damage" evidence=RCA
GO:0045132 "meiotic chromosome segregation" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
MGI|MGI:1913658 Aptx "aprataxin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SE72 APTX "Aprataxin" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|628740 Aptx "aprataxin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LMH1 Aptx "Aprataxin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8K4H4 Aptx "Aprataxin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P61797 APTX "Aprataxin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PHH9 APTX "Aprataxin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6H4 APTX "Aprataxin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q7YRZ1 APTX "Aprataxin" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M041BH140_ARATHNo assigned EC number0.59180.90140.7521yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query761
pfam13671143 pfam13671, AAA_33, AAA domain 1e-27
pfam11969113 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme 1e-24
cd01278104 cd01278, aprataxin_related, aprataxin related: Apr 1e-16
cd02908165 cd02908, Macro_Appr_pase_like, Macro domain, Appr- 2e-11
TIGR01663526 TIGR01663, PNK-3'Pase, polynucleotide 5'-kinase 3' 6e-10
smart00506133 smart00506, A1pp, Appr-1"-p processing enzyme 1e-09
pfam01661117 pfam01661, Macro, Macro domain 2e-09
COG2110179 COG2110, COG2110, Predicted phosphatase homologous 3e-09
COG4639168 COG4639, COG4639, Predicted kinase [General functi 2e-08
PRK00431177 PRK00431, PRK00431, RNase III inhibitor; Provision 3e-08
TIGR04075851 TIGR04075, bacter_Pnkp, polynucleotide kinase-phos 7e-08
cd02907175 cd02907, Macro_Af1521_BAL_like, Macro domain, Af15 1e-07
cd02749147 cd02749, Macro, Macro domain, a high-affinity ADP- 3e-07
cd02903137 cd02903, Macro_BAL_like, Macro domain, BAL_like fa 9e-07
pfam0123097 pfam01230, HIT, HIT domain 6e-06
cd01276104 cd01276, PKCI_related, Protein Kinase C Interactin 0.004
>gnl|CDD|222307 pfam13671, AAA_33, AAA domain Back     alignment and domain information
 Score =  108 bits (272), Expect = 1e-27
 Identities = 45/146 (30%), Positives = 65/146 (44%), Gaps = 19/146 (13%)

Query: 22  LVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKV---------------Q 66
           L++MVG PGSGKSTF   ++R        +  DT+ K   G                  +
Sbjct: 1   LILMVGLPGSGKSTFARRLLR--ELGAVVLSSDTLRKRLRGDGPPDISYYARASGRVYQR 58

Query: 67  CLTSASSALKKGKSVFLDRCNLEREQRTDFVKLG-GPEVDVHAVVLDLPAKLCISRSVKR 125
            L  A  AL+ G+ V +D  NL RE+R   + L       V  V L+ P ++   R+ +R
Sbjct: 59  LLELAREALRAGRPVIVDATNLSREERARLIDLARRYGAPVRIVYLEAPEEVLRERNAQR 118

Query: 126 IEHEGNLQGGKAAAVVNRMLQKKELP 151
            E  G        AV++RML + E P
Sbjct: 119 -ERSGGDPSDVPEAVLDRMLARFEPP 143


This family of domains contain only a P-loop motif, that is characteristic of the AAA superfamily. Many of the proteins in this family are just short fragments so there is no Walker B motif. Length = 143

>gnl|CDD|221348 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme C-term binding Back     alignment and domain information
>gnl|CDD|238609 cd01278, aprataxin_related, aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>gnl|CDD|239236 cd02908, Macro_Appr_pase_like, Macro domain, Appr-1"-pase_like family Back     alignment and domain information
>gnl|CDD|130724 TIGR01663, PNK-3'Pase, polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>gnl|CDD|214701 smart00506, A1pp, Appr-1"-p processing enzyme Back     alignment and domain information
>gnl|CDD|216634 pfam01661, Macro, Macro domain Back     alignment and domain information
>gnl|CDD|225021 COG2110, COG2110, Predicted phosphatase homologous to the C-terminal domain of histone macroH2A1 [General function prediction only] Back     alignment and domain information
>gnl|CDD|226986 COG4639, COG4639, Predicted kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234759 PRK00431, PRK00431, RNase III inhibitor; Provisional Back     alignment and domain information
>gnl|CDD|234457 TIGR04075, bacter_Pnkp, polynucleotide kinase-phosphatase Back     alignment and domain information
>gnl|CDD|239235 cd02907, Macro_Af1521_BAL_like, Macro domain, Af1521- and BAL-like family Back     alignment and domain information
>gnl|CDD|239150 cd02749, Macro, Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases) Back     alignment and domain information
>gnl|CDD|239231 cd02903, Macro_BAL_like, Macro domain, BAL_like family Back     alignment and domain information
>gnl|CDD|216377 pfam01230, HIT, HIT domain Back     alignment and domain information
>gnl|CDD|238607 cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 761
KOG0562184 consensus Predicted hydrolase (HIT family) [Genera 100.0
cd02905140 Macro_GDAP2_like Macro domain, GDAP2_like family. 99.95
cd02904186 Macro_H2A_like Macro domain, Macro_H2A_like family 99.94
PF11969116 DcpS_C: Scavenger mRNA decapping enzyme C-term bin 99.94
PRK04143264 hypothetical protein; Provisional 99.92
cd02906147 Macro_1 Macro domain, Unknown family 1. The macro 99.91
cd02908165 Macro_Appr_pase_like Macro domain, Appr-1"-pase_li 99.9
cd02907175 Macro_Af1521_BAL_like Macro domain, Af1521- and BA 99.89
PRK00431177 RNase III inhibitor; Provisional 99.88
cd02903137 Macro_BAL_like Macro domain, BAL_like family. The 99.88
COG2110179 Predicted phosphatase homologous to the C-terminal 99.87
KOG4359166 consensus Protein kinase C inhibitor-like protein 99.84
cd03330133 Macro_2 Macro domain, Unknown family 2. The macro 99.83
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 99.79
COG4639168 Predicted kinase [General function prediction only 99.74
KOG3275127 consensus Zinc-binding protein of the histidine tr 99.74
PRK10687119 purine nucleoside phosphoramidase; Provisional 99.73
cd01278104 aprataxin_related aprataxin related: Aprataxin, a 99.72
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 99.71
smart00506133 A1pp Appr-1"-p processing enzyme. Function determi 99.71
cd02749147 Macro Macro domain, a high-affinity ADP-ribose bin 99.7
cd01276104 PKCI_related Protein Kinase C Interacting protein 99.67
COG0537138 Hit Diadenosine tetraphosphate (Ap4A) hydrolase an 99.66
cd02900186 Macro_Appr_pase Macro domain, Appr-1"-pase family. 99.66
KOG2633200 consensus Hismacro and SEC14 domain-containing pro 99.64
PF0123098 HIT: HIT domain; InterPro: IPR001310 The Histidine 99.62
PRK13341725 recombination factor protein RarA/unknown domain f 99.61
PRK06762166 hypothetical protein; Provisional 99.6
PF01661118 Macro: Macro domain; InterPro: IPR002589 The Macro 99.59
PHA02530300 pseT polynucleotide kinase; Provisional 99.59
COG4088261 Predicted nucleotide kinase [Nucleotide transport 99.58
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 99.57
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 99.55
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 99.51
cd0046886 HIT_like HIT family: HIT (Histidine triad) protein 99.49
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 99.47
KOG3354191 consensus Gluconate kinase [Carbohydrate transport 99.46
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 99.46
cd02904186 Macro_H2A_like Macro domain, Macro_H2A_like family 99.44
cd01277103 HINT_subgroup HINT (histidine triad nucleotide-bin 99.42
cd01275126 FHIT FHIT (fragile histidine family): FHIT protein 99.41
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 99.37
PRK04143264 hypothetical protein; Provisional 99.36
PRK14527191 adenylate kinase; Provisional 99.36
KOG3079195 consensus Uridylate kinase/adenylate kinase [Nucle 99.35
PRK14531183 adenylate kinase; Provisional 99.34
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 99.31
PRK14532188 adenylate kinase; Provisional 99.3
COG0645170 Predicted kinase [General function prediction only 99.29
cd02905140 Macro_GDAP2_like Macro domain, GDAP2_like family. 99.28
cd02901140 Macro_Poa1p_like Macro domain, Poa1p_like family. 99.27
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 99.26
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 99.22
PLN02674244 adenylate kinase 99.21
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 99.21
PRK00279215 adk adenylate kinase; Reviewed 99.2
PLN02200234 adenylate kinase family protein 99.2
PRK09825176 idnK D-gluconate kinase; Provisional 99.19
PF08303168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 99.19
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 99.19
PRK11545163 gntK gluconate kinase 1; Provisional 99.18
PRK13808333 adenylate kinase; Provisional 99.15
PRK14529223 adenylate kinase; Provisional 99.15
PRK14530215 adenylate kinase; Provisional 99.14
KOG2134422 consensus Polynucleotide kinase 3' phosphatase [Re 99.14
PRK14528186 adenylate kinase; Provisional 99.14
TIGR00209347 galT_1 galactose-1-phosphate uridylyltransferase, 99.13
KOG3379150 consensus Diadenosine polyphosphate hydrolase and 99.13
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 99.11
PRK02496184 adk adenylate kinase; Provisional 99.11
PRK11720346 galactose-1-phosphate uridylyltransferase; Provisi 99.1
cd02906147 Macro_1 Macro domain, Unknown family 1. The macro 99.09
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 99.09
cd02908165 Macro_Appr_pase_like Macro domain, Appr-1"-pase_li 99.08
PRK06217183 hypothetical protein; Validated 99.08
PLN02459261 probable adenylate kinase 99.07
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 99.06
PRK14526211 adenylate kinase; Provisional 99.04
cd02907175 Macro_Af1521_BAL_like Macro domain, Af1521- and BA 99.03
PTZ00088229 adenylate kinase 1; Provisional 99.03
cd02903137 Macro_BAL_like Macro domain, BAL_like family. The 99.02
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 99.01
PRK08118167 topology modulation protein; Reviewed 99.0
PRK07261171 topology modulation protein; Provisional 99.0
KOG3062281 consensus RNA polymerase II elongator associated p 98.98
KOG2134422 consensus Polynucleotide kinase 3' phosphatase [Re 98.97
COG0703172 AroK Shikimate kinase [Amino acid transport and me 98.97
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 98.96
cd00608329 GalT Galactose-1-phosphate uridyl transferase (Gal 98.94
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 98.94
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 98.91
COG0529197 CysC Adenylylsulfate kinase and related kinases [I 98.9
PRK14737186 gmk guanylate kinase; Provisional 98.9
PRK00431177 RNase III inhibitor; Provisional 98.9
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.86
PRK06547172 hypothetical protein; Provisional 98.85
PRK13946184 shikimate kinase; Provisional 98.84
PF01591222 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR0130 98.84
KOG3969310 consensus Uncharacterized conserved protein [Funct 98.84
PLN02643336 ADP-glucose phosphorylase 98.83
PRK13948182 shikimate kinase; Provisional 98.82
PRK03846198 adenylylsulfate kinase; Provisional 98.81
PRK01184184 hypothetical protein; Provisional 98.8
PRK05541176 adenylylsulfate kinase; Provisional 98.8
PLN02842505 nucleotide kinase 98.8
KOG4622291 consensus Predicted nucleotide kinase [General fun 98.79
PRK00131175 aroK shikimate kinase; Reviewed 98.79
PRK00625173 shikimate kinase; Provisional 98.78
PRK13949169 shikimate kinase; Provisional 98.77
PRK13947171 shikimate kinase; Provisional 98.77
PRK00889175 adenylylsulfate kinase; Provisional 98.77
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 98.75
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 98.74
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 98.73
PRK03839180 putative kinase; Provisional 98.72
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 98.71
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 98.71
PRK05480209 uridine/cytidine kinase; Provisional 98.7
PRK05057172 aroK shikimate kinase I; Reviewed 98.7
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.69
PRK06696223 uridine kinase; Validated 98.69
COG4185187 Uncharacterized protein conserved in bacteria [Fun 98.69
PRK08356195 hypothetical protein; Provisional 98.68
COG2110179 Predicted phosphatase homologous to the C-terminal 98.66
PRK12339197 2-phosphoglycerate kinase; Provisional 98.64
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 98.63
PRK14738206 gmk guanylate kinase; Provisional 98.62
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 98.61
PTZ00301210 uridine kinase; Provisional 98.61
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 98.59
PRK03731171 aroL shikimate kinase II; Reviewed 98.56
PRK08233182 hypothetical protein; Provisional 98.55
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 98.55
PRK00300205 gmk guanylate kinase; Provisional 98.54
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 98.52
PRK00081194 coaE dephospho-CoA kinase; Reviewed 98.51
KOG2633200 consensus Hismacro and SEC14 domain-containing pro 98.5
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 98.5
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 98.49
PRK04040188 adenylate kinase; Provisional 98.49
PRK14730195 coaE dephospho-CoA kinase; Provisional 98.47
COG1936180 Predicted nucleotide kinase (related to CMP and AM 98.47
PRK04182180 cytidylate kinase; Provisional 98.46
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 98.44
TIGR00235207 udk uridine kinase. Model contains a number of lon 98.43
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 98.43
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 98.43
PRK07667193 uridine kinase; Provisional 98.42
PRK13975196 thymidylate kinase; Provisional 98.42
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 98.42
PRK14021542 bifunctional shikimate kinase/3-dehydroquinate syn 98.4
TIGR00152188 dephospho-CoA kinase. This model produces scores i 98.39
cd03330133 Macro_2 Macro domain, Unknown family 2. The macro 98.38
PRK13973213 thymidylate kinase; Provisional 98.37
PRK08154309 anaerobic benzoate catabolism transcriptional regu 98.37
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 98.37
PRK00698205 tmk thymidylate kinase; Validated 98.35
PLN02348395 phosphoribulokinase 98.34
PHA02595154 tk.4 hypothetical protein; Provisional 98.32
PRK14732196 coaE dephospho-CoA kinase; Provisional 98.32
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_ 98.31
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 98.29
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 98.29
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 98.28
PLN02422232 dephospho-CoA kinase 98.27
PRK14733204 coaE dephospho-CoA kinase; Provisional 98.27
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 98.26
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 98.25
KOG0635207 consensus Adenosine 5'-phosphosulfate kinase [Inor 98.24
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 98.23
PRK14731208 coaE dephospho-CoA kinase; Provisional 98.23
PRK12338319 hypothetical protein; Provisional 98.23
PLN02924220 thymidylate kinase 98.22
PRK14734200 coaE dephospho-CoA kinase; Provisional 98.18
PRK12337475 2-phosphoglycerate kinase; Provisional 98.18
PLN02199303 shikimate kinase 98.17
PRK04220301 2-phosphoglycerate kinase; Provisional 98.16
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 98.16
PTZ00451244 dephospho-CoA kinase; Provisional 98.15
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 98.14
COG3709192 Uncharacterized component of phosphonate metabolis 98.11
PRK07429327 phosphoribulokinase; Provisional 98.1
PLN02772398 guanylate kinase 98.09
PRK15453290 phosphoribulokinase; Provisional 98.07
PRK05439311 pantothenate kinase; Provisional 98.06
KOG3078235 consensus Adenylate kinase [Nucleotide transport a 98.04
COG5075305 Uncharacterized conserved protein [Function unknow 98.03
PRK13341725 recombination factor protein RarA/unknown domain f 98.02
PRK09270229 nucleoside triphosphate hydrolase domain-containin 97.99
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 97.96
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 97.93
PRK13951488 bifunctional shikimate kinase/3-dehydroquinate syn 97.93
PF01661118 Macro: Macro domain; InterPro: IPR002589 The Macro 97.91
cd02900186 Macro_Appr_pase Macro domain, Appr-1"-pase family. 97.9
PRK06761282 hypothetical protein; Provisional 97.89
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a 97.87
TIGR00554290 panK_bact pantothenate kinase, bacterial type. Sho 97.87
PLN02318656 phosphoribulokinase/uridine kinase 97.84
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 97.84
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 97.81
cd02749147 Macro Macro domain, a high-affinity ADP-ribose bin 97.79
PRK07933213 thymidylate kinase; Validated 97.78
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.77
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 97.76
PF00004132 AAA: ATPase family associated with various cellula 97.76
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 97.74
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 97.72
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 97.71
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 97.69
PRK13974212 thymidylate kinase; Provisional 97.69
PHA00729226 NTP-binding motif containing protein 97.67
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 97.59
PLN02165334 adenylate isopentenyltransferase 97.58
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 97.53
KOG3877393 consensus NADH:ubiquinone oxidoreductase, NDUFA10/ 97.53
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 97.5
smart00506133 A1pp Appr-1"-p processing enzyme. Function determi 97.49
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.48
COG3896205 Chloramphenicol 3-O-phosphotransferase [Defense me 97.38
PRK00023225 cmk cytidylate kinase; Provisional 97.36
COG5324758 Uncharacterized conserved protein [Function unknow 97.34
COG1085338 GalT Galactose-1-phosphate uridylyltransferase [En 97.28
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 97.26
PLN02748468 tRNA dimethylallyltransferase 97.21
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 97.2
cd02901140 Macro_Poa1p_like Macro domain, Poa1p_like family. 97.18
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 97.17
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 97.17
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 97.15
PRK13976209 thymidylate kinase; Provisional 97.12
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 97.1
KOG3308225 consensus Uncharacterized protein of the uridine k 97.09
smart00382148 AAA ATPases associated with a variety of cellular 97.08
KOG3220225 consensus Similar to bacterial dephospho-CoA kinas 97.05
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 97.04
KOG4238627 consensus Bifunctional ATP sulfurylase/adenosine 5 97.03
KOG1384348 consensus tRNA delta(2)-isopentenylpyrophosphate t 97.0
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.97
PRK09087226 hypothetical protein; Validated 96.95
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.86
PRK00771437 signal recognition particle protein Srp54; Provisi 96.86
COG1660286 Predicted P-loop-containing kinase [General functi 96.85
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 96.85
PF02744166 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transf 96.84
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.79
COG0541451 Ffh Signal recognition particle GTPase [Intracellu 96.79
PRK11860661 bifunctional 3-phosphoshikimate 1-carboxyvinyltran 96.77
KOG1969877 consensus DNA replication checkpoint protein CHL12 96.75
PF04677121 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; In 96.74
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 96.68
CHL00195489 ycf46 Ycf46; Provisional 96.66
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 96.65
KOG0707231 consensus Guanylate kinase [Nucleotide transport a 96.65
PRK10867433 signal recognition particle protein; Provisional 96.64
PF13173128 AAA_14: AAA domain 96.64
cd03115173 SRP The signal recognition particle (SRP) mediates 96.6
PRK14974336 cell division protein FtsY; Provisional 96.56
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 96.53
PLN02840421 tRNA dimethylallyltransferase 96.53
PHA02544316 44 clamp loader, small subunit; Provisional 96.53
PRK03992389 proteasome-activating nucleotidase; Provisional 96.52
PF14519280 Macro_2: Macro-like domain; PDB: 1TXZ_A 1TY8_A 1NJ 96.49
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 96.47
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.46
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.46
TIGR00959428 ffh signal recognition particle protein. This mode 96.46
KOG0234438 consensus Fructose-6-phosphate 2-kinase/fructose-2 96.44
TIGR00064272 ftsY signal recognition particle-docking protein F 96.44
KOG2720431 consensus Predicted hydrolase (HIT family) [Genera 96.43
PHA03132580 thymidine kinase; Provisional 96.42
COG2256436 MGS1 ATPase related to the helicase subunit of the 96.42
PRK10416318 signal recognition particle-docking protein FtsY; 96.4
PRK08084235 DNA replication initiation factor; Provisional 96.4
PRK06620214 hypothetical protein; Validated 96.35
KOG2958354 consensus Galactose-1-phosphate uridylyltransferas 96.34
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 96.34
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 96.33
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 96.32
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 96.31
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.3
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 96.29
KOG2702323 consensus Predicted panthothenate kinase/uridine k 96.22
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 96.2
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 96.2
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.18
PRK12377248 putative replication protein; Provisional 96.17
KOG0780483 consensus Signal recognition particle, subunit Srp 96.14
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 96.12
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.09
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.09
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.08
CHL00181287 cbbX CbbX; Provisional 96.05
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.05
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.04
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 96.0
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 95.99
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 95.97
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 95.91
PRK13342413 recombination factor protein RarA; Reviewed 95.88
PHA02244383 ATPase-like protein 95.85
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 95.84
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.84
PRK04195482 replication factor C large subunit; Provisional 95.82
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 95.81
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 95.81
PRK08116268 hypothetical protein; Validated 95.8
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 95.77
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 95.73
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 95.73
PLN03103403 GDP-L-galactose-hexose-1-phosphate guanyltransfera 95.72
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 95.66
PRK08727233 hypothetical protein; Validated 95.66
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.63
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 95.61
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 95.59
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.58
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 95.56
KOG1533290 consensus Predicted GTPase [General function predi 95.55
PRK06893229 DNA replication initiation factor; Validated 95.54
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 95.54
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 95.49
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 95.48
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.48
PLN03046460 D-glycerate 3-kinase; Provisional 95.46
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 95.45
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 95.37
PRK05642234 DNA replication initiation factor; Validated 95.37
PRK07952244 DNA replication protein DnaC; Validated 95.36
PRK04296190 thymidine kinase; Provisional 95.36
PLN02796347 D-glycerate 3-kinase 95.32
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.32
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 95.3
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.27
cd03331152 Macro_Poa1p_like_SNF2 Macro domain, Poa1p_like fam 95.27
CHL00176638 ftsH cell division protein; Validated 95.27
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 95.25
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 95.25
KOG4235244 consensus Mitochondrial thymidine kinase 2/deoxygu 95.24
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 95.2
PRK12402337 replication factor C small subunit 2; Reviewed 95.18
COG1126240 GlnQ ABC-type polar amino acid transport system, A 95.16
PRK06921266 hypothetical protein; Provisional 95.12
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 95.11
PLN03025319 replication factor C subunit; Provisional 95.11
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 95.03
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.01
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 94.99
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 94.98
cd01394218 radB RadB. The archaeal protein radB shares simila 94.98
PF05729166 NACHT: NACHT domain 94.96
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 94.95
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 94.94
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 94.94
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 94.92
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 94.91
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 94.9
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.88
PRK08181269 transposase; Validated 94.88
PRK07003830 DNA polymerase III subunits gamma and tau; Validat 94.87
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 94.86
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 94.85
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 94.85
PRK09183259 transposase/IS protein; Provisional 94.84
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 94.84
PRK12422445 chromosomal replication initiation protein; Provis 94.84
PRK00440319 rfc replication factor C small subunit; Reviewed 94.83
PRK00149450 dnaA chromosomal replication initiation protein; R 94.82
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.81
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 94.8
PF1324576 AAA_19: Part of AAA domain 94.79
PRK09435332 membrane ATPase/protein kinase; Provisional 94.77
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 94.77
PRK06835329 DNA replication protein DnaC; Validated 94.76
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 94.75
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 94.75
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 94.7
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 94.68
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 94.68
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 94.66
PRK06526254 transposase; Provisional 94.65
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 94.65
PF02367123 UPF0079: Uncharacterised P-loop hydrolase UPF0079; 94.65
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 94.64
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.63
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 94.63
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 94.63
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 94.62
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 94.62
PF13189179 Cytidylate_kin2: Cytidylate kinase-like family; PD 94.6
PRK07764824 DNA polymerase III subunits gamma and tau; Validat 94.6
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 94.58
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 94.58
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 94.56
KOG0731774 consensus AAA+-type ATPase containing the peptidas 94.55
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 94.51
PF07726131 AAA_3: ATPase family associated with various cellu 94.5
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 94.5
KOG0734752 consensus AAA+-type ATPase containing the peptidas 94.48
PRK08099399 bifunctional DNA-binding transcriptional repressor 94.45
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 94.42
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 94.41
PRK08533230 flagellar accessory protein FlaH; Reviewed 94.37
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 94.37
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 94.34
COG1855604 ATPase (PilT family) [General function prediction 94.34
PTZ00202550 tuzin; Provisional 94.33
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 94.32
COG1117253 PstB ABC-type phosphate transport system, ATPase c 94.32
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 94.28
PRK14086617 dnaA chromosomal replication initiation protein; P 94.26
PRK04328249 hypothetical protein; Provisional 94.25
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 94.24
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 94.23
cd03216163 ABC_Carb_Monos_I This family represents the domain 94.22
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 94.2
TIGR03707230 PPK2_P_aer polyphosphate kinase 2, PA0141 family. 94.17
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 94.13
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 94.12
TIGR00101199 ureG urease accessory protein UreG. This model rep 94.1
PRK08903227 DnaA regulatory inactivator Hda; Validated 94.1
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 94.09
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 94.08
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 94.07
PRK091692316 hypothetical protein; Validated 94.04
COG2255332 RuvB Holliday junction resolvasome, helicase subun 94.02
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.0
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 94.0
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 93.98
COG4240300 Predicted kinase [General function prediction only 93.98
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 93.98
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 93.95
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 93.92
PRK13768253 GTPase; Provisional 93.91
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 93.9
TIGR00672250 cdh CDP-diacylglycerol pyrophosphatase, bacterial 93.89
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 93.88
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 93.85
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 93.84
PRK05471252 CDP-diacylglycerol pyrophosphatase; Provisional 93.8
COG2884223 FtsE Predicted ATPase involved in cell division [C 93.79
PRK09361225 radB DNA repair and recombination protein RadB; Pr 93.77
PRK14088440 dnaA chromosomal replication initiation protein; P 93.7
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 93.66
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 93.66
PF13479213 AAA_24: AAA domain 93.65
CHL002062281 ycf2 Ycf2; Provisional 93.63
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 93.6
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 93.6
PRK12269863 bifunctional cytidylate kinase/ribosomal protein S 93.57
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 93.54
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 93.53
PF02611222 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: 93.53
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 93.47
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 93.46
PRK08939306 primosomal protein DnaI; Reviewed 93.46
COG0552340 FtsY Signal recognition particle GTPase [Intracell 93.45
PF1355562 AAA_29: P-loop containing region of AAA domain 93.45
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 93.44
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 93.43
TIGR02012321 tigrfam_recA protein RecA. This model describes or 93.42
TIGR03709264 PPK2_rel_1 polyphosphate:nucleotide phosphotransfe 93.38
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.38
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 93.37
PF00005137 ABC_tran: ABC transporter This structure is on hol 93.37
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 93.34
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 93.33
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 93.29
KOG1534273 consensus Putative transcription factor FET5 [Tran 93.27
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 93.25
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 93.23
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 93.22
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 93.18
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 93.15
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 93.15
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 93.14
TIGR00763775 lon ATP-dependent protease La. This protein is ind 93.11
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 93.09
PRK00089292 era GTPase Era; Reviewed 93.02
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 93.01
TIGR03708493 poly_P_AMP_trns polyphosphate:AMP phosphotransfera 92.99
PRK15455644 PrkA family serine protein kinase; Provisional 92.96
cd03114148 ArgK-like The function of this protein family is u 92.92
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 92.83
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 92.82
TIGR01526325 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltr 92.82
TIGR02237209 recomb_radB DNA repair and recombination protein R 92.8
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 92.79
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 92.78
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 92.76
PRK06067234 flagellar accessory protein FlaH; Validated 92.74
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 92.73
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 92.73
PRK14490369 putative bifunctional molybdopterin-guanine dinucl 92.72
COG0470325 HolB ATPase involved in DNA replication [DNA repli 92.71
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 92.67
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 92.66
PRK05564313 DNA polymerase III subunit delta'; Validated 92.64
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 92.59
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 92.52
PRK10646153 ADP-binding protein; Provisional 92.49
>KOG0562 consensus Predicted hydrolase (HIT family) [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=2.4e-47  Score=359.59  Aligned_cols=181  Identities=46%  Similarity=0.754  Sum_probs=162.1

Q ss_pred             hhHHHHHhhhcCCCCCCCcEEEEc-CcEEEEecCCCCCCceEEEEeCCCCCCChhcCCHHHHHHHHHHHHHHHHHHHHhh
Q 004319          559 SWAQALYRTAMYPERHKDDLLEIS-DDVVVLNDLYPKAQKHILVLSRFDGLDRLADVRNEHLQILQTMHAVGMKWAEKFL  637 (761)
Q Consensus       559 ~w~~~L~~~~~~Pe~~p~~vvyed-d~~vai~D~~Pka~~H~LVIPk~~hi~~l~dl~~e~l~lL~~m~~~~~~~~~~~~  637 (761)
                      +|+.++..++..||.    |+.+. |++|+|+|.||||+.|+||+||...|+++.++..+++.+|.+|..++..|.....
T Consensus         2 sw~~~i~~~i~k~e~----V~~es~d~vvvIrD~fPKa~~H~LvLpr~s~i~~l~~~~qe~l~ll~~~h~~~~~~v~~~~   77 (184)
T KOG0562|consen    2 SWHEAIVMDIPKPEN----VYIESPDDVVVIRDKFPKARMHLLVLPRRSSIDSLFSVVQEHLSLLKEDHAVGPCWVDQLT   77 (184)
T ss_pred             chhhhhhhcCCccce----eeccCcccEEEEcccCccceeEEEEecccchhHHHHHHHHHHhhHhHHHhhcCchHHHHhc
Confidence            688777766666665    55555 7999999999999999999997678999999999999999999999999998876


Q ss_pred             ccCCceeeeecccCCCcccceeeeeecCCcccccccccccccccCcccccCHHHHHHHHHhcCCCCccchhhhccCCccc
Q 004319          638 HEDASLAFRLGYHSAPSMRQLHLHVISQDFNSKHLKNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRC  717 (761)
Q Consensus       638 ~~~~~~~~~~G~ha~pSv~HLHlHVIs~d~~s~~lk~kkH~nsF~t~fFv~~~~v~~~l~~~g~~~~~~~~~~l~~~l~C  717 (761)
                      .++....|++||||+|||.||||||||+||+|++||||||||||||+||++++++.+++.+.|+.+..... ||+.||+|
T Consensus        78 ~~~~~~~f~vG~HavPSM~~LHLHVISkDf~S~sLKNKKHwnSFnT~fFv~~~~~~~~~~~~G~~t~~~~~-llk~dLrC  156 (184)
T KOG0562|consen   78 NEALCNYFRVGFHAVPSMNNLHLHVISKDFVSPSLKNKKHWNSFNTEFFVKSDDVTENVPTRGTATVLFTT-LLKEDLRC  156 (184)
T ss_pred             chhhhhheeeeeccCcchhheeEEEeecccCCchhccchhhcccCccceeeccchhhhhhccccchhhhhh-hhccceee
Confidence            66666789999999999999999999999999999999999999999999999999999999998765544 99999999


Q ss_pred             ccCCCCCCChHHHHHHHhhcCCCCCcc
Q 004319          718 HRCRSAHPSIPRLKSHISSCRAPFPSS  744 (761)
Q Consensus       718 ~~C~~~~~n~~~LK~Hl~~~~~~~~~~  744 (761)
                      |||+..-++||+||+||+.|-..+|.+
T Consensus       157 ~~Cq~~~~~~~kLK~Hl~~~~~q~~d~  183 (184)
T KOG0562|consen  157 WRCQTFGPHFPKLKAHLREEYDQWLDK  183 (184)
T ss_pred             hhhhhcccccHHHHHHHHHHHhhcccc
Confidence            999943356999999999999888865



>cd02905 Macro_GDAP2_like Macro domain, GDAP2_like family Back     alignment and domain information
>cd02904 Macro_H2A_like Macro domain, Macro_H2A_like family Back     alignment and domain information
>PF11969 DcpS_C: Scavenger mRNA decapping enzyme C-term binding; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B 1XQU_B Back     alignment and domain information
>PRK04143 hypothetical protein; Provisional Back     alignment and domain information
>cd02906 Macro_1 Macro domain, Unknown family 1 Back     alignment and domain information
>cd02908 Macro_Appr_pase_like Macro domain, Appr-1"-pase_like family Back     alignment and domain information
>cd02907 Macro_Af1521_BAL_like Macro domain, Af1521- and BAL-like family Back     alignment and domain information
>PRK00431 RNase III inhibitor; Provisional Back     alignment and domain information
>cd02903 Macro_BAL_like Macro domain, BAL_like family Back     alignment and domain information
>COG2110 Predicted phosphatase homologous to the C-terminal domain of histone macroH2A1 [General function prediction only] Back     alignment and domain information
>KOG4359 consensus Protein kinase C inhibitor-like protein [General function prediction only] Back     alignment and domain information
>cd03330 Macro_2 Macro domain, Unknown family 2 Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>KOG3275 consensus Zinc-binding protein of the histidine triad (HIT) family [Signal transduction mechanisms] Back     alignment and domain information
>PRK10687 purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>cd01278 aprataxin_related aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>smart00506 A1pp Appr-1"-p processing enzyme Back     alignment and domain information
>cd02749 Macro Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases) Back     alignment and domain information
>cd01276 PKCI_related Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information
>COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>cd02900 Macro_Appr_pase Macro domain, Appr-1"-pase family Back     alignment and domain information
>KOG2633 consensus Hismacro and SEC14 domain-containing proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF01230 HIT: HIT domain; InterPro: IPR001310 The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PF01661 Macro: Macro domain; InterPro: IPR002589 The Macro or A1pp domain is a module of about 180 amino acids which can bind ADP-ribose, an NAD metabolite or related ligands Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>KOG3354 consensus Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02904 Macro_H2A_like Macro domain, Macro_H2A_like family Back     alignment and domain information
>cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK04143 hypothetical protein; Provisional Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>KOG3079 consensus Uridylate kinase/adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>cd02905 Macro_GDAP2_like Macro domain, GDAP2_like family Back     alignment and domain information
>cd02901 Macro_Poa1p_like Macro domain, Poa1p_like family Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>KOG3379 consensus Diadenosine polyphosphate hydrolase and related proteins of the histidine triad (HIT) family [Nucleotide transport and metabolism; General function prediction only] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>cd02906 Macro_1 Macro domain, Unknown family 1 Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>cd02908 Macro_Appr_pase_like Macro domain, Appr-1"-pase_like family Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>cd02907 Macro_Af1521_BAL_like Macro domain, Af1521- and BAL-like family Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>cd02903 Macro_BAL_like Macro domain, BAL_like family Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>KOG3062 consensus RNA polymerase II elongator associated protein [General function prediction only] Back     alignment and domain information
>KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK00431 RNase III inhibitor; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PF01591 6PF2K: 6-phosphofructo-2-kinase; InterPro: IPR013079 6-Phosphofructo-2-kinase (2 Back     alignment and domain information
>KOG3969 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>KOG4622 consensus Predicted nucleotide kinase [General function prediction only] Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>COG2110 Predicted phosphatase homologous to the C-terminal domain of histone macroH2A1 [General function prediction only] Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>KOG2633 consensus Hismacro and SEC14 domain-containing proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>cd03330 Macro_2 Macro domain, Unknown family 2 Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PLN02348 phosphoribulokinase Back     alignment and domain information
>PHA02595 tk Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>KOG0635 consensus Adenosine 5'-phosphosulfate kinase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PRK15453 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>KOG3078 consensus Adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG5075 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PF01661 Macro: Macro domain; InterPro: IPR002589 The Macro or A1pp domain is a module of about 180 amino acids which can bind ADP-ribose, an NAD metabolite or related ligands Back     alignment and domain information
>cd02900 Macro_Appr_pase Macro domain, Appr-1"-pase family Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase, bacterial type Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>cd02749 Macro Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases) Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3877 consensus NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit [Energy production and conversion] Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>smart00506 A1pp Appr-1"-p processing enzyme Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>COG3896 Chloramphenicol 3-O-phosphotransferase [Defense mechanisms] Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>COG5324 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>cd02901 Macro_Poa1p_like Macro domain, Poa1p_like family Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>KOG3308 consensus Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG3220 consensus Similar to bacterial dephospho-CoA kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4238 consensus Bifunctional ATP sulfurylase/adenosine 5'-phosphosulfate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG1384 consensus tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG1660 Predicted P-loop-containing kinase [General function prediction only] Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PF02744 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transferase, C-terminal domain; InterPro: IPR005850 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF04677 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; InterPro: IPR006768 This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 (Q09909 from SWISSPROT) and its homologues Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>KOG0707 consensus Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PF14519 Macro_2: Macro-like domain; PDB: 1TXZ_A 1TY8_A 1NJR_A Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>KOG0234 consensus Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>KOG2720 consensus Predicted hydrolase (HIT family) [General function prediction only] Back     alignment and domain information
>PHA03132 thymidine kinase; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>KOG2958 consensus Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG2702 consensus Predicted panthothenate kinase/uridine kinase-related protein [Nucleotide transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PLN03103 GDP-L-galactose-hexose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PLN03046 D-glycerate 3-kinase; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PLN02796 D-glycerate 3-kinase Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>cd03331 Macro_Poa1p_like_SNF2 Macro domain, Poa1p_like family, SNF2 subfamily Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>KOG4235 consensus Mitochondrial thymidine kinase 2/deoxyguanosine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13189 Cytidylate_kin2: Cytidylate kinase-like family; PDB: 3FDI_A Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03707 PPK2_P_aer polyphosphate kinase 2, PA0141 family Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK09169 hypothetical protein; Validated Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR00672 cdh CDP-diacylglycerol pyrophosphatase, bacterial type Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK05471 CDP-diacylglycerol pyrophosphatase; Provisional Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK12269 bifunctional cytidylate kinase/ribosomal protein S1; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF02611 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: IPR003763 The CDP-diacylglycerol pyrophosphatases 3 Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>TIGR03709 PPK2_rel_1 polyphosphate:nucleotide phosphotransferase, PPK2 family Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03708 poly_P_AMP_trns polyphosphate:AMP phosphotransferase Back     alignment and domain information
>PRK15455 PrkA family serine protein kinase; Provisional Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase, NadR type Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK14490 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MobA; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query761
3spd_A204 Crystal Structure Of Aprataxin Ortholog Hnt3 In Com 2e-11
3sp4_A204 Crystal Structure Of Aprataxin Ortholog Hnt3 From S 3e-11
3szq_A206 Structure Of An S. Pombe AptxDNAAMPZN COMPLEX Lengt 3e-11
3zvn_A416 The Structural Basis For Substrate Recognition By M 5e-06
3zvl_A416 The Structural Basis For Substrate Recognition By M 5e-06
3u7e_B381 Crystal Structure Of Mpnkp Catalytic Fragment (D170 7e-06
3zvm_A416 The Structural Basis For Substrate Recognition By M 9e-06
1yj5_A383 Molecular Architecture Of Mammalian Polynucleotide 1e-05
3u7g_A379 Crystal Structure Of Mpnkp Catalytic Fragment (D170 1e-05
4gp6_A171 Polynucleotide Kinase Length = 171 6e-04
>pdb|3SPD|A Chain A, Crystal Structure Of Aprataxin Ortholog Hnt3 In Complex With Dna Length = 204 Back     alignment and structure

Iteration: 1

Score = 68.2 bits (165), Expect = 2e-11, Method: Compositional matrix adjust. Identities = 48/180 (26%), Positives = 92/180 (51%), Gaps = 22/180 (12%) Query: 571 PERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLDRL--ADVRNEHLQILQTMHAV 628 PE +K+ ++ DDVV++ D++PK++ H+L+++R L + ++ +H +++ + + Sbjct: 17 PESYKN-VIYYDDDVVLVRDMFPKSKMHLLLMTRDPHLTHVHPLEIMMKHRSLVEKLVSY 75 Query: 629 ------GMKWAE-------KFLHEDASLAFRLGYHSAPSMRQLHLHVISQDFNSKHLKNK 675 G+ + E + +E + ++G+H+ PSM LHLH+++ D S LKN Sbjct: 76 VQGDLSGLIFDEARNCLSQQLTNEALANYIKVGFHAGPSMNNLHLHIMTLDHVSPSLKNS 135 Query: 676 KHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRCHRC-RSAHPSIPRLKSHI 734 H+ SF + FF + G T SL +L+C RC + +LK+H+ Sbjct: 136 AHYISFTSPFFVKIDTPTSNLPTRGTLT-----SLFQEDLKCWRCGETFGRHFTKLKAHL 190
>pdb|3SP4|A Chain A, Crystal Structure Of Aprataxin Ortholog Hnt3 From Schizosaccharomyces Pombe Length = 204 Back     alignment and structure
>pdb|3SZQ|A Chain A, Structure Of An S. Pombe AptxDNAAMPZN COMPLEX Length = 206 Back     alignment and structure
>pdb|3ZVN|A Chain A, The Structural Basis For Substrate Recognition By Mammalian Polynucleotide Kinase 3' Phosphatase Length = 416 Back     alignment and structure
>pdb|3ZVL|A Chain A, The Structural Basis For Substrate Recognition By Mammalian Polynucleotide Kinase 3' Phosphatase Length = 416 Back     alignment and structure
>pdb|3U7E|B Chain B, Crystal Structure Of Mpnkp Catalytic Fragment (D170a) Length = 381 Back     alignment and structure
>pdb|3ZVM|A Chain A, The Structural Basis For Substrate Recognition By Mammalian Polynucleotide Kinase 3' Phosphatase Length = 416 Back     alignment and structure
>pdb|1YJ5|A Chain A, Molecular Architecture Of Mammalian Polynucleotide Kinase, A Dna Repair Enzyme Length = 383 Back     alignment and structure
>pdb|3U7G|A Chain A, Crystal Structure Of Mpnkp Catalytic Fragment (D170a) Bound To Single- Stranded Dna (Tcctap) Length = 379 Back     alignment and structure
>pdb|4GP6|A Chain A, Polynucleotide Kinase Length = 171 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query761
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 1e-48
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 2e-22
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 2e-20
3ejf_A176 Non-structural protein 3; IBV, coronavirus, X-doma 5e-19
1vlr_A350 MRNA decapping enzyme; 16740816, structural genomi 3e-18
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand compl 4e-17
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 2e-16
3ejg_A193 Non-structural protein 3; HCOV 229E, X-domain, mac 4e-16
2vri_A174 Non-structural protein 3; RNA replication, nucleot 7e-16
3gqe_A168 Non-structural protein 3; macro domain, X domain, 8e-16
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 1e-15
3q71_A221 Poly [ADP-ribose] polymerase 14; structural genomi 2e-15
1vhu_A211 Hypothetical protein AF1521; structural genomics, 3e-15
3eti_A168 X (ADRP) domain, macro domain of non-structural pr 8e-14
1spv_A184 Putative polyprotein/phosphatase; structural genom 2e-13
2acf_A182 Replicase polyprotein 1AB; ADRP domain, SARS NSP-3 2e-13
3gpg_A168 NSP3, non-structural protein 3; macro domain, X do 3e-13
2dx6_A159 Hypothetical protein TTHA0132; conserved hypotheti 3e-13
3q6z_A214 Poly [ADP-ribose] polymerase 14; structural genomi 4e-13
3kh6_A199 Poly [ADP-ribose] polymerase 15; macro, PARP, BAL3 2e-12
2xd7_A193 Core histone macro-H2A.2; chromosomal protein, nuc 2e-12
1yd9_A193 Core histone macro-H2A.1; alpha-beta structure, A1 4e-12
2x47_A235 Macro domain-containing protein 1; signaling prote 9e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 3e-09
1njr_A284 32.1 kDa protein in ADH3-RCA1 intergenic region; s 3e-08
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 4e-07
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 3e-05
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 8e-05
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 1e-04
3oj7_A117 Putative histidine triad family protein; hydrolase 2e-04
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 2e-04
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 6e-04
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Length = 204 Back     alignment and structure
 Score =  169 bits (429), Expect = 1e-48
 Identities = 47/194 (24%), Positives = 89/194 (45%), Gaps = 22/194 (11%)

Query: 559 SWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLD--RLADVRN 616
           S+   L      PE +K+ ++   DDVV++ D++PK++ H+L+++R   L      ++  
Sbjct: 5   SFRDNLKVYIESPESYKN-VIYYDDDVVLVRDMFPKSKMHLLLMTRDPHLTHVHPLEIMM 63

Query: 617 EHLQILQTMHAVGMKWAEKFLHEDA-------------SLAFRLGYHSAPSMRQLHLHVI 663
           +H  +++ + +         + ++A                 ++G+H+ PSM  LHLH++
Sbjct: 64  KHRSLVEKLVSYVQGDLSGLIFDEARNCLSQQLTNEALCNYIKVGFHAGPSMNNLHLHIM 123

Query: 664 SQDFNSKHLKNKKHWNSFNTAFFCDSVDVLEEISNHGKATLKDYDSLLSMELRCHRC-RS 722
           + D  S  LKN  H+ SF + FF         +   G        SL   +L+C RC  +
Sbjct: 124 TLDHVSPSLKNSAHYISFTSPFFVKIDTPTSNLPTRGT-----LTSLFQEDLKCWRCGET 178

Query: 723 AHPSIPRLKSHISS 736
                 +LK+H+  
Sbjct: 179 FGRHFTKLKAHLQE 192


>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Length = 416 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Length = 181 Back     alignment and structure
>3ejf_A Non-structural protein 3; IBV, coronavirus, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting; 1.60A {Avian infectious bronchitis virus} PDB: 3eke_A* 3ewo_A 3ewp_A* Length = 176 Back     alignment and structure
>1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* Length = 350 Back     alignment and structure
>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Length = 301 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Length = 301 Back     alignment and structure
>3ejg_A Non-structural protein 3; HCOV 229E, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting, RNA-binding; 1.78A {Human coronavirus 229E} PDB: 3ewr_A* 3ewq_A* Length = 193 Back     alignment and structure
>2vri_A Non-structural protein 3; RNA replication, nucleotide-binding, endonuclease, macro domain, viral protein, ATP-binding, exonuclease; 1.8A {Human coronavirus NL63} Length = 174 Back     alignment and structure
>3gqe_A Non-structural protein 3; macro domain, X domain, venezuelan equine encephalitis virus alphavirus; HET: BCN; 2.30A {Venezuelan equine encephalitis virus} PDB: 3gqo_A* Length = 168 Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Length = 260 Back     alignment and structure
>3q71_A Poly [ADP-ribose] polymerase 14; structural genomics, structural genomics consortium, SGC, transferase, PARP14 macro 2; HET: AR6; 2.20A {Homo sapiens} Length = 221 Back     alignment and structure
>1vhu_A Hypothetical protein AF1521; structural genomics, unknown function; HET: MSE MES; 1.34A {Archaeoglobus fulgidus} SCOP: c.50.1.2 PDB: 2bfq_A* 1hjz_A* 2bfr_A* Length = 211 Back     alignment and structure
>3eti_A X (ADRP) domain, macro domain of non-structural protein 3; coronavirus, X domain, RNA binding protein; 2.20A {Feline infectious peritonitis virus} PDB: 3ew5_A* 3jzt_A* Length = 168 Back     alignment and structure
>1spv_A Putative polyprotein/phosphatase; structural genomoics, alpha/beta monomeric protein, structural genomics, PSI, protein structure initiative; HET: MES; 2.00A {Escherichia coli} SCOP: c.50.1.2 Length = 184 Back     alignment and structure
>2acf_A Replicase polyprotein 1AB; ADRP domain, SARS NSP-3, APPR-1-P phosphatase, structural GE joint center for structural genomics, JCSG; 1.40A {Sars coronavirus TOR2} SCOP: c.50.1.2 PDB: 2fav_A* Length = 182 Back     alignment and structure
>3gpg_A NSP3, non-structural protein 3; macro domain, X domain, alphavirus, VIZI enzymes involved in replication, ATP-binding, cell membrane endosome; 1.65A {Chikungunya virus} PDB: 3gpo_A* 3gpq_A Length = 168 Back     alignment and structure
>2dx6_A Hypothetical protein TTHA0132; conserved hypothetical protein, structural genomics, NPPSFA; 1.78A {Thermus thermophilus} PDB: 3v45_A Length = 159 Back     alignment and structure
>3q6z_A Poly [ADP-ribose] polymerase 14; structural genomics consortium, SGC, ADP-ribose binding, TRA; HET: APR; 2.23A {Homo sapiens} Length = 214 Back     alignment and structure
>2xd7_A Core histone macro-H2A.2; chromosomal protein, nucleosome core, chromatin regulator, nucleus, DNA-binding protein, phosphoprotein; 2.09A {Homo sapiens} Length = 193 Back     alignment and structure
>1yd9_A Core histone macro-H2A.1; alpha-beta structure, A1PP domain, macro-domain, structural protein; 1.60A {Rattus norvegicus} SCOP: c.50.1.2 PDB: 1zr3_A* 2fxk_A 3iid_A* 3iif_A* 1zr5_A Length = 193 Back     alignment and structure
>2x47_A Macro domain-containing protein 1; signaling protein, signal transduction, estrogen signaling; 1.70A {Homo sapiens} Length = 235 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>1njr_A 32.1 kDa protein in ADH3-RCA1 intergenic region; structural genomics, dimer, two domain organization, PSI, PR structure initiative; HET: XYL; 1.90A {Saccharomyces cerevisiae} SCOP: c.50.1.2 PDB: 1txz_A* 1ty8_A* Length = 284 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191 Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Length = 189 Back     alignment and structure
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Length = 126 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 253 Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} PDB: 3omf_A* 3oxk_A* Length = 117 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Length = 178 Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} PDB: 3n1t_A* Length = 119 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query761
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 100.0
3q71_A221 Poly [ADP-ribose] polymerase 14; structural genomi 99.93
3eti_A168 X (ADRP) domain, macro domain of non-structural pr 99.93
3q6z_A214 Poly [ADP-ribose] polymerase 14; structural genomi 99.93
1spv_A184 Putative polyprotein/phosphatase; structural genom 99.93
2xd7_A193 Core histone macro-H2A.2; chromosomal protein, nuc 99.92
1yd9_A193 Core histone macro-H2A.1; alpha-beta structure, A1 99.92
4abl_A183 Poly [ADP-ribose] polymerase 14; transferase, PARP 99.92
2x47_A235 Macro domain-containing protein 1; signaling prote 99.92
3ejg_A193 Non-structural protein 3; HCOV 229E, X-domain, mac 99.91
3kh6_A199 Poly [ADP-ribose] polymerase 15; macro, PARP, BAL3 99.9
2acf_A182 Replicase polyprotein 1AB; ADRP domain, SARS NSP-3 99.89
2dx6_A159 Hypothetical protein TTHA0132; conserved hypotheti 99.89
3gqe_A168 Non-structural protein 3; macro domain, X domain, 99.89
3gpg_A168 NSP3, non-structural protein 3; macro domain, X do 99.89
1vhu_A211 Hypothetical protein AF1521; structural genomics, 99.89
2vri_A174 Non-structural protein 3; RNA replication, nucleot 99.89
3ejf_A176 Non-structural protein 3; IBV, coronavirus, X-doma 99.88
1njr_A284 32.1 kDa protein in ADH3-RCA1 intergenic region; s 99.86
4gua_A670 Non-structural polyprotein; viral precursor polypr 99.85
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand compl 99.83
1vlr_A350 MRNA decapping enzyme; 16740816, structural genomi 99.82
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 99.74
4egu_A119 Histidine triad (HIT) protein; structural genomics 99.73
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 99.71
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 99.69
3oj7_A117 Putative histidine triad family protein; hydrolase 99.69
2jyc_A160 Uncharacterized protein C6ORF130; macro domain, A1 99.66
2eee_A149 Uncharacterized protein C6ORF130; macro domain, A1 99.65
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 99.63
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 99.62
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 99.61
2fg1_A158 Conserved hypothetical protein BT1257; structural 99.61
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 99.58
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 99.57
3imi_A147 HIT family protein; structural genomics, infectiou 99.57
3ksv_A149 Uncharacterized protein; HIT family, structural ge 99.56
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 99.56
2eo4_A149 150AA long hypothetical histidine triad nucleotid 99.56
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 99.56
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 99.55
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 99.53
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 99.52
3r6f_A135 HIT family protein; structural genomics, seattle s 99.51
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 99.49
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 99.48
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 99.46
3ohe_A137 Histidine triad (HIT) protein; structural genomics 99.35
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 99.35
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 99.35
3q71_A221 Poly [ADP-ribose] polymerase 14; structural genomi 99.34
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 99.33
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 99.32
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 99.31
3i24_A149 HIT family hydrolase; structural genomics, PSI-2, 99.31
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 99.3
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 99.29
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 99.28
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 99.28
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 99.27
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 99.26
3q6z_A214 Poly [ADP-ribose] polymerase 14; structural genomi 99.25
3tlx_A243 Adenylate kinase 2; structural genomics, structura 99.21
3nrd_A135 Histidine triad (HIT) protein; structural genomics 99.21
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 99.21
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 99.2
4abl_A183 Poly [ADP-ribose] polymerase 14; transferase, PARP 99.2
1spv_A184 Putative polyprotein/phosphatase; structural genom 99.18
1z84_A351 Galactose-1-phosphate uridyl transferase-like prot 99.18
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleot 99.18
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 99.17
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 99.17
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 99.17
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 99.17
2vli_A183 Antibiotic resistance protein; transferase, tunica 99.17
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 99.16
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 99.15
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 99.15
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 99.14
2xd7_A193 Core histone macro-H2A.2; chromosomal protein, nuc 99.14
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 99.14
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 99.14
1yd9_A193 Core histone macro-H2A.1; alpha-beta structure, A1 99.13
3kh6_A199 Poly [ADP-ribose] polymerase 15; macro, PARP, BAL3 99.12
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 99.1
2x47_A235 Macro domain-containing protein 1; signaling prote 99.08
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 99.03
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, H 99.01
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 99.01
3eti_A168 X (ADRP) domain, macro domain of non-structural pr 98.99
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 98.96
2dx6_A159 Hypothetical protein TTHA0132; conserved hypotheti 98.95
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 98.95
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 98.94
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 98.93
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 98.91
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 98.91
1vhu_A211 Hypothetical protein AF1521; structural genomics, 98.89
3vaa_A199 Shikimate kinase, SK; structural genomics, center 98.88
3ejf_A176 Non-structural protein 3; IBV, coronavirus, X-doma 98.88
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 98.88
1x6v_B630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.86
2acf_A182 Replicase polyprotein 1AB; ADRP domain, SARS NSP-3 98.86
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 98.83
1njr_A284 32.1 kDa protein in ADH3-RCA1 intergenic region; s 98.83
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 98.81
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 98.8
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 98.8
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 98.79
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 98.78
3gpg_A168 NSP3, non-structural protein 3; macro domain, X do 98.78
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 98.78
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 98.75
3ejg_A193 Non-structural protein 3; HCOV 229E, X-domain, mac 98.74
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.72
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 98.69
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.68
3gqe_A168 Non-structural protein 3; macro domain, X domain, 98.67
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 98.66
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 98.66
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.66
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.66
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 98.64
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 98.62
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 98.6
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 98.59
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 98.59
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 98.58
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 98.58
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 98.58
1kag_A173 SKI, shikimate kinase I; transferase, structural g 98.57
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 98.57
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.57
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 98.53
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 98.51
1via_A175 Shikimate kinase; structural genomics, transferase 98.49
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 98.49
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 98.48
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 98.47
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.47
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 98.44
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 98.38
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 98.37
2vri_A174 Non-structural protein 3; RNA replication, nucleot 98.36
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 98.35
4gua_A670 Non-structural polyprotein; viral precursor polypr 98.34
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 98.34
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 98.34
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 98.32
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 98.31
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.31
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 98.31
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.29
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 98.28
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.25
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 98.22
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 98.21
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 98.21
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 98.2
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.19
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.19
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 98.15
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 98.15
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 98.14
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 98.14
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 98.12
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 98.09
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 98.08
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 98.07
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 98.06
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 97.96
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 97.92
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.92
3r20_A233 Cytidylate kinase; structural genomics, seattle st 97.92
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 97.9
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 97.89
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 97.88
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 97.82
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 97.8
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 97.78
2jyc_A160 Uncharacterized protein C6ORF130; macro domain, A1 97.75
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 97.75
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 97.65
2eee_A149 Uncharacterized protein C6ORF130; macro domain, A1 97.64
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 97.63
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 97.55
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 97.49
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 97.47
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 97.46
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 97.45
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 97.45
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 97.41
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.38
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 97.35
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 97.21
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 97.15
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 97.14
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 97.12
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 97.11
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 97.1
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 97.03
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.02
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 97.02
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.88
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 96.86
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 96.78
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 96.76
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 96.73
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 96.73
1kjw_A295 Postsynaptic density protein 95; protein-protein i 96.71
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.68
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.67
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 96.65
2fg1_A158 Conserved hypothetical protein BT1257; structural 96.61
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 96.57
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 96.55
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.54
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 96.52
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 96.5
3kfv_A308 Tight junction protein ZO-3; structural genomics c 96.49
1p6x_A334 Thymidine kinase; P-loop, LID, transferase; HET: T 96.48
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 96.43
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 96.37
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 96.34
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 96.33
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.31
3ch4_B202 Pmkase, phosphomevalonate kinase; parallel beta-sh 96.28
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.26
2chg_A226 Replication factor C small subunit; DNA-binding pr 96.25
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 96.22
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.21
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 96.21
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 96.2
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.13
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 96.12
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 96.08
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 96.05
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 96.05
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 95.96
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.95
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 95.92
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 95.9
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.8
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.8
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 95.79
3bos_A242 Putative DNA replication factor; P-loop containing 95.78
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 95.77
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 95.76
3czq_A304 Putative polyphosphate kinase 2; structural genomi 95.76
2xkx_A721 Disks large homolog 4; structural protein, scaffol 95.74
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 95.72
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 95.72
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 95.7
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 95.7
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 95.7
1of1_A376 Thymidine kinase; transferase, antiviral drug, enz 95.67
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 95.55
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 95.54
2r62_A268 Cell division protease FTSH homolog; ATPase domain 95.52
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 95.44
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.43
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.43
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 95.38
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 95.38
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.38
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 95.3
2pof_A227 CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM0 95.22
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 95.18
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 95.14
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.09
2xxa_A433 Signal recognition particle protein; protein trans 95.08
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 95.08
1e2k_A331 Thymidine kinase; transferase, antiviral drug, enz 95.03
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 95.01
3co5_A143 Putative two-component system transcriptional RES 95.01
3pvs_A447 Replication-associated recombination protein A; ma 94.93
1z84_A351 Galactose-1-phosphate uridyl transferase-like prot 94.9
1vma_A306 Cell division protein FTSY; TM0570, structural gen 94.87
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 94.84
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 94.79
2cvh_A220 DNA repair and recombination protein RADB; filamen 94.76
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.7
2chq_A319 Replication factor C small subunit; DNA-binding pr 94.66
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.65
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 94.54
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 94.54
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 94.49
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.44
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 94.4
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 94.38
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 94.37
4a74_A231 DNA repair and recombination protein RADA; hydrola 94.36
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 94.34
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 94.33
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 94.32
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 94.28
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 94.27
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 94.22
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 94.19
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 94.16
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 94.14
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 94.12
4dey_A337 Voltage-dependent L-type calcium channel subunit; 94.11
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 94.05
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 94.0
1ard_A29 Yeast transcription factor ADR1; transcription reg 93.97
2r44_A331 Uncharacterized protein; putative ATPase, structur 93.93
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 93.84
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 93.84
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 93.84
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 93.83
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 93.81
2og2_A359 Putative signal recognition particle receptor; nuc 93.74
1xjc_A169 MOBB protein homolog; structural genomics, midwest 93.73
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 93.66
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 93.65
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 93.63
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 93.62
1tue_A212 Replication protein E1; helicase, replication, E1E 93.61
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.6
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 93.52
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 93.48
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 93.44
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 93.42
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 93.4
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 93.39
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 93.36
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 93.35
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 93.31
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 93.3
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 93.28
1xp8_A366 RECA protein, recombinase A; recombination, radior 93.25
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 93.15
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 93.15
3rhf_A289 Putative polyphosphate kinase 2 family protein; PS 93.14
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 93.13
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 93.1
2eyu_A261 Twitching motility protein PILT; pilus retraction 93.07
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 93.06
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 93.05
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 93.03
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 92.99
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 92.97
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 92.94
1u94_A356 RECA protein, recombinase A; homologous recombinat 92.91
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 92.86
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 92.85
1osn_A341 Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra 92.85
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 92.75
3czp_A500 Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2 92.75
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 92.75
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 92.75
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 92.73
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.71
2r6a_A454 DNAB helicase, replicative helicase; replication, 92.71
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 92.7
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 92.7
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 92.69
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 92.66
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 92.63
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 92.62
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 92.59
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 92.52
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 92.52
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 92.5
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 92.46
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 92.46
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 92.45
2fna_A357 Conserved hypothetical protein; structural genomic 92.43
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 92.41
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 92.41
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 92.41
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 92.38
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 92.37
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 92.37
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 92.37
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.36
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.35
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 92.34
3sig_A277 PArg, poly(ADP-ribose) glycohydrolase; HET: AR6; 1 92.32
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 92.3
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 92.3
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 92.3
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 92.3
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 92.29
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 92.29
1dek_A241 Deoxynucleoside monophosphate kinase; transferase, 92.27
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 92.26
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 92.25
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 92.23
1paa_A30 Yeast transcription factor ADR1; transcription reg 92.22
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 92.2
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 92.18
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 92.17
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 92.17
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 92.15
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 92.14
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 92.13
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 91.36
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 92.08
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 92.07
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 92.03
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 92.02
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 91.25
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 91.99
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.98
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 91.97
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 91.96
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 91.96
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 91.95
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 91.93
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 91.92
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 91.86
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.85
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 91.84
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 91.84
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 91.8
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 91.78
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 91.77
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 91.77
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 91.77
1b0u_A262 Histidine permease; ABC transporter, transport pro 91.75
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 91.73
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 91.71
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 90.99
3kta_A182 Chromosome segregation protein SMC; structural mai 91.7
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 91.69
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 91.65
1ji0_A240 ABC transporter; ATP binding protein, structural g 91.64
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.62
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 91.61
2gno_A305 DNA polymerase III, gamma subunit-related protein; 91.61
1g6h_A257 High-affinity branched-chain amino acid transport 91.6
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 91.59
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 91.57
2hf9_A226 Probable hydrogenase nickel incorporation protein 91.57
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.53
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 91.52
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.51
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 91.5
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 91.48
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 91.45
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 91.44
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 91.43
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 91.43
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 91.41
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 91.41
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 91.41
1sgw_A214 Putative ABC transporter; structural genomics, P p 91.41
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 91.39
2ewv_A372 Twitching motility protein PILT; pilus retraction 91.37
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 91.36
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 91.35
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 91.35
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 91.33
2wji_A165 Ferrous iron transport protein B homolog; membrane 91.33
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 91.32
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 91.32
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.31
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 91.28
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 91.27
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 91.27
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 91.26
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 91.26
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 91.23
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 91.21
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 91.21
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 91.2
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 91.19
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 91.18
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 91.18
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 91.18
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 91.15
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 91.12
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 91.11
2ghi_A260 Transport protein; multidrug resistance protein, M 91.11
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 91.09
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 91.08
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.06
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 91.06
2z43_A324 DNA repair and recombination protein RADA; archaea 91.05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 91.05
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 91.05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 91.04
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 91.04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 91.03
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 91.03
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 90.97
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 90.97
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 90.97
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 90.95
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 90.93
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 90.93
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 90.93
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 90.92
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 90.86
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 90.81
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 90.79
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 90.79
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 90.75
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
Probab=100.00  E-value=2.4e-49  Score=396.53  Aligned_cols=173  Identities=27%  Similarity=0.457  Sum_probs=147.7

Q ss_pred             cchhHHHHHhhhcCCCCCCCcEEEEcCcEEEEecCCCCCCceEEEEeCCCCCCChhcCCH---HHHHHHHHHHHHHH-HH
Q 004319          557 WGSWAQALYRTAMYPERHKDDLLEISDDVVVLNDLYPKAQKHILVLSRFDGLDRLADVRN---EHLQILQTMHAVGM-KW  632 (761)
Q Consensus       557 ~~~w~~~L~~~~~~Pe~~p~~vvyedd~~vai~D~~Pka~~H~LVIPk~~hi~~l~dl~~---e~l~lL~~m~~~~~-~~  632 (761)
                      -.+||++|+.||.+||++|. +|||||.++||+|+||+|++|+||||| +|+.++.++.+   ++.+++.+|..++. +.
T Consensus         3 ~msw~~~L~~yi~~Pe~~p~-~v~edd~~~af~D~~P~a~~H~LVIPk-~h~~~~~~p~~al~d~~~Ll~~m~~la~~~~   80 (204)
T 3sp4_A            3 HMSFRDNLKVYIESPESYKN-VIYYDDDVVLVRDMFPKSKMHLLLMTR-DPHLTHVHPLEIMMKHRSLVEKLVSYVQGDL   80 (204)
T ss_dssp             CCSGGGTTHHHHHCGGGCTT-EEEECSSEEEEECSSCSSSSEEEEEEC-CTTTTTSCHHHHHHHCHHHHHHHHHHHHTTT
T ss_pred             CCcHHHHHHHHhcChhhCCC-EEEEcCCEEEEeCCCCCCCccEEEEec-cccCcccchhhhhhhhHHHHHHHHHHHHHHH
Confidence            35799999999999999999 999999999999999999999999999 79999886554   46888999999888 64


Q ss_pred             HHHhhc------------cCCceeeeecccCCCcccceeeeeecCCcccccccccccccccCcccccCHHHHHHHHHhcC
Q 004319          633 AEKFLH------------EDASLAFRLGYHSAPSMRQLHLHVISQDFNSKHLKNKKHWNSFNTAFFCDSVDVLEEISNHG  700 (761)
Q Consensus       633 ~~~~~~------------~~~~~~~~~G~ha~pSv~HLHlHVIs~d~~s~~lk~kkH~nsF~t~fFv~~~~v~~~l~~~g  700 (761)
                      +++...            .+....|++|||++|||+||||||||+||+|++||+|||||||||+|||+++   ..|+..+
T Consensus        81 l~~~~~~~~~~~~~~~~~~~~~~~i~~GfHa~PSm~HLHLHVIS~Df~s~~lK~kkH~NSF~T~fFv~~~---~~l~~~~  157 (204)
T 3sp4_A           81 SGLIFDEARNCLSQQLTNEALCNYIKVGFHAGPSMNNLHLHIMTLDHVSPSLKNSAHYISFTSPFFVKID---TPTSNLP  157 (204)
T ss_dssp             HHHHHHHHHHHSCTTCCHHHHHTTEEEEEESSCSSSSCCEEEEESCCCCTTCCSHHHHHHHHSTTEEETT---CCGGGCC
T ss_pred             HHHHHhhhhhhhcccCCcCCeeeeEeccCCCCCcccceeEEEeccCCCChhhCccchhcccChhhhccch---hhhhhcc
Confidence            443221            1112379999999999999999999999999999999999999999999999   2345555


Q ss_pred             CCCccchhhhc-cCCcccccCCCCCCC-hHHHHHHHhhc
Q 004319          701 KATLKDYDSLL-SMELRCHRCRSAHPS-IPRLKSHISSC  737 (761)
Q Consensus       701 ~~~~~~~~~~l-~~~l~C~~C~~~~~n-~~~LK~Hl~~~  737 (761)
                      +....   .+| ++||+||+|+++|+| ||+||+||+.+
T Consensus       158 ~~~~~---~~l~~~~L~C~~C~~~f~n~~~~LK~HL~~e  193 (204)
T 3sp4_A          158 TRGTL---TSLFQEDLKCWRCGETFGRHFTKLKAHLQEE  193 (204)
T ss_dssp             CGGGG---GGGGGSCCBCTTTCCBCTTCHHHHHHHHHHH
T ss_pred             ccCHh---hhhcCCCceeCCCCchhhcccHHHHHHHHHH
Confidence            43322   556 999999999999999 99999999865



>3q71_A Poly [ADP-ribose] polymerase 14; structural genomics, structural genomics consortium, SGC, transferase, PARP14 macro 2; HET: AR6; 2.20A {Homo sapiens} Back     alignment and structure
>3eti_A X (ADRP) domain, macro domain of non-structural protein 3; coronavirus, X domain, RNA binding protein; 2.20A {Feline infectious peritonitis virus} PDB: 3ew5_A* 3jzt_A* Back     alignment and structure
>3q6z_A Poly [ADP-ribose] polymerase 14; structural genomics consortium, SGC, ADP-ribose binding, TRA; HET: APR; 2.23A {Homo sapiens} Back     alignment and structure
>1spv_A Putative polyprotein/phosphatase; structural genomoics, alpha/beta monomeric protein, structural genomics, PSI, protein structure initiative; HET: MES; 2.00A {Escherichia coli} SCOP: c.50.1.2 Back     alignment and structure
>2xd7_A Core histone macro-H2A.2; chromosomal protein, nucleosome core, chromatin regulator, nucleus, DNA-binding protein, phosphoprotein; 2.09A {Homo sapiens} Back     alignment and structure
>1yd9_A Core histone macro-H2A.1; alpha-beta structure, A1PP domain, macro-domain, structural protein; 1.60A {Rattus norvegicus} SCOP: c.50.1.2 PDB: 1zr3_A* 2fxk_A 3iid_A* 3iif_A* 1zr5_A Back     alignment and structure
>4abl_A Poly [ADP-ribose] polymerase 14; transferase, PARP14; 1.15A {Homo sapiens} PDB: 4abk_A Back     alignment and structure
>2x47_A Macro domain-containing protein 1; signaling protein, signal transduction, estrogen signaling; 1.70A {Homo sapiens} Back     alignment and structure
>3ejg_A Non-structural protein 3; HCOV 229E, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting, RNA-binding; 1.78A {Human coronavirus 229E} PDB: 3ewr_A* 3ewq_A* Back     alignment and structure
>2acf_A Replicase polyprotein 1AB; ADRP domain, SARS NSP-3, APPR-1-P phosphatase, structural GE joint center for structural genomics, JCSG; 1.40A {Sars coronavirus TOR2} SCOP: c.50.1.2 PDB: 2fav_A* Back     alignment and structure
>2dx6_A Hypothetical protein TTHA0132; conserved hypothetical protein, structural genomics, NPPSFA; 1.78A {Thermus thermophilus} PDB: 3v45_A Back     alignment and structure
>3gqe_A Non-structural protein 3; macro domain, X domain, venezuelan equine encephalitis virus alphavirus; HET: BCN; 2.30A {Venezuelan equine encephalitis virus} PDB: 3gqo_A* Back     alignment and structure
>3gpg_A NSP3, non-structural protein 3; macro domain, X domain, alphavirus, VIZI enzymes involved in replication, ATP-binding, cell membrane endosome; 1.65A {Chikungunya virus} PDB: 3gpo_A* 3gpq_A Back     alignment and structure
>1vhu_A Hypothetical protein AF1521; structural genomics, unknown function; HET: MSE MES; 1.34A {Archaeoglobus fulgidus} SCOP: c.50.1.2 PDB: 2bfq_A* 1hjz_A* 2bfr_A* Back     alignment and structure
>2vri_A Non-structural protein 3; RNA replication, nucleotide-binding, endonuclease, macro domain, viral protein, ATP-binding, exonuclease; 1.8A {Human coronavirus NL63} Back     alignment and structure
>3ejf_A Non-structural protein 3; IBV, coronavirus, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting; 1.60A {Avian infectious bronchitis virus} PDB: 3eke_A* 3ewo_A 3ewp_A* Back     alignment and structure
>1njr_A 32.1 kDa protein in ADH3-RCA1 intergenic region; structural genomics, dimer, two domain organization, PSI, PR structure initiative; HET: XYL; 1.90A {Saccharomyces cerevisiae} SCOP: c.50.1.2 PDB: 1txz_A* 1ty8_A* Back     alignment and structure
>4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus} Back     alignment and structure
>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Back     alignment and structure
>1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} SCOP: d.13.1.0 PDB: 3n1t_A* Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Back     alignment and structure
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} SCOP: d.13.1.1 PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} SCOP: d.13.1.0 PDB: 3omf_A* 3oxk_A* Back     alignment and structure
>2eee_A Uncharacterized protein C6ORF130; macro domain, A1PP domain, ADP-ribose binding, rossmann fold, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l8r_A* Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Back     alignment and structure
>2fg1_A Conserved hypothetical protein BT1257; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.25A {Bacteroides thetaiotaomicron} SCOP: c.50.1.2 PDB: 2afc_A Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} SCOP: d.13.1.1 Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} SCOP: d.13.1.0 Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3q71_A Poly [ADP-ribose] polymerase 14; structural genomics, structural genomics consortium, SGC, transferase, PARP14 macro 2; HET: AR6; 2.20A {Homo sapiens} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Back     alignment and structure
>3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3q6z_A Poly [ADP-ribose] polymerase 14; structural genomics consortium, SGC, ADP-ribose binding, TRA; HET: APR; 2.23A {Homo sapiens} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>4abl_A Poly [ADP-ribose] polymerase 14; transferase, PARP14; 1.15A {Homo sapiens} PDB: 4abk_A Back     alignment and structure
>1spv_A Putative polyprotein/phosphatase; structural genomoics, alpha/beta monomeric protein, structural genomics, PSI, protein structure initiative; HET: MES; 2.00A {Escherichia coli} SCOP: c.50.1.2 Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>2xd7_A Core histone macro-H2A.2; chromosomal protein, nucleosome core, chromatin regulator, nucleus, DNA-binding protein, phosphoprotein; 2.09A {Homo sapiens} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1yd9_A Core histone macro-H2A.1; alpha-beta structure, A1PP domain, macro-domain, structural protein; 1.60A {Rattus norvegicus} SCOP: c.50.1.2 PDB: 1zr3_A* 2fxk_A 3iid_A* 3iif_A* 1zr5_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2x47_A Macro domain-containing protein 1; signaling protein, signal transduction, estrogen signaling; 1.70A {Homo sapiens} Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3eti_A X (ADRP) domain, macro domain of non-structural protein 3; coronavirus, X domain, RNA binding protein; 2.20A {Feline infectious peritonitis virus} PDB: 3ew5_A* 3jzt_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2dx6_A Hypothetical protein TTHA0132; conserved hypothetical protein, structural genomics, NPPSFA; 1.78A {Thermus thermophilus} PDB: 3v45_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1vhu_A Hypothetical protein AF1521; structural genomics, unknown function; HET: MSE MES; 1.34A {Archaeoglobus fulgidus} SCOP: c.50.1.2 PDB: 2bfq_A* 1hjz_A* 2bfr_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ejf_A Non-structural protein 3; IBV, coronavirus, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting; 1.60A {Avian infectious bronchitis virus} PDB: 3eke_A* 3ewo_A 3ewp_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>2acf_A Replicase polyprotein 1AB; ADRP domain, SARS NSP-3, APPR-1-P phosphatase, structural GE joint center for structural genomics, JCSG; 1.40A {Sars coronavirus TOR2} SCOP: c.50.1.2 PDB: 2fav_A* Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1njr_A 32.1 kDa protein in ADH3-RCA1 intergenic region; structural genomics, dimer, two domain organization, PSI, PR structure initiative; HET: XYL; 1.90A {Saccharomyces cerevisiae} SCOP: c.50.1.2 PDB: 1txz_A* 1ty8_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3gpg_A NSP3, non-structural protein 3; macro domain, X domain, alphavirus, VIZI enzymes involved in replication, ATP-binding, cell membrane endosome; 1.65A {Chikungunya virus} PDB: 3gpo_A* 3gpq_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3ejg_A Non-structural protein 3; HCOV 229E, X-domain, macro domain, NSP3, ADRP, hydrolase, ribosomal frameshifting, RNA-binding; 1.78A {Human coronavirus 229E} PDB: 3ewr_A* 3ewq_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3gqe_A Non-structural protein 3; macro domain, X domain, venezuelan equine encephalitis virus alphavirus; HET: BCN; 2.30A {Venezuelan equine encephalitis virus} PDB: 3gqo_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2vri_A Non-structural protein 3; RNA replication, nucleotide-binding, endonuclease, macro domain, viral protein, ATP-binding, exonuclease; 1.8A {Human coronavirus NL63} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>4gua_A Non-structural polyprotein; viral precursor polyprotein, protease, zinc-binding, hydrola; HET: MES; 2.85A {Sindbis virus} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2eee_A Uncharacterized protein C6ORF130; macro domain, A1PP domain, ADP-ribose binding, rossmann fold, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l8r_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2fg1_A Conserved hypothetical protein BT1257; structural genomics, PSI, PROT structure initiative; HET: MSE; 1.25A {Bacteroides thetaiotaomicron} SCOP: c.50.1.2 PDB: 2afc_A Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3czq_A Putative polyphosphate kinase 2; structural genomics, APC6299, PSI-2, structure initiative; HET: MSE GOL; 2.23A {Sinorhizobium meliloti} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2pof_A CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM02611, PSI-2, phospholipid biosynthesis structural genomics, protein structure initiative; 1.40A {Escherichia coli} SCOP: d.13.1.4 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3rhf_A Putative polyphosphate kinase 2 family protein; PSI-biology, MCSG, structural genomics, midwest center for S genomics; HET: PGE FLC PG4; 2.45A {Arthrobacter aurescens} Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3czp_A Putative polyphosphate kinase 2; PPK2, MCSG, PSI-2, structural protein structure initiative, midwest center for structural genomics; HET: MSE; 2.00A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3sig_A PArg, poly(ADP-ribose) glycohydrolase; HET: AR6; 1.28A {Thermomonospora curvata} PDB: 3sih_A 3sii_A* 3sij_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 761
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 2e-16
d1vlra1192 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C- 2e-16
d1vhua_192 c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeo 2e-09
d2acfa1168 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SA 6e-09
d1njra_264 c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker' 2e-08
d1yd9a1188 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Ratt 1e-06
d1ly1a_152 c.37.1.1 (A:) Polynucleotide kinase, kinase domain 1e-06
d1spva_172 c.50.1.2 (A:) Hypothetical protein YmbD {Escherich 4e-06
d1emsa1160 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-te 1e-05
d1kpfa_111 d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 2e-05
d1y23a_139 d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423] 4e-05
d1xqua_113 d.13.1.1 (A:) Putative hydrolase {Clostridium ther 6e-05
d1fita_146 d.13.1.1 (A:) FHIT (fragile histidine triad protei 2e-04
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 7e-04
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 8e-04
d2fg1a1154 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Ba 0.002
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: 5' polynucleotide kinase-3' phosphatase, C-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 75.7 bits (185), Expect = 2e-16
 Identities = 33/143 (23%), Positives = 61/143 (42%), Gaps = 9/143 (6%)

Query: 22  LVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTSASSALKKGKSV 81
           +V+ VG PG+GKSTF +  +   +  +  + +DT+         +C++S  +AL++GK V
Sbjct: 16  VVVAVGFPGAGKSTFIQEHLV--SAGYVHVNRDTLGS-----WQRCVSSCQAALRQGKRV 68

Query: 82  FLDRCNLEREQRTDFVKLG-GPEVDVHAVVLDLPAKLCISRSVKRIEHEGNLQGGKAAAV 140
            +D  N +   R  +++      V           +     +  R E         +  V
Sbjct: 69  VIDNTNPDVPSRARYIQCAKDAGVPCRCFNFCATIEQARHNNRFR-EMTDPSHAPVSDMV 127

Query: 141 VNRMLQKKELPKLSEGFSRITLC 163
           +    ++ E P L+EGF  I   
Sbjct: 128 MFSYRKQFEPPTLAEGFLEILEI 150


>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 192 Back     information, alignment and structure
>d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 192 Back     information, alignment and structure
>d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]} Length = 168 Back     information, alignment and structure
>d1njra_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 264 Back     information, alignment and structure
>d1yd9a1 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Length = 152 Back     information, alignment and structure
>d1spva_ c.50.1.2 (A:) Hypothetical protein YmbD {Escherichia coli [TaxId: 562]} Length = 172 Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 160 Back     information, alignment and structure
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Length = 139 Back     information, alignment and structure
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Length = 113 Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Length = 146 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d2fg1a1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query761
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 99.89
d1yd9a1188 Histone macro-H2a1.1 {Rat (Rattus norvegicus) [Tax 99.88
d1spva_172 Hypothetical protein YmbD {Escherichia coli [TaxId 99.87
d1vhua_192 Hypothetical protein AF1521 {Archaeon Archaeoglobu 99.86
d2acfa1168 Replicase polyprotein 1ab {SARS coronavirus [TaxId 99.81
d1kpfa_111 Protein kinase C inhibitor-1, PKCI-1 {Human (Homo 99.76
d1vlra1192 mRNA decapping enzyme DcpS C-terminal domain {Mous 99.76
d1xqua_113 Putative hydrolase {Clostridium thermocellum [TaxI 99.7
d1emsa1160 NIT-FHIT fusion protein, C-terminal domain {Nemato 99.7
d1njra_264 Hypothetical protein Ymr087W {Baker's yeast (Sacch 99.65
d1fita_146 FHIT (fragile histidine triad protein) {Human (Hom 99.64
d1y23a_139 Hit {Bacillus subtilis [TaxId: 1423]} 99.64
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 99.62
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 99.51
d2oika1139 Histidine triad protein Mfla2506 {Methylobacillus 99.48
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 99.43
d1z84a2156 Galactose-1-phosphate uridylyltransferase {Thale c 99.36
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 99.35
d1guqa2171 Galactose-1-phosphate uridylyltransferase {Escheri 99.33
d2fg1a1154 Hypothetical protein BT1257 {Bacteroides thetaiota 99.26
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 99.24
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 99.18
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 99.14
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 99.12
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 99.11
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 99.1
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 99.09
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 99.09
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 99.06
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 99.06
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 99.05
d1yd9a1188 Histone macro-H2a1.1 {Rat (Rattus norvegicus) [Tax 99.04
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 98.97
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 98.91
d1spva_172 Hypothetical protein YmbD {Escherichia coli [TaxId 98.91
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 98.88
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 98.87
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.87
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 98.84
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 98.82
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.79
d1vhua_192 Hypothetical protein AF1521 {Archaeon Archaeoglobu 98.78
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 98.77
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 98.72
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 98.7
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 98.66
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.62
d2acfa1168 Replicase polyprotein 1ab {SARS coronavirus [TaxId 98.57
d1njra_264 Hypothetical protein Ymr087W {Baker's yeast (Sacch 98.57
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 98.55
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 98.51
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 98.5
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 98.5
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 98.49
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.39
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 98.33
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 98.25
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 98.21
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 98.2
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 98.12
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 98.11
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 98.07
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 98.03
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 98.02
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.98
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 97.97
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 97.87
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 97.62
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 97.58
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.53
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.46
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 97.46
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.45
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.35
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 97.33
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.3
d1vmaa2213 GTPase domain of the signal recognition particle r 97.25
d2qy9a2211 GTPase domain of the signal recognition particle r 97.17
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.16
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 97.15
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.1
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 97.08
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 97.03
d1okkd2207 GTPase domain of the signal recognition particle r 96.98
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.92
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 96.88
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.84
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 96.82
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 96.75
d2fg1a1154 Hypothetical protein BT1257 {Bacteroides thetaiota 96.74
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.72
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.44
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.33
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.3
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 96.26
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.25
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 96.09
d2axpa1164 Hypothetical protein YorR {Bacillus subtilis [TaxI 96.01
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 95.99
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.93
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.91
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.7
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 95.59
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 95.58
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.56
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.46
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 95.4
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.27
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 95.05
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 95.05
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.97
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 94.95
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 94.93
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.86
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 94.78
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 94.51
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.5
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 94.45
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.44
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.43
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 94.42
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.35
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 94.34
d2pofa1220 CDP-diacylglycerol pyrophosphatase CDH {Escherichi 94.34
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 94.26
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 94.18
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 94.17
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.1
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 94.05
d2cota238 Zinc finger and SCAN domain-containing protein 16, 94.01
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.88
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.83
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.73
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 93.58
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.57
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.55
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 93.5
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 93.42
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.26
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.07
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 93.03
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 92.96
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 92.94
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.89
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 92.73
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 92.71
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.68
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 92.61
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.61
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 92.45
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 92.38
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.35
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.29
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 92.25
d1g2912240 Maltose transport protein MalK, N-terminal domain 92.15
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 92.15
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 92.08
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 92.08
d2awna2232 Maltose transport protein MalK, N-terminal domain 92.08
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 92.03
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 91.99
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.91
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 91.91
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 91.89
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 91.88
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 91.86
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.83
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 91.76
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 91.75
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 91.72
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 91.65
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 91.63
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 91.58
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 91.46
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 91.45
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 91.21
d1nrjb_209 Signal recognition particle receptor beta-subunit 91.19
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 91.16
d1z84a1173 Galactose-1-phosphate uridylyltransferase {Thale c 91.16
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 91.07
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.01
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 90.95
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 90.87
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 90.83
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 90.8
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 90.79
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 90.72
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 90.69
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 90.61
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 90.61
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 90.57
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 90.51
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 90.48
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 90.43
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 90.41
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 90.38
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 90.3
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 90.29
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 90.23
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 90.18
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 90.16
d2fh5b1207 Signal recognition particle receptor beta-subunit 90.14
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.06
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 89.96
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.86
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 89.79
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 89.73
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 89.73
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 89.71
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 89.59
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 89.4
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 89.35
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 89.22
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 89.17
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.14
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 89.13
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 89.12
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 89.1
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 89.06
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 89.03
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 89.02
d2hyda1255 Putative multidrug export ATP-binding/permease pro 89.0
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 88.92
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 88.78
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 88.77
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 88.77
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.63
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 88.63
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 88.58
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 88.49
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 88.49
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 88.44
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 88.39
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 88.18
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 88.13
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 88.12
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 87.99
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 87.94
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 87.83
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 87.69
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 87.66
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 87.64
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 87.64
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 87.47
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 87.45
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.32
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 87.28
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 87.22
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 87.2
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 87.08
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 87.08
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 86.87
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 86.86
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 86.54
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 86.35
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 86.29
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 86.26
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 86.03
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 85.89
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 85.79
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 85.73
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 85.35
d1tuea_205 Replication protein E1 helicase domain {Human papi 84.96
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 84.73
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 84.65
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 84.63
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 84.56
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 84.52
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 84.3
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 83.95
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 83.07
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 83.0
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 82.98
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 82.89
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 82.64
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 82.45
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 81.97
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 81.76
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 81.62
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 81.11
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 80.91
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 80.68
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: 5' polynucleotide kinase-3' phosphatase, C-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.89  E-value=3.9e-23  Score=201.57  Aligned_cols=141  Identities=24%  Similarity=0.360  Sum_probs=127.8

Q ss_pred             ccCccEEEEEEcCCCCcHHHHHHHHHHHcCCCeEEEecccccCCCCCcHHHHHHHHHHHHHCCCcEEEeCCCCCHHHHHH
Q 004319           16 KKWKQILVIMVGAPGSGKSTFCEHVMRSSARPWARICQDTINKGKSGTKVQCLTSASSALKKGKSVFLDRCNLEREQRTD   95 (761)
Q Consensus        16 ~~~~~~LIvLvG~PGSGKSTfA~~L~~~~~~~~~~I~~D~i~~~~~~~~~~~~~~~~~~L~~g~~VIID~tn~~~~~R~~   95 (761)
                      ..+.|.||+|+|+|||||||||++++...+  +.+|+.|.+     .++..+...+..+|..|.+||+|+||....+|..
T Consensus        10 ~~~~p~liil~G~pGsGKST~a~~l~~~~~--~~~i~~D~~-----~~~~~~~~~~~~~l~~g~~vIiD~t~~~~~~R~~   82 (172)
T d1yj5a2          10 LSPNPEVVVAVGFPGAGKSTFIQEHLVSAG--YVHVNRDTL-----GSWQRCVSSCQAALRQGKRVVIDNTNPDVPSRAR   82 (172)
T ss_dssp             SCSSCCEEEEECCTTSSHHHHHHHHTGGGT--CEEEEHHHH-----CSHHHHHHHHHHHHHTTCCEEEESCCCSHHHHHH
T ss_pred             CCCCCEEEEEECCCCCCHHHHHHHHHHhcC--CEEEchHHH-----HHHHHHHHHHHHHHHCCCCceeeCcCCCHHHHHH
Confidence            457899999999999999999999998887  889999998     4577788999999999999999999999999999


Q ss_pred             HHHh-CCCCceEEEEEEeCCHHHHHHHHHhcccccCCCCCCChHHHHHHHHhhhcCCCccCCceEEEEcC
Q 004319           96 FVKL-GGPEVDVHAVVLDLPAKLCISRSVKRIEHEGNLQGGKAAAVVNRMLQKKELPKLSEGFSRITLCQ  164 (761)
Q Consensus        96 ~~~l-~~~~~~v~vV~Ld~p~e~~~~R~~~R~~~~~~~~~~v~~~vI~r~~~~~e~P~~~EgFd~V~vv~  164 (761)
                      |+++ +.+++.+++|+|++|.++|.+|+.+|..+... ...+++.++.+|.+.|++|...|||+.|+.++
T Consensus        83 ~~~~a~~~~~~~~~v~l~~~~e~~~~Rn~~R~~~~~~-~~~v~~~~~~~~~~~fe~P~~~Egf~~i~~i~  151 (172)
T d1yj5a2          83 YIQCAKDAGVPCRCFNFCATIEQARHNNRFREMTDPS-HAPVSDMVMFSYRKQFEPPTLAEGFLEILEIP  151 (172)
T ss_dssp             HHHHHHHHTCCEEEEEECCCHHHHHHHHHHHHHHCTT-CCCCCHHHHHHHHHHCCCCCGGGSCSCEEEEC
T ss_pred             HHHHHHhcCCCEEEEEeCCCHHHHHHHHHHhcccCcc-cCccHHHHHHHHHHhCCCCCcccCCcEEEEEC
Confidence            9999 88999999999999999999999999765332 23588999999999999999999999999875



>d1yd9a1 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1spva_ c.50.1.2 (A:) Hypothetical protein YmbD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]} Back     information, alignment and structure
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1njra_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fg1a1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1yd9a1 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1spva_ c.50.1.2 (A:) Hypothetical protein YmbD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vhua_ c.50.1.2 (A:) Hypothetical protein AF1521 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2acfa1 c.50.1.2 (A:184-351) Replicase polyprotein 1ab {SARS coronavirus [TaxId: 227859]} Back     information, alignment and structure
>d1njra_ c.50.1.2 (A:) Hypothetical protein Ymr087W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d2fg1a1 c.50.1.2 (A:2-155) Hypothetical protein BT1257 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2axpa1 c.37.1.1 (A:2-165) Hypothetical protein YorR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2pofa1 d.13.1.4 (A:31-250) CDP-diacylglycerol pyrophosphatase CDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure