Citrus Sinensis ID: 004475


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSNTSDGKCGA
cccccccEEEEccccccccccEEEEccccccccccEEEcccccEEEEEEEEccccccccccEEEEEEEcccccEEEcccccccccccccccEEEEccccEEEEEEccccccccccccccccccEEEcccccccccccccccccccHHHcccccccccEEEEEccccccEEccccccEEEEEEcccccEEEEEEcccccccccccccccccEEEEcccccEEEEccccccccccccccccccccccccEEccccccEEEEEEEccccccccccccccEEEEEccccccccccEEEEEcccEEEEEEcccccEEEEEEEEccccEEEEEEEccccccccEEEEEccccccccccccccEEEcccccEEEEEEEcccccEEEEEEccccccccccccEEEEEEcccccEEEEEEcccccccEEEEEEEcccccccccccccEEEEEEEccccccEEEEEEcccccEEEcccccccccccccccEEEEEEEcccccEEEEEEEccccccccccccEEEEEEEcccccccccccccccccccccccccccHHHHHHHccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccHHHHHHcccccccccccccEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHHHHHHcccccccccccc
ccccccEEEEEccccccccccEEEccccccccccccEEcccccEEEEEEEEccccccccccEEEEEEEcccccccEcccccccccccccccEEEEccccEEEEEEcccccccccccccccccEEEEcccccccccccHHHHHccHHHHHHHHHHHHHcEEEEcccccEEEcccccHEEcccccccccEEEEEEEEcccccccccccccccEEEEcccccEEEEcccccccccccccccccccccccccEccccccEEEEEEEcccccccccccccccccccccccccccccHHEEEccccccEEEccccEEEEEEEccccccEEEEEEcccccccccEEEEcccccccccccccEEEEEcccccEEEEEEEccccccEEEEEccccccccccccEEEEEEcccccEEEEEEEcccccEEEEEEEEcccccEEEcccccEEEEEEccccccccEEEEEccccccEEEEcccccHHHHcccccEEEEEEcccccEEEEEEEcccccccccccccEEEEEEcccccccHHHHcccccccccccccccccHHHHHHccEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHcccccHccEEEEcccHHHHHHHHHHHcccHHHHHEEEcccccccccccccccHHcccccccHHHHHHcccHHHHHcccccEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHcccccHHHccc
mpfftgigihrllpddslgpekevhgypdgakinfvswspdgkriafsvrvdeednvssckLRVWIADaetgeakplfespdiclnaVFGSFvwvnnstlliftipssrrdppkktmvplgpkiqsneqKNIIISRMTdnllkdeydesLFDYYTTAQLVLGsldgtakdfgtpavytavepspdqkYVLITSmhrpysykvpcarfsqKVQVWTTDGKLVRelcdlppaedipvcynSVREGMRsiswradkpstlYWVEAQdrgdanvevsprdiiytqpaepaegekpeilhkldlrfsvswcddSLALVNETWYKtsqtrtwlvcpgskdvaprvLFDRVFenvysdpgspmmtrtstgTNVIAKIKKENDEQIYILLNgrgftpegnipfldlfdintgskerIWESNREKYFETAVALVFGqgeedinlNQLKILTSKESKTEITQYHILswplkkssqitnfphpyptlASLQKEMIKYQrkdgvpltatlylppgydqskdgplpclfwaypedykskdaagqvrgspnefsgmtptsSLIFLARRFAvlagpsipiigegdklpndrFVEQLVSSAEAAVEEVVRrgvadpsriavgghsygAFMTAHLLahaphlfccgiarsgsynktltpfgfqTEFRTLWEATNVYiemspithankikkpiliihgevddkvglfpmQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYClsntsdgkcga
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFsvrvdeednvsscKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIftipssrrdppkktmvplgpkiqsneqkniIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAvytavepspdQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRelcdlppaedipVCYNSVREGMRsiswradkpstLYWVEAQDrgdanvevspRDIIYtqpaepaegekPEILHKLDLRFSVSWCDDSLALVNETWYKtsqtrtwlvcpgskdVAPRVLFDRVFENvysdpgspmmtrtsTGTNVIAKIKKENDEQIYILLNGrgftpegniPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLsntsdgkcga
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFveqlvssaeaaveevvrrgvaDPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSNTSDGKCGA
***FTGIGIHRLLP*********VHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTI*************************NIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIY************EILHKLDLRFSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYS*************TNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDY***********************SLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLS*********
*PFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTI*****************************SRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQK*************
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSN********
*PFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSN********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFSVSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKYCLSNTSDGKCGA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query751 2.2.26 [Sep-21-2011]
Q8VZF3960 Probable glutamyl endopep yes no 0.990 0.775 0.716 0.0
Q10MJ1938 Probable glutamyl endopep yes no 0.989 0.792 0.711 0.0
P39839657 Uncharacterized peptidase yes no 0.290 0.331 0.266 2e-09
P34422740 Dipeptidyl peptidase fami yes no 0.201 0.204 0.291 9e-09
P13676732 Acylamino-acid-releasing yes no 0.210 0.215 0.272 2e-08
Q8R146732 Acylamino-acid-releasing yes no 0.211 0.217 0.245 3e-08
P80227730 Acylamino-acid-releasing yes no 0.198 0.204 0.288 1e-07
P19205732 Acylamino-acid-releasing yes no 0.185 0.189 0.260 5e-07
P14740767 Dipeptidyl peptidase 4 OS no no 0.326 0.319 0.264 6e-07
P28843760 Dipeptidyl peptidase 4 OS no no 0.327 0.323 0.265 2e-06
>sp|Q8VZF3|CGEP_ARATH Probable glutamyl endopeptidase, chloroplastic OS=Arabidopsis thaliana GN=GEP PE=2 SV=2 Back     alignment and function desciption
 Score = 1138 bits (2944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/748 (71%), Positives = 631/748 (84%), Gaps = 4/748 (0%)

Query: 1   MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC 60
           M F+TG+GIH+LLPD +L PEKE+ G PDG KINFV+WS DGK +AFS+RVDE  N  S 
Sbjct: 174 MSFYTGLGIHQLLPDGTLSPEKEITGIPDGGKINFVTWSNDGKHLAFSIRVDENGN--SS 231

Query: 61  KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL 120
           K  VW+AD ETG A+PLF S DI LNA+F SFVW++NSTLL+ TIPSSR +PPKK +VP 
Sbjct: 232 KPVVWVADVETGVARPLFNSQDIFLNAIFESFVWIDNSTLLVSTIPSSRGEPPKKPLVPS 291

Query: 121 GPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAV 180
           GPK  SNE K ++  R   +LLKDEYD  LFDYY ++QLVL SLDGT K+ G PAVYT++
Sbjct: 292 GPKTLSNETKTVVQVRTFQDLLKDEYDADLFDYYASSQLVLASLDGTVKEVGVPAVYTSL 351

Query: 181 EPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSV 240
           +PS D KY+L++S+HRPYS+ VPC RF +KV+VWTTDG+ VR+LCDLP AEDIP+  NSV
Sbjct: 352 DPSTDHKYLLVSSLHRPYSFIVPCGRFPKKVEVWTTDGRFVRQLCDLPLAEDIPIASNSV 411

Query: 241 REGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLR 300
           R+GMRSI+WRADKPSTL W E QD GDA +EVSPRDI+Y Q AEP  GE+PE+LHKLDLR
Sbjct: 412 RKGMRSINWRADKPSTL-WAETQDGGDAKMEVSPRDIVYMQSAEPLAGEEPEVLHKLDLR 470

Query: 301 FS-VSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTR 359
           +  +SWCDD+LALV E+WYKT +TRTW++ PGS DV+PR+LFDR  E+VYSDPGS M+ R
Sbjct: 471 YGGISWCDDTLALVYESWYKTRRTRTWVISPGSNDVSPRILFDRSSEDVYSDPGSTMLRR 530

Query: 360 TSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFE 419
           T  GT VIAKIKKENDE  Y+LLNG G TP+GN+PFLDLFDINTG+KERIWES++EKYFE
Sbjct: 531 TDAGTYVIAKIKKENDEGTYVLLNGSGATPQGNVPFLDLFDINTGNKERIWESDKEKYFE 590

Query: 420 TAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASL 479
           T VAL+  Q E D+ + +LKILTSKESKTE TQY +  WP +K  QITNFPHPYP LASL
Sbjct: 591 TVVALMSDQKEGDLKMEELKILTSKESKTENTQYSLQLWPDRKVQQITNFPHPYPQLASL 650

Query: 480 QKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEF 539
           QKEMI+YQRKDGV LTATLYLPPGYD SKDGPLPCLFW+YP ++KSKDAAGQVRGSPNEF
Sbjct: 651 QKEMIRYQRKDGVQLTATLYLPPGYDPSKDGPLPCLFWSYPGEFKSKDAAGQVRGSPNEF 710

Query: 540 SGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVAD 599
           +G+  TS+L++LARRFA+L+GP+IPIIGEGD+  NDR+VEQLV+SAEAAVEEVVRRGVAD
Sbjct: 711 AGIGSTSALLWLARRFAILSGPTIPIIGEGDEEANDRYVEQLVASAEAAVEEVVRRGVAD 770

Query: 600 PSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVY 659
            S+IAVGGHSYGAFMTA+LLAHAPHLF CGIARSG+YN+TLTPFGFQ E RTLWEATNVY
Sbjct: 771 RSKIAVGGHSYGAFMTANLLAHAPHLFACGIARSGAYNRTLTPFGFQNEDRTLWEATNVY 830

Query: 660 IEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVY 719
           +EMSP   ANKIKKPIL+IHGE D+  G   MQ++RFF+ALKGHGAL RLV+LP E H Y
Sbjct: 831 VEMSPFMSANKIKKPILLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVVLPHESHGY 890

Query: 720 AARENVMHVIWETDRWLQKYCLSNTSDG 747
           +ARE++MHV+WETDRWLQKYC+ NTSD 
Sbjct: 891 SARESIMHVLWETDRWLQKYCVPNTSDA 918




Serine-type protease active in vitro against the LHCII N-terminal. Cleaves its substrate on the carboxy-side of Glu residues.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -
>sp|Q10MJ1|CGEP_ORYSJ Probable glutamyl endopeptidase, chloroplastic OS=Oryza sativa subsp. japonica GN=GEP PE=2 SV=1 Back     alignment and function description
>sp|P39839|YUXL_BACSU Uncharacterized peptidase YuxL OS=Bacillus subtilis (strain 168) GN=yuxL PE=3 SV=3 Back     alignment and function description
>sp|P34422|DPF6_CAEEL Dipeptidyl peptidase family member 6 OS=Caenorhabditis elegans GN=dpf-6 PE=3 SV=2 Back     alignment and function description
>sp|P13676|ACPH_RAT Acylamino-acid-releasing enzyme OS=Rattus norvegicus GN=Apeh PE=1 SV=1 Back     alignment and function description
>sp|Q8R146|APEH_MOUSE Acylamino-acid-releasing enzyme OS=Mus musculus GN=Apeh PE=2 SV=3 Back     alignment and function description
>sp|P80227|ACPH_BOVIN Acylamino-acid-releasing enzyme OS=Bos taurus GN=APEH PE=1 SV=2 Back     alignment and function description
>sp|P19205|ACPH_PIG Acylamino-acid-releasing enzyme OS=Sus scrofa GN=APEH PE=1 SV=2 Back     alignment and function description
>sp|P14740|DPP4_RAT Dipeptidyl peptidase 4 OS=Rattus norvegicus GN=Dpp4 PE=1 SV=2 Back     alignment and function description
>sp|P28843|DPP4_MOUSE Dipeptidyl peptidase 4 OS=Mus musculus GN=Dpp4 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query751
297743980 913 unnamed protein product [Vitis vinifera] 0.992 0.815 0.740 0.0
359479944 961 PREDICTED: probable glutamyl endopeptida 0.990 0.774 0.738 0.0
224130988 967 predicted protein [Populus trichocarpa] 0.993 0.771 0.734 0.0
449436423 970 PREDICTED: probable glutamyl endopeptida 0.992 0.768 0.729 0.0
449436421 971 PREDICTED: probable glutamyl endopeptida 0.992 0.767 0.729 0.0
224064539 905 predicted protein [Populus trichocarpa] 0.988 0.819 0.729 0.0
357511363 962 Acylamino-acid-releasing enzyme [Medicag 0.993 0.775 0.719 0.0
30690669 961 prolyl oligopeptidase-like protein [Arab 0.992 0.775 0.717 0.0
297828471 962 serine-type peptidase [Arabidopsis lyrat 0.992 0.774 0.716 0.0
332278170 960 RecName: Full=Probable glutamyl endopept 0.990 0.775 0.716 0.0
>gi|297743980|emb|CBI36950.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1187 bits (3070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/747 (74%), Positives = 655/747 (87%), Gaps = 2/747 (0%)

Query: 1   MPFFTGIGIHRLLPDDSLGPEKEVHGYPDGAKINFVSWSPDGKRIAFSVRVDEEDNVSSC 60
           M F+T IGIH+L+PD +LGPEKEVHG+PDGAKINFVSWS +G+ ++FS+RVDEE+N SS 
Sbjct: 109 MSFYTSIGIHQLMPDGTLGPEKEVHGFPDGAKINFVSWSLNGQHLSFSIRVDEEEN-SSS 167

Query: 61  KLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPL 120
           KLR+W+AD ETG+A+PLF+SPDI LNAVF +FVWV++STLL+ TIP SR DPPKK +VP 
Sbjct: 168 KLRIWVADVETGKARPLFQSPDIHLNAVFDNFVWVDDSTLLVCTIPLSRGDPPKKPLVPS 227

Query: 121 GPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAV 180
           GPK+QSNEQKN++  R   +LLKDEYD  LFDYY T QLVL SLDGT K+ G PAVYT++
Sbjct: 228 GPKVQSNEQKNVVQVRTFQDLLKDEYDADLFDYYATTQLVLASLDGTMKEIGPPAVYTSM 287

Query: 181 EPSPDQKYVLITSMHRPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSV 240
           +PSPDQKY+LI+S+HRPYS+ VPC RF +KV +WT++GK VRELCDLP AEDIP+ +NSV
Sbjct: 288 DPSPDQKYLLISSIHRPYSFIVPCGRFPKKVDLWTSEGKFVRELCDLPLAEDIPIAFNSV 347

Query: 241 REGMRSISWRADKPSTLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLR 300
           R+GMRSI+WRADKPSTLYWVE QD GDA VEVSPRDI+Y QPAEP +GE+  ILHKLDLR
Sbjct: 348 RKGMRSINWRADKPSTLYWVETQDEGDAKVEVSPRDIVYMQPAEPLDGEQQAILHKLDLR 407

Query: 301 FS-VSWCDDSLALVNETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTR 359
           +  +SWCDDSLALV E+WYKT +TRTW++ PGS+DV+PR+LFDR  E+VYSDPGSPM+ R
Sbjct: 408 YGGISWCDDSLALVYESWYKTRRTRTWVISPGSEDVSPRILFDRSSEDVYSDPGSPMLRR 467

Query: 360 TSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFE 419
           T+ GT VIAKIKKENDE  YILLNG G TPEGNIPFLDLFDINTGSKERIWES++EKY+E
Sbjct: 468 TTAGTYVIAKIKKENDEGTYILLNGSGATPEGNIPFLDLFDINTGSKERIWESDKEKYYE 527

Query: 420 TAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASL 479
           T VAL+  Q E D+ LNQLKILTSKESKTE TQY I SW  KK+ QITNFPHPYP LASL
Sbjct: 528 TVVALMSDQSEGDLYLNQLKILTSKESKTENTQYFIQSWLDKKACQITNFPHPYPQLASL 587

Query: 480 QKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEF 539
           QKEMI+Y+RKDGV LTATLYLPPGYD SKDGPLPCL W+YP ++KSKDAAGQVRGSPNEF
Sbjct: 588 QKEMIRYERKDGVQLTATLYLPPGYDPSKDGPLPCLVWSYPGEFKSKDAAGQVRGSPNEF 647

Query: 540 SGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQLVSSAEAAVEEVVRRGVAD 599
           +G+ PTS+L++LARRFA+L+GP+IPIIGEG++  NDR+VEQLV+SAEAAVEEV+RRGVA 
Sbjct: 648 AGIGPTSALLWLARRFAILSGPTIPIIGEGNEEANDRYVEQLVASAEAAVEEVIRRGVAH 707

Query: 600 PSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVY 659
           P++IAVGGHSYGAFMTA+LLAHAPHLFCCGIARSG+YN+TLTPFGFQ E RTLWEAT+ Y
Sbjct: 708 PNKIAVGGHSYGAFMTANLLAHAPHLFCCGIARSGAYNRTLTPFGFQNEDRTLWEATDTY 767

Query: 660 IEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVY 719
           +EMSP   ANKIK+P+L+IHGE D+  G   MQ++RFF+ALKGHGAL RLV+LPFE H Y
Sbjct: 768 VEMSPFMSANKIKRPVLLIHGEEDNNPGTLTMQSDRFFNALKGHGALCRLVILPFESHGY 827

Query: 720 AARENVMHVIWETDRWLQKYCLSNTSD 746
           AARE++MHV+WETDRWLQK+C+SNT++
Sbjct: 828 AARESIMHVLWETDRWLQKHCVSNTTN 854




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359479944|ref|XP_002270510.2| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130988|ref|XP_002320974.1| predicted protein [Populus trichocarpa] gi|222861747|gb|EEE99289.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449436423|ref|XP_004135992.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 2 [Cucumis sativus] gi|449507837|ref|XP_004163143.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449436421|ref|XP_004135991.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 1 [Cucumis sativus] gi|449507834|ref|XP_004163142.1| PREDICTED: probable glutamyl endopeptidase, chloroplastic-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224064539|ref|XP_002301512.1| predicted protein [Populus trichocarpa] gi|222843238|gb|EEE80785.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357511363|ref|XP_003625970.1| Acylamino-acid-releasing enzyme [Medicago truncatula] gi|355500985|gb|AES82188.1| Acylamino-acid-releasing enzyme [Medicago truncatula] Back     alignment and taxonomy information
>gi|30690669|ref|NP_850473.1| prolyl oligopeptidase-like protein [Arabidopsis thaliana] gi|330255741|gb|AEC10835.1| prolyl oligopeptidase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297828471|ref|XP_002882118.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata] gi|297327957|gb|EFH58377.1| serine-type peptidase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|332278170|sp|Q8VZF3.2|CGEP_ARATH RecName: Full=Probable glutamyl endopeptidase, chloroplastic; Flags: Precursor Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query751
UNIPROTKB|Q8EHB8801 SO_1310 "Serine peptidase S9 f 0.778 0.730 0.341 6.9e-94
TIGR_CMR|SO_1310801 SO_1310 "conserved hypothetica 0.778 0.730 0.341 6.9e-94
TIGR_CMR|SO_4618645 SO_4618 "prolyl oligopeptidase 0.134 0.156 0.302 1.8e-09
TIGR_CMR|SO_4537675 SO_4537 "peptidase, putative" 0.182 0.202 0.267 2.6e-09
TAIR|locus:2169789746 AT5G24260 [Arabidopsis thalian 0.170 0.171 0.273 4.4e-06
TAIR|locus:2129920764 AARE "acylamino acid-releasing 0.186 0.183 0.292 4.8e-06
UNIPROTKB|Q47UC7693 CPS_4957 "Putative uncharacter 0.439 0.476 0.208 1.7e-05
TIGR_CMR|CPS_4957693 CPS_4957 "conserved hypothetic 0.439 0.476 0.208 1.7e-05
UNIPROTKB|Q0C2V8770 HNE_1217 "Dipeptidyl aminopept 0.183 0.179 0.277 7.2e-05
TIGR_CMR|BA_0165654 BA_0165 "prolyl oligopeptidase 0.191 0.220 0.243 0.00065
UNIPROTKB|Q8EHB8 SO_1310 "Serine peptidase S9 family" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
 Score = 903 (322.9 bits), Expect = 6.9e-94, Sum P(2) = 6.9e-94
 Identities = 206/603 (34%), Positives = 321/603 (53%)

Query:   136 RMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTPAVYTAVEPSPDQKYVLITSMH 195
             R   +LLK   D+ LF   TT+QL L  L+G     G P +      SPD +Y+L   + 
Sbjct:   210 RTYQDLLKTSADKQLFSRLTTSQLALVDLEGKLTKIGAPGIIEDFSVSPDGQYILSRQIT 269

Query:   196 RPYSYKVPCARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPS 255
              P+S +V    F    +++  +G+L+  L      E  P   +SV  G R   W   + +
Sbjct:   270 TPFSTQVKYDDFPTLTEIYNLNGQLITLLHQSQGGESRPQGKDSVLPGPRMFHWVQGQAA 329

Query:   256 TLYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFS-VSWCDDSLALVN 314
             TL + +A D+GD+  +   RD ++    +P   ++   + +   R + + W ++ LAL+ 
Sbjct:   330 TLAFTKALDQGDSQRDAPQRDSLWL--LDPPFTQQATRVAQTQWRITDIDWAENHLALIT 387

Query:   315 ETWYKTSQTRTWLVCPGSKDVAPRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKEN 374
             E   K  Q R   +     + +   L +R   + Y D G         G   +  ++ + 
Sbjct:   388 ERNSKAQQIRLSSLNTRLGESSLHTLNERNLRDKYQDLGL-FAKHYYPGKGQVVSLQ-QG 445

Query:   375 DEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIWESNREKYFETAVALVFGQGEEDIN 434
              +   ++  G+G TP+G+ PFL    + T     +W+S   +    +V  V       +N
Sbjct:   446 AKTTGLIHYGQGATPQGDKPFLKRTSLITSESSLLWQSASNRL--ESVRYV-------LN 496

Query:   435 LNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASLQKEMIKYQRKDGVPL 494
             L+ L+++ ++ES TE     +L+    K S +   P        +QK++I ++R DGVPL
Sbjct:   497 LDPLQLIINRESPTESPSLVLLN--AAKESVLYEQPDGLSAYLGMQKQLITFKRADGVPL 554

Query:   495 TATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARR 554
             + TLYLP  Y + + G LP L WAYP ++   + AGQ+  S N++  ++P   +  +A  
Sbjct:   555 SGTLYLPANYTKEQ-GTLPVLMWAYPREFNDPEVAGQISFSANQYPTISPRGPIPLVAEG 613

Query:   555 FAVLAGPSIPIIGEGDKLPNDRFXXXXXXXXXXXXXXXXXXXXXDPSRIAVGGHSYGAFM 614
             FAV    S+PII +GDK  ND F                     D  +IAVGGHSYGAFM
Sbjct:   614 FAVFDKVSMPIIAQGDKESNDTFREQLTANAQAAIDTLVDLGIADRKQIAVGGHSYGAFM 673

Query:   615 TAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNVYIEMSPITHANKIKKP 674
              A+LLAH   LF  GIARSG+YN++LTPFGFQ E RT W+A ++Y +MSP  +A+KIK P
Sbjct:   674 VANLLAHTD-LFYAGIARSGAYNRSLTPFGFQNEERTYWQANDIYQQMSPFNYADKIKSP 732

Query:   675 ILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDR 734
             +L+IHGE+D   G FP+Q+ER FDA++G G  +RLV+LPFE H Y A+E++ H+++E  +
Sbjct:   733 LLLIHGEMDQNSGTFPLQSERLFDAIQGLGGKARLVILPFEGHSYTAKESLEHLLFEQSQ 792

Query:   735 WLQ 737
             +L+
Sbjct:   793 FLK 795


GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TIGR_CMR|SO_1310 SO_1310 "conserved hypothetical protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4618 SO_4618 "prolyl oligopeptidase family protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4537 SO_4537 "peptidase, putative" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TAIR|locus:2169789 AT5G24260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129920 AARE "acylamino acid-releasing enzyme" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q47UC7 CPS_4957 "Putative uncharacterized protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_4957 CPS_4957 "conserved hypothetical protein" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|Q0C2V8 HNE_1217 "Dipeptidyl aminopeptidase IV" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0165 BA_0165 "prolyl oligopeptidase family protein, putative" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q10MJ1CGEP_ORYSJ3, ., 4, ., 2, 1, ., -0.71170.98930.7921yesno
Q8VZF3CGEP_ARATH3, ., 4, ., 2, 1, ., -0.71650.99060.775yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00028112001
SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (884 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00015534001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (725 aa)
       0.422

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query751
COG1506620 COG1506, DAP2, Dipeptidyl aminopeptidases/acylamin 2e-43
pfam00326212 pfam00326, Peptidase_S9, Prolyl oligopeptidase fam 2e-25
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 1e-10
pfam12695145 pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam 1e-08
COG0412236 COG0412, COG0412, Dienelactone hydrolase and relat 8e-08
COG0400207 COG0400, COG0400, Predicted esterase [General func 8e-07
COG0657312 COG0657, Aes, Esterase/lipase [Lipid metabolism] 3e-05
COG4099387 COG4099, COG4099, Predicted peptidase [General fun 1e-04
PRK10566249 PRK10566, PRK10566, esterase; Provisional 4e-04
pfam01738215 pfam01738, DLH, Dienelactone hydrolase family 4e-04
COG1073299 COG1073, COG1073, Hydrolases of the alpha/beta sup 0.002
pfam02129265 pfam02129, Peptidase_S15, X-Pro dipeptidyl-peptida 0.002
>gnl|CDD|224423 COG1506, DAP2, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
 Score =  166 bits (422), Expect = 2e-43
 Identities = 86/323 (26%), Positives = 138/323 (42%), Gaps = 34/323 (10%)

Query: 431 EDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPYPTLASL-QKEMIKYQRK 489
              +++  K+  +  S TE     I  +   + +++T+  +       L + E + Y+  
Sbjct: 316 PGFDVDGRKLALAYSSPTE--PPEIYLYDRGEEAKLTSSNNSGLKKVKLAEPEPVTYKSN 373

Query: 490 DGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLI 549
           DG  +   LY PPG+D  K  PL  + + +              G P+   G +    + 
Sbjct: 374 DGETIHGWLYKPPGFDPRKKYPL--IVYIH--------------GGPSAQVGYSFNPEIQ 417

Query: 550 FLARR-FAVLAGPSIPIIGEGDK---LPNDRFVEQLVSSAEAAVEEVVRRGVADPSRIAV 605
            LA   +AVLA       G G +        +    +    AAV+ +V+  + DP RI +
Sbjct: 418 VLASAGYAVLAPNYRGSTGYGREFADAIRGDWGGVDLEDLIAAVDALVKLPLVDPERIGI 477

Query: 606 GGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEAT--------N 657
            G SYG +MT       P  F   +A +G  +  L         R   E           
Sbjct: 478 TGGSYGGYMTLLAATKTP-RFKAAVAVAGGVDWLLYFGESTEGLRFDPEENGGGPPEDRE 536

Query: 658 VYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHH 717
            Y + SPI +A+ IK P+L+IHGE DD+V +   QAE+  DALK  G    LV+ P E H
Sbjct: 537 KYEDRSPIFYADNIKTPLLLIHGEEDDRVPIE--QAEQLVDALKRKGKPVELVVFPDEGH 594

Query: 718 VYAARENVMHVIWETDRWLQKYC 740
            ++  EN + V+ E   W +++ 
Sbjct: 595 GFSRPENRVKVLKEILDWFKRHL 617


Length = 620

>gnl|CDD|215859 pfam00326, Peptidase_S9, Prolyl oligopeptidase family Back     alignment and domain information
>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|223489 COG0412, COG0412, Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|223477 COG0400, COG0400, Predicted esterase [General function prediction only] Back     alignment and domain information
>gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|226584 COG4099, COG4099, Predicted peptidase [General function prediction only] Back     alignment and domain information
>gnl|CDD|182555 PRK10566, PRK10566, esterase; Provisional Back     alignment and domain information
>gnl|CDD|216672 pfam01738, DLH, Dienelactone hydrolase family Back     alignment and domain information
>gnl|CDD|223999 COG1073, COG1073, Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|216890 pfam02129, Peptidase_S15, X-Pro dipeptidyl-peptidase (S15 family) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 751
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 100.0
PRK10115686 protease 2; Provisional 100.0
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 99.97
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 99.97
COG1770682 PtrB Protease II [Amino acid transport and metabol 99.96
PRK01029428 tolB translocation protein TolB; Provisional 99.94
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.94
PRK01029428 tolB translocation protein TolB; Provisional 99.94
PRK03629429 tolB translocation protein TolB; Provisional 99.93
PRK05137435 tolB translocation protein TolB; Provisional 99.93
PRK04043419 tolB translocation protein TolB; Provisional 99.93
PRK03629429 tolB translocation protein TolB; Provisional 99.92
PRK05137435 tolB translocation protein TolB; Provisional 99.92
PRK04043419 tolB translocation protein TolB; Provisional 99.92
PRK04792448 tolB translocation protein TolB; Provisional 99.92
PRK02889427 tolB translocation protein TolB; Provisional 99.91
PRK04922433 tolB translocation protein TolB; Provisional 99.91
PRK04922433 tolB translocation protein TolB; Provisional 99.91
PRK04792448 tolB translocation protein TolB; Provisional 99.91
PRK02889427 tolB translocation protein TolB; Provisional 99.91
PRK00178430 tolB translocation protein TolB; Provisional 99.9
PRK00178430 tolB translocation protein TolB; Provisional 99.9
COG4946668 Uncharacterized protein related to the periplasmic 99.9
PRK01742429 tolB translocation protein TolB; Provisional 99.88
PRK01742429 tolB translocation protein TolB; Provisional 99.87
COG1505648 Serine proteases of the peptidase family S9A [Amin 99.87
KOG2237712 consensus Predicted serine protease [Posttranslati 99.87
KOG1455313 consensus Lysophospholipase [Lipid transport and m 99.86
PLN02298330 hydrolase, alpha/beta fold family protein 99.86
PRK10566249 esterase; Provisional 99.85
PRK13604307 luxD acyl transferase; Provisional 99.85
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.85
PLN02385349 hydrolase; alpha/beta fold family protein 99.84
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.83
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.83
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 99.83
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.83
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.83
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.82
PLN02442283 S-formylglutathione hydrolase 99.82
PHA02857276 monoglyceride lipase; Provisional 99.82
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 99.81
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.81
PRK10749330 lysophospholipase L2; Provisional 99.8
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.8
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 99.79
COG0823425 TolB Periplasmic component of the Tol biopolymer t 99.78
PLN02652395 hydrolase; alpha/beta fold family protein 99.78
PRK10162318 acetyl esterase; Provisional 99.78
KOG1552258 consensus Predicted alpha/beta hydrolase [General 99.77
COG1647243 Esterase/lipase [General function prediction only] 99.77
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 99.76
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 99.75
PRK11460232 putative hydrolase; Provisional 99.74
COG4946668 Uncharacterized protein related to the periplasmic 99.7
COG2267298 PldB Lysophospholipase [Lipid metabolism] 99.7
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 99.69
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 99.69
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.69
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.67
COG0657312 Aes Esterase/lipase [Lipid metabolism] 99.66
COG4099387 Predicted peptidase [General function prediction o 99.66
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.66
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 99.65
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 99.65
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 99.64
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 99.64
TIGR03611257 RutD pyrimidine utilization protein D. This protei 99.64
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.63
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.62
PRK00870302 haloalkane dehalogenase; Provisional 99.62
PLN02511388 hydrolase 99.62
COG0400207 Predicted esterase [General function prediction on 99.62
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.62
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 99.61
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 99.61
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.61
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.6
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 99.59
PRK10985324 putative hydrolase; Provisional 99.59
PRK10673255 acyl-CoA esterase; Provisional 99.59
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 99.58
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 99.58
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 99.58
PLN02824294 hydrolase, alpha/beta fold family protein 99.57
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 99.56
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.56
PLN02965255 Probable pheophorbidase 99.56
PLN00021313 chlorophyllase 99.55
PLN02679360 hydrolase, alpha/beta fold family protein 99.55
PF10503220 Esterase_phd: Esterase PHB depolymerase 99.54
KOG0315311 consensus G-protein beta subunit-like protein (con 99.53
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 99.53
PRK06489360 hypothetical protein; Provisional 99.53
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 99.52
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 99.52
PRK03592295 haloalkane dehalogenase; Provisional 99.51
PLN02872395 triacylglycerol lipase 99.51
COG2945210 Predicted hydrolase of the alpha/beta superfamily 99.51
PRK11071190 esterase YqiA; Provisional 99.51
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 99.5
PLN02894402 hydrolase, alpha/beta fold family protein 99.5
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.5
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 99.5
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 99.5
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 99.48
PRK10349256 carboxylesterase BioH; Provisional 99.48
PLN02578354 hydrolase 99.47
PRK07581339 hypothetical protein; Validated 99.47
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.47
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.46
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 99.46
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 99.46
PRK03204286 haloalkane dehalogenase; Provisional 99.46
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.45
PRK00175379 metX homoserine O-acetyltransferase; Provisional 99.45
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 99.44
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.44
PRK11028330 6-phosphogluconolactonase; Provisional 99.43
KOG3043242 consensus Predicted hydrolase related to dienelact 99.42
PRK08775343 homoserine O-acetyltransferase; Provisional 99.42
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 99.42
PLN03084383 alpha/beta hydrolase fold protein; Provisional 99.42
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.41
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 99.41
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 99.4
KOG0293519 consensus WD40 repeat-containing protein [Function 99.4
KOG1838409 consensus Alpha/beta hydrolase [General function p 99.38
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 99.37
KOG3101283 consensus Esterase D [General function prediction 99.37
PLN02211273 methyl indole-3-acetate methyltransferase 99.37
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.36
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.36
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 99.35
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 99.35
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.35
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.35
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 99.34
COG2936 563 Predicted acyl esterases [General function predict 99.34
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.32
KOG4667269 consensus Predicted esterase [Lipid transport and 99.28
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.28
PRK11028330 6-phosphogluconolactonase; Provisional 99.28
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 99.28
KOG0266456 consensus WD40 repeat-containing protein [General 99.27
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.27
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.27
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 99.26
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.25
PRK06765389 homoserine O-acetyltransferase; Provisional 99.25
KOG2984277 consensus Predicted hydrolase [General function pr 99.24
KOG2055514 consensus WD40 repeat protein [General function pr 99.23
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.22
KOG2055514 consensus WD40 repeat protein [General function pr 99.22
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.22
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 99.22
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.21
KOG0315311 consensus G-protein beta subunit-like protein (con 99.21
PRK05855 582 short chain dehydrogenase; Validated 99.2
KOG0293519 consensus WD40 repeat-containing protein [Function 99.2
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.19
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 99.18
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.18
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.17
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 99.17
PRK13616591 lipoprotein LpqB; Provisional 99.17
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.15
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.11
COG0627316 Predicted esterase [General function prediction on 99.11
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.1
KOG0286343 consensus G-protein beta subunit [General function 99.09
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 99.09
PRK07868 994 acyl-CoA synthetase; Validated 99.09
KOG2112206 consensus Lysophospholipase [Lipid transport and m 99.09
TIGR01838 532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 99.08
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 99.08
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.07
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.07
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 99.07
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.06
PTZ00421493 coronin; Provisional 99.06
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.06
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 99.04
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.04
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 99.02
KOG0266456 consensus WD40 repeat-containing protein [General 99.01
KOG0973 942 consensus Histone transcription regulator HIRA, WD 98.99
KOG0286343 consensus G-protein beta subunit [General function 98.98
KOG3847399 consensus Phospholipase A2 (platelet-activating fa 98.97
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 98.97
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 98.96
KOG0296399 consensus Angio-associated migratory cell protein 98.96
KOG2096420 consensus WD40 repeat protein [General function pr 98.95
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.95
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 98.93
KOG0263707 consensus Transcription initiation factor TFIID, s 98.92
PTZ00420568 coronin; Provisional 98.91
KOG2382315 consensus Predicted alpha/beta hydrolase [General 98.9
PLN00181793 protein SPA1-RELATED; Provisional 98.87
KOG0645312 consensus WD40 repeat protein [General function pr 98.87
KOG2314698 consensus Translation initiation factor 3, subunit 98.87
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 98.86
KOG0282503 consensus mRNA splicing factor [Function unknown] 98.86
KOG2315566 consensus Predicted translation initiation factor 98.85
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 98.83
COG4188365 Predicted dienelactone hydrolase [General function 98.83
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 98.82
KOG2564343 consensus Predicted acetyltransferases and hydrola 98.81
KOG0772641 consensus Uncharacterized conserved protein, conta 98.8
KOG2139445 consensus WD40 repeat protein [General function pr 98.78
PRK10115686 protease 2; Provisional 98.78
PTZ00421493 coronin; Provisional 98.77
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 98.76
KOG0265338 consensus U5 snRNP-specific protein-like factor an 98.76
PRK13616591 lipoprotein LpqB; Provisional 98.76
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.75
KOG2314698 consensus Translation initiation factor 3, subunit 98.75
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 98.75
KOG0275508 consensus Conserved WD40 repeat-containing protein 98.74
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 98.73
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 98.73
KOG2624403 consensus Triglyceride lipase-cholesterol esterase 98.69
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 98.69
KOG1273405 consensus WD40 repeat protein [General function pr 98.69
KOG2315566 consensus Predicted translation initiation factor 98.68
COG2819264 Predicted hydrolase of the alpha/beta superfamily 98.67
KOG0772641 consensus Uncharacterized conserved protein, conta 98.67
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.67
PLN00181793 protein SPA1-RELATED; Provisional 98.64
COG4757281 Predicted alpha/beta hydrolase [General function p 98.63
KOG0282503 consensus mRNA splicing factor [Function unknown] 98.63
KOG0263707 consensus Transcription initiation factor TFIID, s 98.62
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 98.62
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 98.62
KOG0265338 consensus U5 snRNP-specific protein-like factor an 98.6
KOG0296399 consensus Angio-associated migratory cell protein 98.58
KOG1274 933 consensus WD40 repeat protein [General function pr 98.58
PTZ00420568 coronin; Provisional 98.58
KOG2096420 consensus WD40 repeat protein [General function pr 98.58
COG3208244 GrsT Predicted thioesterase involved in non-riboso 98.57
KOG2139445 consensus WD40 repeat protein [General function pr 98.57
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.56
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 98.56
KOG2048691 consensus WD40 repeat protein [General function pr 98.55
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 98.52
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 98.52
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 98.52
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 98.51
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 98.51
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.49
KOG0645312 consensus WD40 repeat protein [General function pr 98.49
PF00135 535 COesterase: Carboxylesterase family The prints ent 98.48
KOG2106626 consensus Uncharacterized conserved protein, conta 98.48
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.47
KOG0639705 consensus Transducin-like enhancer of split protei 98.47
KOG0284464 consensus Polyadenylation factor I complex, subuni 98.45
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.44
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 98.44
KOG0639705 consensus Transducin-like enhancer of split protei 98.42
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.41
COG1073299 Hydrolases of the alpha/beta superfamily [General 98.41
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 98.4
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 98.4
KOG1274 933 consensus WD40 repeat protein [General function pr 98.39
KOG14451012 consensus Tumor-specific antigen (contains WD repe 98.36
KOG1553517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 98.35
PRK04940180 hypothetical protein; Provisional 98.31
KOG0640430 consensus mRNA cleavage stimulating factor complex 98.3
KOG0284464 consensus Polyadenylation factor I complex, subuni 98.29
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 98.28
KOG0275508 consensus Conserved WD40 repeat-containing protein 98.25
KOG1539910 consensus WD repeat protein [General function pred 98.22
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.21
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 98.21
KOG0643327 consensus Translation initiation factor 3, subunit 98.2
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.19
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 98.18
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 98.17
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 98.17
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 98.17
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.17
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 98.16
KOG0310487 consensus Conserved WD40 repeat-containing protein 98.16
KOG14451012 consensus Tumor-specific antigen (contains WD repe 98.15
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 98.11
KOG0295406 consensus WD40 repeat-containing protein [Function 98.09
KOG0643327 consensus Translation initiation factor 3, subunit 98.08
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.07
KOG0283712 consensus WD40 repeat-containing protein [Function 98.06
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 98.05
KOG1273405 consensus WD40 repeat protein [General function pr 98.05
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 98.04
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 98.04
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 98.04
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 98.01
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.0
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 97.97
KOG0640430 consensus mRNA cleavage stimulating factor complex 97.97
COG1770682 PtrB Protease II [Amino acid transport and metabol 97.96
KOG0306888 consensus WD40-repeat-containing subunit of the 18 97.95
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 97.95
COG3243 445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 97.95
KOG0306888 consensus WD40-repeat-containing subunit of the 18 97.95
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 97.95
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 97.94
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 97.94
KOG0295406 consensus WD40 repeat-containing protein [Function 97.93
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 97.91
KOG0288459 consensus WD40 repeat protein TipD [General functi 97.9
TIGR02171912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 97.9
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 97.9
KOG0278334 consensus Serine/threonine kinase receptor-associa 97.88
PRK02888635 nitrous-oxide reductase; Validated 97.86
KOG0771398 consensus Prolactin regulatory element-binding pro 97.84
KOG0289506 consensus mRNA splicing factor [General function p 97.84
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 97.83
KOG0278334 consensus Serine/threonine kinase receptor-associa 97.81
COG3150191 Predicted esterase [General function prediction on 97.8
KOG2106626 consensus Uncharacterized conserved protein, conta 97.79
COG3386307 Gluconolactonase [Carbohydrate transport and metab 97.79
KOG0647347 consensus mRNA export protein (contains WD40 repea 97.75
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 97.75
KOG0316307 consensus Conserved WD40 repeat-containing protein 97.73
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 97.73
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.73
KOG1063764 consensus RNA polymerase II elongator complex, sub 97.68
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 97.67
KOG2110391 consensus Uncharacterized conserved protein, conta 97.67
KOG0289506 consensus mRNA splicing factor [General function p 97.67
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 97.66
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 97.65
COG4947227 Uncharacterized protein conserved in bacteria [Fun 97.62
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 97.61
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 97.6
TIGR02171912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 97.6
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.6
KOG2048691 consensus WD40 repeat protein [General function pr 97.6
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 97.59
KOG0316307 consensus Conserved WD40 repeat-containing protein 97.59
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.58
KOG0283712 consensus WD40 repeat-containing protein [Function 97.57
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 97.52
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 97.52
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 97.49
KOG1516 545 consensus Carboxylesterase and related proteins [G 97.48
KOG0268433 consensus Sof1-like rRNA processing protein (conta 97.47
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.46
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.45
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 97.44
KOG0303472 consensus Actin-binding protein Coronin, contains 97.43
KOG2931326 consensus Differentiation-related gene 1 protein ( 97.43
KOG0647347 consensus mRNA export protein (contains WD40 repea 97.42
KOG4840299 consensus Predicted hydrolases or acyltransferases 97.42
KOG0288459 consensus WD40 repeat protein TipD [General functi 97.41
COG4814288 Uncharacterized protein with an alpha/beta hydrola 97.4
KOG0299479 consensus U3 snoRNP-associated protein (contains W 97.35
KOG0771398 consensus Prolactin regulatory element-binding pro 97.34
KOG0319775 consensus WD40-repeat-containing subunit of the 18 97.34
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 97.33
KOG4328498 consensus WD40 protein [Function unknown] 97.32
PRK02888635 nitrous-oxide reductase; Validated 97.29
KOG1963792 consensus WD40 repeat protein [General function pr 97.28
KOG0302440 consensus Ribosome Assembly protein [General funct 97.28
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 97.25
KOG2110391 consensus Uncharacterized conserved protein, conta 97.24
KOG1063764 consensus RNA polymerase II elongator complex, sub 97.22
KOG1963 792 consensus WD40 repeat protein [General function pr 97.22
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 97.22
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 97.22
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 97.2
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 97.19
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 97.19
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.18
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 97.16
KOG4328498 consensus WD40 protein [Function unknown] 97.12
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 97.12
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 97.12
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 97.12
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 97.07
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.07
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 97.06
KOG1539910 consensus WD repeat protein [General function pred 97.05
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 97.01
KOG0268433 consensus Sof1-like rRNA processing protein (conta 96.98
COG3391381 Uncharacterized conserved protein [Function unknow 96.98
KOG4283397 consensus Transcription-coupled repair protein CSA 96.93
KOG0269 839 consensus WD40 repeat-containing protein [Function 96.85
KOG0303472 consensus Actin-binding protein Coronin, contains 96.83
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 96.81
KOG0290364 consensus Conserved WD40 repeat-containing protein 96.8
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 96.8
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.75
COG3391381 Uncharacterized conserved protein [Function unknow 96.68
KOG0313423 consensus Microtubule binding protein YTM1 (contai 96.62
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 96.55
KOG14081080 consensus WD40 repeat protein [Function unknown] 96.52
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 96.51
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 96.5
KOG0310487 consensus Conserved WD40 repeat-containing protein 96.45
PRK13614573 lipoprotein LpqB; Provisional 96.44
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.41
PRK13615557 lipoprotein LpqB; Provisional 96.38
KOG3967297 consensus Uncharacterized conserved protein [Funct 96.37
COG3204316 Uncharacterized protein conserved in bacteria [Fun 96.33
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 96.33
KOG0313423 consensus Microtubule binding protein YTM1 (contai 96.31
KOG0294362 consensus WD40 repeat-containing protein [Function 96.3
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 96.29
KOG0294362 consensus WD40 repeat-containing protein [Function 96.27
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 96.27
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 96.27
PF00450 415 Peptidase_S10: Serine carboxypeptidase; InterPro: 96.19
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 96.18
KOG2041 1189 consensus WD40 repeat protein [General function pr 96.18
KOG0269839 consensus WD40 repeat-containing protein [Function 96.17
KOG1551371 consensus Uncharacterized conserved protein [Funct 96.17
KOG4388880 consensus Hormone-sensitive lipase HSL [Lipid tran 96.14
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.14
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 96.13
KOG2111346 consensus Uncharacterized conserved protein, conta 96.1
KOG2111346 consensus Uncharacterized conserved protein, conta 96.1
KOG0646476 consensus WD40 repeat protein [General function pr 96.04
COG3319257 Thioesterase domains of type I polyketide synthase 96.01
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 95.88
KOG0308735 consensus Conserved WD40 repeat-containing protein 95.86
KOG3975301 consensus Uncharacterized conserved protein [Funct 95.8
KOG4283397 consensus Transcription-coupled repair protein CSA 95.74
KOG0290364 consensus Conserved WD40 repeat-containing protein 95.73
KOG2321703 consensus WD40 repeat protein [General function pr 95.7
KOG0302440 consensus Ribosome Assembly protein [General funct 95.65
COG4782377 Uncharacterized protein conserved in bacteria [Fun 95.55
KOG0641350 consensus WD40 repeat protein [General function pr 95.54
COG3490366 Uncharacterized protein conserved in bacteria [Fun 95.49
KOG4389 601 consensus Acetylcholinesterase/Butyrylcholinestera 95.45
PRK13613599 lipoprotein LpqB; Provisional 95.43
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 95.43
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 95.42
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 95.32
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 95.29
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 95.24
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 95.22
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 95.15
KOG0646476 consensus WD40 repeat protein [General function pr 95.03
KOG0299479 consensus U3 snoRNP-associated protein (contains W 95.03
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 95.03
KOG12141289 consensus Nidogen and related basement membrane pr 94.86
PLN02209437 serine carboxypeptidase 94.69
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 94.56
PRK102521296 entF enterobactin synthase subunit F; Provisional 94.32
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 94.32
COG1075336 LipA Predicted acetyltransferases and hydrolases w 94.29
PF13449326 Phytase-like: Esterase-like activity of phytase 94.28
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 94.24
TIGR03712511 acc_sec_asp2 accessory Sec system protein Asp2. Th 94.21
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.09
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 93.87
COG2319466 FOG: WD40 repeat [General function prediction only 93.8
PRK13614573 lipoprotein LpqB; Provisional 93.78
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.78
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 93.64
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 93.45
KOG4532344 consensus WD40-like repeat containing protein [Gen 93.42
PRK13615557 lipoprotein LpqB; Provisional 93.36
KOG2565469 consensus Predicted hydrolases or acyltransferases 93.11
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 93.1
PF13449326 Phytase-like: Esterase-like activity of phytase 93.08
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 93.05
COG4287 507 PqaA PhoPQ-activated pathogenicity-related protein 93.01
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 92.97
KOG1912 1062 consensus WD40 repeat protein [General function pr 92.96
KOG2521350 consensus Uncharacterized conserved protein [Funct 92.95
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 92.65
KOG0308735 consensus Conserved WD40 repeat-containing protein 92.42
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 92.35
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 92.3
KOG1282 454 consensus Serine carboxypeptidases (lysosomal cath 92.26
KOG0267825 consensus Microtubule severing protein katanin p80 92.23
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 92.15
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 92.12
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 92.1
PLN02454414 triacylglycerol lipase 92.06
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 91.9
KOG0641350 consensus WD40 repeat protein [General function pr 91.84
KOG3724 973 consensus Negative regulator of COPII vesicle form 91.72
KOG0267825 consensus Microtubule severing protein katanin p80 91.69
KOG2041 1189 consensus WD40 repeat protein [General function pr 91.69
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 91.63
KOG2321703 consensus WD40 repeat protein [General function pr 91.6
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 91.41
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 91.32
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 91.23
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 91.23
PLN02408365 phospholipase A1 90.81
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 90.72
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 90.5
KOG0270463 consensus WD40 repeat-containing protein [Function 90.36
PF03283361 PAE: Pectinacetylesterase 90.28
PLN02571413 triacylglycerol lipase 90.25
TIGR03606454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 90.16
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 90.08
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=7.7e-42  Score=377.20  Aligned_cols=573  Identities=21%  Similarity=0.219  Sum_probs=375.9

Q ss_pred             cccceeecCCCCeEEEEEeecccccccCCceeEEEEEcCCCCeeeccCCCCccccceeeeeEEecCCcEEEEeecCCCCC
Q 004475           32 KINFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESPDICLNAVFGSFVWVNNSTLLIFTIPSSRRD  111 (751)
Q Consensus        32 ~~~~p~~SPDG~~iaf~~~~~~~~~~~~~~~~l~i~~~~~g~~~~lt~~~~~~~~~~~~~~~wspDg~~l~~~~~~~~~~  111 (751)
                      .+..|..+|+|+.++|+...- +.........+|+.+...  .+.++.+..      ...+.|||||+.++|....... 
T Consensus        14 ~~~~~~~~~~~~~~~~i~~~~-~~~~~~~~~~~~~~d~~~--~~~~~~~~~------~~~~~~spdg~~~~~~~~~~~~-   83 (620)
T COG1506          14 RVSDPRVSPPGGRLAYILTGL-DFLKPLYKSSLWVSDGKT--VRLLTFGGG------VSELRWSPDGSVLAFVSTDGGR-   83 (620)
T ss_pred             cccCcccCCCCceeEEeeccc-cccccccccceEEEeccc--ccccccCCc------ccccccCCCCCEEEEEeccCCC-
Confidence            477899999999999998621 111225668899977544  444444332      5678999999999998621111 


Q ss_pred             CCCCCCCCCCCceeeccccccccchhhhhccCCccchhhhhhheeeEEEEEcCCCCceecCCC-ceEEeeeeCCCCceEE
Q 004475          112 PPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVLGSLDGTAKDFGTP-AVYTAVEPSPDQKYVL  190 (751)
Q Consensus       112 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~G~~~~lt~~-~~~~~~~~SpDG~~i~  190 (751)
                                                                  ..++|+++.+|   .++.. ..+....|+|+|+.++
T Consensus        84 --------------------------------------------~~~l~l~~~~g---~~~~~~~~v~~~~~~~~g~~~~  116 (620)
T COG1506          84 --------------------------------------------VAQLYLVDVGG---LITKTAFGVSDARWSPDGDRIA  116 (620)
T ss_pred             --------------------------------------------cceEEEEecCC---ceeeeecccccceeCCCCCeEE
Confidence                                                        15889988774   33323 5667899999999999


Q ss_pred             EEEecCCcccccc--------------cCCCceeEEEEeCCCceeeeeccCCCCCCCCCccCCccCCCceeeeecCCCce
Q 004475          191 ITSMHRPYSYKVP--------------CARFSQKVQVWTTDGKLVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPST  256 (751)
Q Consensus       191 ~~~~~~~~~~~~~--------------~~~~~~~l~~~d~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~spdG~~~  256 (751)
                      +............              .+.....++++|..+ ....             .......+..+.++++++. 
T Consensus       117 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~l~~~d~~~-~~~~-------------~~~~~~~~~~~~~~~~~~~-  181 (620)
T COG1506         117 FLTAEGASKRDGGDHLFVDRLPVWFDGRGGERSDLYVVDIES-KLIK-------------LGLGNLDVVSFATDGDGRL-  181 (620)
T ss_pred             EEecccccccCCceeeeecccceeecCCCCcccceEEEccCc-cccc-------------ccCCCCceeeeeeCCCCce-
Confidence            9433221100000              000112334444333 1111             1111222334455555554 


Q ss_pred             EEEEEeccCCCCccccCcccceeeccCCCCCCCCceEeEeeceeEE-EEEecCCceEEEeeeecc----cceeEEEecCC
Q 004475          257 LYWVEAQDRGDANVEVSPRDIIYTQPAEPAEGEKPEILHKLDLRFS-VSWCDDSLALVNETWYKT----SQTRTWLVCPG  331 (751)
Q Consensus       257 i~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~-~~~spdg~~l~~~~~~~~----~~~~l~~~~~~  331 (751)
                      ++..........     .....++....   .+....++.....+. +.|.++|+.+++......    ....+++.+.+
T Consensus       182 ~~~~~~~~~~~~-----~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~gk~~~~~~~~~~~~~~~~~~~~~~~~~  253 (620)
T COG1506         182 VASIRLDDDADP-----WVTNLYVLIEG---NGELESLTPGEGSISKLAFDADGKSIALLGTESDRGLAEGDFILLLDGE  253 (620)
T ss_pred             eEEeeeccccCC-----ceEeeEEEecC---CCceEEEcCCCceeeeeeeCCCCCeeEEeccCCccCccccceEEEEecc
Confidence            444332211011     11122222221   345556666666677 999999998887764332    22345555522


Q ss_pred             CCCCccee-eeecccccccCCCCCCCeeeCCCCCEEEEeeeecCCcceEEEEccCCCCCCCCCceeEEEecCCCceeEEe
Q 004475          332 SKDVAPRV-LFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKERIW  410 (751)
Q Consensus       332 ~~~~~~~~-l~~~~~~~~~~~~~~~~~~~spDG~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~d~~~g~~~~l~  410 (751)
                      .+  .... +...+  ...   +.....+.-++..++|...+.                 .....+...+..++. ..+.
T Consensus       254 ~~--~~d~~~~~~~--~~~---~~~~~~~~~~~~~~~~~~~~~-----------------~g~~~l~~~~~~~~~-~~~~  308 (620)
T COG1506         254 LG--EVDGDLSSGD--DTR---GAWAVEGGLDGDGLLFIATDG-----------------GGSSPLFRVDDLGGG-VEGL  308 (620)
T ss_pred             cc--ccceeeccCC--ccc---CcHHhccccCCCcEEEEEecC-----------------CCceEEEEEeccCCc-eeee
Confidence            21  1111 11111  000   000012234555566655321                 111223333322222 2222


Q ss_pred             eccchhhhhceeeeecCCcceeeccCCCEEEEEEecCCCCCeEEEEEcCCCceeEeecCCCCC-CCccCCceEEEEEEcC
Q 004475          411 ESNREKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHPY-PTLASLQKEMIKYQRK  489 (751)
Q Consensus       411 ~~~~~~~~~~~~~~~~~~~~~~~s~dg~~l~~~~~~~~~~~~l~~~~~~~g~~~~lt~~~~~~-~~~~~~~~e~i~~~~~  489 (751)
                      ..+.             .....|+.+++.+++..+++..|+++|+.+.  ++..+++...... .+....+.|.++++..
T Consensus       309 ~~~~-------------~~v~~f~~~~~~~~~~~s~~~~p~~i~~~~~--~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~  373 (620)
T COG1506         309 SGDD-------------GGVPGFDVDGRKLALAYSSPTEPPEIYLYDR--GEEAKLTSSNNSGLKKVKLAEPEPVTYKSN  373 (620)
T ss_pred             cCCC-------------ceEEEEeeCCCEEEEEecCCCCccceEEEcC--CCceEEeecccccccccccCCceEEEEEcC
Confidence            2221             1113456689999999999999999999997  5666666655443 3455678999999999


Q ss_pred             CCceEEEEEEcCCCCCCCCCCCccEEEEEcCCCCcCcccCCcccCCCCccCCCCchHHHHHHhCCeEEEEcCCCCCCCCC
Q 004475          490 DGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEG  569 (751)
Q Consensus       490 ~~~~i~~~~~~P~~~~~~~~~~~P~vv~~HGg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~v~~~~~~~~~g~g  569 (751)
                      +|.+|.+++++|.++++.++  +|+||++||||....+             .......+.|+++||+|+.+++++..|+|
T Consensus       374 dG~~i~~~l~~P~~~~~~k~--yP~i~~~hGGP~~~~~-------------~~~~~~~q~~~~~G~~V~~~n~RGS~GyG  438 (620)
T COG1506         374 DGETIHGWLYKPPGFDPRKK--YPLIVYIHGGPSAQVG-------------YSFNPEIQVLASAGYAVLAPNYRGSTGYG  438 (620)
T ss_pred             CCCEEEEEEecCCCCCCCCC--CCEEEEeCCCCccccc-------------cccchhhHHHhcCCeEEEEeCCCCCCccH
Confidence            99999999999999877654  9999999999743211             12235677889999999999999999998


Q ss_pred             CCCCC---chhHHHHHHHHHHHHHHHHHcCCCCCCcEEEEEeChHHHHHHHHHHhCCCceeEEEEccCCCCCCCCccCcc
Q 004475          570 DKLPN---DRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQ  646 (751)
Q Consensus       570 ~~~~~---~~~~~~~~~d~~~~v~~l~~~~~id~~~i~l~G~S~GG~~a~~~a~~~p~~~~~~v~~~~~~d~~~~~~~~~  646 (751)
                      ..+..   ..+.....+|+.++++++.+.+.+|++||+|+|+|+||+|+++++.+.| .|+++++..+.+++........
T Consensus       439 ~~F~~~~~~~~g~~~~~D~~~~~~~l~~~~~~d~~ri~i~G~SyGGymtl~~~~~~~-~f~a~~~~~~~~~~~~~~~~~~  517 (620)
T COG1506         439 REFADAIRGDWGGVDLEDLIAAVDALVKLPLVDPERIGITGGSYGGYMTLLAATKTP-RFKAAVAVAGGVDWLLYFGEST  517 (620)
T ss_pred             HHHHHhhhhccCCccHHHHHHHHHHHHhCCCcChHHeEEeccChHHHHHHHHHhcCc-hhheEEeccCcchhhhhccccc
Confidence            86433   2234456899999999999999999999999999999999999999997 8888888888766443322211


Q ss_pred             cc--------cccchhhHHHHHhcCcccccCCCCCCEEEEEcCCCCCCCCChHHHHHHHHHHHhCCCcEEEEEeCCCCCc
Q 004475          647 TE--------FRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHV  718 (751)
Q Consensus       647 ~~--------~~~~~~~~~~~~~~~~~~~~~~~~~P~li~~G~~D~~vp~~~~~~~~~~~~l~~~~~~~~~~~~~~~~H~  718 (751)
                      ..        ...++.+.+.|...+|+.+++++++|+|+|||++|..||  .+++++++++|+.+|+++++++||+++|.
T Consensus       518 ~~~~~~~~~~~~~~~~~~~~~~~~sp~~~~~~i~~P~LliHG~~D~~v~--~~q~~~~~~aL~~~g~~~~~~~~p~e~H~  595 (620)
T COG1506         518 EGLRFDPEENGGGPPEDREKYEDRSPIFYADNIKTPLLLIHGEEDDRVP--IEQAEQLVDALKRKGKPVELVVFPDEGHG  595 (620)
T ss_pred             hhhcCCHHHhCCCcccChHHHHhcChhhhhcccCCCEEEEeecCCccCC--hHHHHHHHHHHHHcCceEEEEEeCCCCcC
Confidence            11        111111577899999999999999999999999999999  99999999999999999999999999999


Q ss_pred             CCccccHHHHHHHHHHHHHHHhcC
Q 004475          719 YAARENVMHVIWETDRWLQKYCLS  742 (751)
Q Consensus       719 ~~~~~~~~~~~~~~~~fl~~~l~~  742 (751)
                      +...++....++++++||+++++.
T Consensus       596 ~~~~~~~~~~~~~~~~~~~~~~~~  619 (620)
T COG1506         596 FSRPENRVKVLKEILDWFKRHLKQ  619 (620)
T ss_pred             CCCchhHHHHHHHHHHHHHHHhcC
Confidence            998788889999999999999864



>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PRK13615 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG3967 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4388 consensus Hormone-sensitive lipase HSL [Lipid transport and metabolism] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4389 consensus Acetylcholinesterase/Butyrylcholinesterase [Signal transduction mechanisms] Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>KOG1214 consensus Nidogen and related basement membrane protein proteins [Cell wall/membrane/envelope biogenesis; Extracellular structures] Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2 Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PRK13614 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PRK13615 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2521 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query751
2ecf_A741 Crystal Structure Of Dipeptidyl Aminopeptidase Iv F 2e-08
2qr5_A582 Aeropyrum Pernix Acylaminoacyl Peptidase, H367a Mut 1e-05
2qzp_A562 Crystal Structure Of Mutation Of An Acylptide Hydro 1e-05
1ve6_A582 Crystal Structure Of An Acylpeptide HydrolaseESTERA 1e-05
2gbc_A730 Native Dpp-Iv (Cd26) From Rat Length = 730 2e-05
2hu8_A582 Binding Of Inhibitors By Acylaminoacyl Peptidase Le 3e-05
3o4j_A582 Structure And Catalysis Of Acylaminoacyl Peptidase 5e-05
3o4h_A582 Structure And Catalysis Of Acylaminoacyl Peptidase 1e-04
1xfd_A723 Structure Of A Human A-Type Potassium Channel Accel 2e-04
>pdb|2ECF|A Chain A, Crystal Structure Of Dipeptidyl Aminopeptidase Iv From Stenotrophomonas Maltophilia Length = 741 Back     alignment and structure

Iteration: 1

Score = 58.2 bits (139), Expect = 2e-08, Method: Compositional matrix adjust. Identities = 43/152 (28%), Positives = 66/152 (43%), Gaps = 14/152 (9%) Query: 599 DPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGFQTEFRTLWEATNV 658 DP+RI V G S G +MT LLA A + CG+A + + L + + L + Sbjct: 600 DPARIGVQGWSNGGYMTLMLLAKASDSYACGVAGAPVTDWGLYDSHYTERYMDLPARNDA 659 Query: 659 -YIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHH 717 Y E +TH ++ P+L+IHG DD V LF + AL+ G L+ P H Sbjct: 660 GYREARVLTHIEGLRSPLLLIHGMADDNV-LF-TNSTSLMSALQKRGQPFELMTYPGAKH 717 Query: 718 VYAARENVMHVIWETDRWLQKYCLSNTSDGKC 749 + + L +Y ++ G+C Sbjct: 718 GLSGADA-----------LHRYRVAEAFLGRC 738
>pdb|2QR5|A Chain A, Aeropyrum Pernix Acylaminoacyl Peptidase, H367a Mutant Length = 582 Back     alignment and structure
>pdb|2QZP|A Chain A, Crystal Structure Of Mutation Of An Acylptide HydrolaseESTERASE FROM AEROPYRUM PERNIX K1 Length = 562 Back     alignment and structure
>pdb|1VE6|A Chain A, Crystal Structure Of An Acylpeptide HydrolaseESTERASE FROM Aeropyrum Pernix K1 Length = 582 Back     alignment and structure
>pdb|2GBC|A Chain A, Native Dpp-Iv (Cd26) From Rat Length = 730 Back     alignment and structure
>pdb|2HU8|A Chain A, Binding Of Inhibitors By Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|3O4J|A Chain A, Structure And Catalysis Of Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|3O4H|A Chain A, Structure And Catalysis Of Acylaminoacyl Peptidase Length = 582 Back     alignment and structure
>pdb|1XFD|A Chain A, Structure Of A Human A-Type Potassium Channel Accelerating Factor Dppx, A Member Of The Dipeptidyl Aminopeptidase Family Length = 723 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query751
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 7e-34
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 1e-31
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 4e-28
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 4e-26
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 3e-25
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 1e-22
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 9e-20
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 7e-19
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 2e-18
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 5e-18
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 3e-17
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 4e-17
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 6e-17
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 3e-16
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 1e-15
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 6e-15
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 1e-14
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 2e-14
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 5e-13
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 5e-13
3nuz_A398 Putative acetyl xylan esterase; structural genomic 8e-13
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 1e-12
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 2e-12
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 3e-12
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 4e-12
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 1e-11
1vkh_A273 Putative serine hydrolase; structural genomics, jo 5e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 8e-10
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 2e-09
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 3e-09
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 6e-09
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 3e-05
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 1e-08
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 1e-08
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 2e-08
3bjr_A283 Putative carboxylesterase; structural genomics, jo 1e-07
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 3e-07
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 3e-07
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 3e-07
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 3e-07
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 3e-07
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 3e-07
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 1e-06
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 2e-06
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 1e-05
1k32_A 1045 Tricorn protease; protein degradation, substrate g 1e-05
1k32_A1045 Tricorn protease; protein degradation, substrate g 2e-04
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 2e-05
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 3e-05
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 7e-05
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 1e-04
3llc_A270 Putative hydrolase; structural genomics, joint cen 1e-04
3h04_A275 Uncharacterized protein; protein with unknown func 1e-04
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 2e-04
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 2e-04
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 2e-04
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 2e-04
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 3e-04
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 3e-04
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 4e-04
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 4e-04
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 4e-04
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 8e-04
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Length = 662 Back     alignment and structure
 Score =  137 bits (346), Expect = 7e-34
 Identities = 50/286 (17%), Positives = 88/286 (30%), Gaps = 58/286 (20%)

Query: 482 EMIKYQRKDGVPLTATLYLPPG--YDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEF 539
           ++  +   DG  + A +Y P    +    D   P +  A+          G     P   
Sbjct: 392 QIRTFTAPDGREIHAHIYPPHSPDFTGPADELPPYVVMAHG---------GPTSRVPAVL 442

Query: 540 SGMTPTSSLIFLARR-FAVLAGPSIPIIGEGDKLPNDR--------FVEQL--------V 582
                     +   R   V                N          + E+L        V
Sbjct: 443 DLDVA-----YFTSRGIGVAD-------------VNYGGSTGYGRAYRERLRGRWGVVDV 484

Query: 583 SSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYN----- 637
               A    +   G AD +R+AV G S G +  A  L     ++ CG       +     
Sbjct: 485 EDCAAVATALAEEGTADRARLAVRGGSAGGWTAASSLVS-TDVYACGTVLYPVLDLLGWA 543

Query: 638 KTLTP----FGFQTEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQA 693
              T             +  E    Y + +P+T A++++ P L++ G  D      P Q 
Sbjct: 544 DGGTHDFESRYLDFLIGSFEEFPERYRDRAPLTRADRVRVPFLLLQGLEDPVCP--PEQC 601

Query: 694 ERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKY 739
           +RF +A+ G G     +    E H +  +E ++  +        + 
Sbjct: 602 DRFLEAVAGCGVPHAYLSFEGEGHGFRRKETMVRALEAELSLYAQV 647


>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Length = 582 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Length = 290 Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Length = 318 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Length = 337 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Length = 346 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Length = 741 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Length = 706 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Length = 740 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Length = 719 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Length = 723 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Length = 386 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Length = 415 Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Length = 380 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Length = 238 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Length = 251 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Length = 405 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Length = 262 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Length = 422 Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Length = 398 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Length = 446 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Length = 223 Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Length = 391 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Length = 226 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} Length = 209 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Length = 273 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Length = 251 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Length = 276 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Length = 277 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Length = 347 Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Length = 347 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Length = 251 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Length = 305 Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Length = 403 Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Length = 283 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Length = 223 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} Length = 270 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Length = 247 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Length = 226 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Length = 306 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Length = 270 Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Length = 318 Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Length = 258 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Length = 262 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Length = 1045 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Length = 241 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Length = 218 Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Length = 259 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Length = 268 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Length = 270 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Length = 275 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Length = 239 Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Length = 331 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Length = 232 Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Length = 397 Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Length = 367 Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Length = 275 Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Length = 278 Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Length = 297 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Length = 297 Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Length = 560 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query751
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 100.0
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 100.0
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 100.0
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 100.0
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 100.0
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 100.0
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 100.0
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 100.0
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 100.0
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 100.0
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 100.0
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 100.0
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 100.0
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.95
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.92
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.91
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.91
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.91
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.91
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.91
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.9
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.9
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.9
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.9
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.9
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 99.9
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.89
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.89
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.89
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.88
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.88
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.88
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.87
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.87
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.87
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.87
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 99.87
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.87
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.87
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.87
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.87
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.87
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.87
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.87
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.87
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.86
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.86
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.86
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 99.86
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.86
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.86
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.85
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.85
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.85
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.85
3ain_A323 303AA long hypothetical esterase; carboxylesterase 99.85
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 99.85
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 99.85
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.85
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.85
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 99.85
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.84
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 99.84
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.84
3h04_A275 Uncharacterized protein; protein with unknown func 99.84
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.84
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 99.84
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.84
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.83
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.83
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 99.83
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.83
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 99.83
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.83
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.82
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 99.82
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.82
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.82
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.82
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.81
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.81
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 99.81
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 99.81
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.81
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.81
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.81
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 99.81
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.81
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.81
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 99.8
3llc_A270 Putative hydrolase; structural genomics, joint cen 99.8
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.8
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.8
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.79
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 99.79
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.79
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 99.79
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 99.79
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.79
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.79
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.78
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.78
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.78
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 99.78
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 99.78
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.77
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 99.77
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.77
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.76
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 99.76
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.75
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.75
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 99.75
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.75
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.75
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 99.75
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.75
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.74
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.74
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 99.74
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.74
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 99.74
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.74
4f21_A246 Carboxylesterase/phospholipase family protein; str 99.74
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 99.73
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.73
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 99.73
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.73
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.72
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 99.72
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.72
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 99.72
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.72
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 99.72
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 99.72
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.72
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 99.72
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.72
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 99.72
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 99.72
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 99.71
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 99.71
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 99.71
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 99.71
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 99.7
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 99.7
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 99.7
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 99.7
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 99.7
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 99.7
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.7
3d59_A383 Platelet-activating factor acetylhydrolase; secret 99.7
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.7
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.7
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.7
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 99.7
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 99.7
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.7
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 99.7
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 99.69
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 99.69
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 99.69
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 99.69
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 99.69
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.69
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 99.69
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 99.69
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 99.68
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.68
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 99.68
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 99.68
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.68
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 99.68
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.68
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 99.68
3nuz_A398 Putative acetyl xylan esterase; structural genomic 99.68
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 99.68
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 99.67
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.67
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.67
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 99.67
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 99.66
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.66
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 99.66
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 99.66
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 99.66
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 99.66
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 99.66
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 99.66
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 99.66
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.66
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.66
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.65
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 99.65
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 99.65
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.65
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.65
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 99.65
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.65
1iup_A282 META-cleavage product hydrolase; aromatic compound 99.65
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.64
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 99.63
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.63
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 99.63
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.63
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 99.63
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.63
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.63
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 99.63
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 99.63
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 99.63
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 99.62
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 99.62
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 99.62
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 99.62
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.62
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 99.62
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 99.62
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 99.62
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.62
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.62
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.62
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.62
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.62
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.61
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 99.61
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.61
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 99.61
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.61
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 99.61
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 99.61
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.61
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 99.61
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.61
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 99.61
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.6
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 99.6
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.6
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.6
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 99.6
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.59
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.59
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.58
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 99.58
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 99.58
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 99.58
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 99.58
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.58
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.58
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.58
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 99.57
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.57
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.57
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 99.57
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 99.57
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.57
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 99.57
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 99.57
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 99.56
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.56
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 99.56
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.56
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.55
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 99.55
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.55
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 99.55
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.55
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.55
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.55
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.54
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.54
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.54
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.54
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.54
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.53
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.53
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.52
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.52
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.52
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.52
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.52
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 99.51
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 99.51
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.51
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 99.51
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.5
1r3d_A264 Conserved hypothetical protein VC1974; structural 99.5
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.5
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.5
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.5
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.5
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.49
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.49
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.49
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.49
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.49
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.48
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 99.48
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 99.48
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.47
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 99.47
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.47
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.47
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.47
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.47
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.46
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.46
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.46
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.45
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 99.18
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.45
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.44
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.43
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.41
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 99.41
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.41
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.41
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.39
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 99.39
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 99.38
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.38
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.38
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.38
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 99.38
2pm7_B297 Protein transport protein SEC13, protein transport 99.37
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.37
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.37
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.36
3jrp_A379 Fusion protein of protein transport protein SEC13 99.36
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.36
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.36
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.36
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.36
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.35
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.35
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.35
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.34
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 99.33
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.32
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.32
1kez_A300 Erythronolide synthase; polyketide synthase, modul 99.32
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.32
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.31
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.31
3jrp_A379 Fusion protein of protein transport protein SEC13 99.3
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.3
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.29
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.28
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.28
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.28
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.28
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.27
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.27
2pm7_B297 Protein transport protein SEC13, protein transport 99.26
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.25
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.25
3lp5_A250 Putative cell surface hydrolase; structural genom 99.24
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.23
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.23
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.22
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.22
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 99.21
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.21
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.19
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.18
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.18
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.18
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.17
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.15
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 99.15
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.15
3jro_A753 Fusion protein of protein transport protein SEC13 99.14
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.14
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.14
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.14
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.14
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.13
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.12
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.12
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.1
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.1
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.1
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.07
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.07
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.07
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.07
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.06
3jro_A 753 Fusion protein of protein transport protein SEC13 99.06
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.06
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.03
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 99.02
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.01
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.0
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.0
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 98.99
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 98.99
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 98.97
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 98.97
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 98.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.97
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 98.95
2ece_A462 462AA long hypothetical selenium-binding protein; 98.95
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 98.93
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 98.9
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 98.89
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.88
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.87
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 98.86
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.86
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 98.85
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 98.85
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.84
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.83
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 98.79
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 98.79
3tej_A329 Enterobactin synthase component F; nonribosomal pe 98.78
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 98.77
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.77
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 98.75
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 98.75
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 98.74
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.73
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.73
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 98.72
3v65_B386 Low-density lipoprotein receptor-related protein; 98.72
3v65_B386 Low-density lipoprotein receptor-related protein; 98.71
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 98.7
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 98.7
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.7
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.7
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.69
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 98.69
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.68
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 98.68
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 98.68
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 98.66
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 98.64
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.64
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.63
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 98.62
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.59
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 98.58
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.58
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.58
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 98.57
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 98.56
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.56
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.56
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 98.55
2ece_A462 462AA long hypothetical selenium-binding protein; 98.54
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.51
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.51
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 98.49
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.48
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.48
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.47
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.45
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.45
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.43
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.41
2qe8_A343 Uncharacterized protein; structural genomics, join 98.4
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.38
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 98.38
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.36
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 98.35
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 98.35
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.35
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 98.35
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 98.34
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.32
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.32
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.29
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 98.29
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.28
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.27
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 98.25
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.23
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.16
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.11
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 98.08
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 98.06
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.05
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.03
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.99
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 97.97
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.97
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 97.95
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.89
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.86
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.78
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.75
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.73
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.69
3kya_A496 Putative phosphatase; structural genomics, joint c 97.64
2qe8_A343 Uncharacterized protein; structural genomics, join 97.59
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.58
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.56
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.55
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.5
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.49
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
Probab=100.00  E-value=2.3e-54  Score=498.64  Aligned_cols=608  Identities=14%  Similarity=0.074  Sum_probs=420.4

Q ss_pred             eeEEeecCCCCCCCCcccccCCCCcc--cc--cceeecCCCCeEEEEEeecccccccCCceeEEEEEcCCCCeeeccCCC
Q 004475            6 GIGIHRLLPDDSLGPEKEVHGYPDGA--KI--NFVSWSPDGKRIAFSVRVDEEDNVSSCKLRVWIADAETGEAKPLFESP   81 (751)
Q Consensus         6 ~~~~~~~~~~~~~g~~~~l~~~~~~~--~~--~~p~~SPDG~~iaf~~~~~~~~~~~~~~~~l~i~~~~~g~~~~lt~~~   81 (751)
                      +|+++++.+    |+.+.+.......  .+  ..++|||||++|||...... ........++|++|+++|+.++|+...
T Consensus        37 ~i~~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~Spdg~~l~~~~~~~~-~~r~~~~~~~~~~d~~~~~~~~l~~~~  111 (740)
T 4a5s_A           37 NILVFNAEY----GNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNYVK-QWRHSYTASYDIYDLNKRQLITEERIP  111 (740)
T ss_dssp             EEEEEETTT----CCEEEEECTTTTTTCCSCCCEEEECTTSSEEEEEEEEEE-CSSSCEEEEEEEEETTTTEECCSSCCC
T ss_pred             cEEEEECCC----CceEEEEechhhhhhcccccceEECCCCCEEEEEECCee-eEEEccceEEEEEECCCCcEEEcccCC
Confidence            699999999    8877664221111  12  23899999999999875211 111244589999999999999997655


Q ss_pred             CccccceeeeeEEecCCcEEEEeecCCCCCCCCCCCCCCCCceeeccccccccchhhhhccCCccchhhhhhheeeEEEE
Q 004475           82 DICLNAVFGSFVWVNNSTLLIFTIPSSRRDPPKKTMVPLGPKIQSNEQKNIIISRMTDNLLKDEYDESLFDYYTTAQLVL  161 (751)
Q Consensus        82 ~~~~~~~~~~~~wspDg~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  161 (751)
                      .     .+..++|||||++|+|...                                                  .+||+
T Consensus       112 ~-----~~~~~~~SPdG~~la~~~~--------------------------------------------------~~i~~  136 (740)
T 4a5s_A          112 N-----NTQWVTWSPVGHKLAYVWN--------------------------------------------------NDIYV  136 (740)
T ss_dssp             T-----TEEEEEECSSTTCEEEEET--------------------------------------------------TEEEE
T ss_pred             C-----cceeeEECCCCCEEEEEEC--------------------------------------------------CeEEE
Confidence            4     3678899999999999843                                                  48999


Q ss_pred             EcC-CCCceecCCCc---eE-----------------EeeeeCCCCceEEEEEecCCccc--cc----------------
Q 004475          162 GSL-DGTAKDFGTPA---VY-----------------TAVEPSPDQKYVLITSMHRPYSY--KV----------------  202 (751)
Q Consensus       162 ~~~-~G~~~~lt~~~---~~-----------------~~~~~SpDG~~i~~~~~~~~~~~--~~----------------  202 (751)
                      +++ +|+.++||..+   .+                 ..+.|||||++|+|.+.+.....  ..                
T Consensus       137 ~~~~~~~~~~lt~~g~~~~~~~g~~~~v~~ee~~~~~~~~~wSpDg~~la~~~~d~~~v~~~~~~~~~~~~~~~~~~~~~  216 (740)
T 4a5s_A          137 KIEPNLPSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRV  216 (740)
T ss_dssp             ESSTTSCCEECCSCCBTTTEEESBCCHHHHHHTSSSSBCEEECTTSSEEEEEEEECTTCCEEEEEECCSTTCSSCEEEEE
T ss_pred             EECCCCceEEEcCCCCccceecCcccccccchhcCCCcceEECCCCCEEEEEEEcccCCceEEEEeecCCCCCCCcceee
Confidence            999 66888887641   11                 23889999999999876543100  00                


Q ss_pred             ---ccCCC--ceeEEEEeCCC---c---eeeeeccCCCCCCCCCccCCccCCCceeeeecCCCceEEEEEeccCCCCccc
Q 004475          203 ---PCARF--SQKVQVWTTDG---K---LVRELCDLPPAEDIPVCYNSVREGMRSISWRADKPSTLYWVEAQDRGDANVE  271 (751)
Q Consensus       203 ---~~~~~--~~~l~~~d~~~---~---~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~spdG~~~i~~~~~~~~~~~~~~  271 (751)
                         ..+..  ...|++||+++   +   +.+++....       .+......+..++|||||+. +++....        
T Consensus       217 ~yp~~G~~~~~~~l~v~d~~~~~~~~~~~~~~l~~~~-------~~~~~~~~~~~~~wspdg~~-~~~~~~r--------  280 (740)
T 4a5s_A          217 PYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPA-------SMLIGDHYLCDVTWATQERI-SLQWLRR--------  280 (740)
T ss_dssp             ECCBTTSCCCEEEEEEEETTSCCSSSCCCEEEECCCH-------HHHTSCEEEEEEEEEETTEE-EEEEEES--------
T ss_pred             cCCCCcCcCCeeEEEEEECCCCCCCCcceEEEecCCc-------cCCCCCeEEEEEEEeCCCeE-EEEEeCC--------
Confidence               00111  13699999988   6   444442210       00011223557899999996 5543311        


Q ss_pred             cCcccceeeccCCCCCCCC-------ceEeE-eece---e---EE-EEEecCCceEE-EeeeecccceeEEEecCCCCCC
Q 004475          272 VSPRDIIYTQPAEPAEGEK-------PEILH-KLDL---R---FS-VSWCDDSLALV-NETWYKTSQTRTWLVCPGSKDV  335 (751)
Q Consensus       272 ~~~~~~l~~~~~~~~~~~~-------~~~l~-~~~~---~---~~-~~~spdg~~l~-~~~~~~~~~~~l~~~~~~~~~~  335 (751)
                      ......|++++++   ++.       ...+. ....   .   .. +.|||||+.|+ +.+. .++..+||++++++  +
T Consensus       281 ~~~~~~i~~~d~~---tg~~~~~~~~~~~l~~~~~~~~v~~~~~~~p~fspDG~~l~~~~s~-~~G~~~l~~~~~~~--~  354 (740)
T 4a5s_A          281 IQNYSVMDICDYD---ESSGRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIISN-EEGYRHICYFQIDK--K  354 (740)
T ss_dssp             STTEEEEEEEEEE---TTTTEEEECGGGCEEEECSSSCSSSSSCCCCEECTTSSEEEEEEEC-TTSCEEEEEEETTC--S
T ss_pred             CCCEEEEEEEECC---CCccccceeEEEEeeeccCCceEccCcCCCceEcCCCCEEEEEEEc-CCCceEEEEEECCC--C
Confidence            1123478999886   333       23332 2111   1   34 89999999998 5543 35568999999998  4


Q ss_pred             cceeeeecccccccCCCCCCCeeeCCCCCEEEEeeeecCCcceEEEEccCCCCCCCCCceeEEEecCCCcee-EEeec-c
Q 004475          336 APRVLFDRVFENVYSDPGSPMMTRTSTGTNVIAKIKKENDEQIYILLNGRGFTPEGNIPFLDLFDINTGSKE-RIWES-N  413 (751)
Q Consensus       336 ~~~~l~~~~~~~~~~~~~~~~~~~spDG~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~d~~~g~~~-~l~~~-~  413 (751)
                      ..++|+.....-.        ..+++||+.|+|.+...              .....+.+||+++++++..+ +|+.. .
T Consensus       355 ~~~~lT~g~~~v~--------~~~~~d~~~i~f~~~~~--------------~~~~~~~~ly~v~~~g~~~~~~lt~~~~  412 (740)
T 4a5s_A          355 DCTFITKGTWEVI--------GIEALTSDYLYYISNEY--------------KGMPGGRNLYKIQLIDYTKVTCLSCELN  412 (740)
T ss_dssp             SCEESCCSSSCEE--------EEEEECSSEEEEEESCG--------------GGCTTCBEEEEEETTEEEEEEESSTTTS
T ss_pred             ceEecccCCEEEE--------EEEEEeCCEEEEEEecC--------------CCCCceeEEEEEECCCCCcceeeccccC
Confidence            6678886643321        22457799999988320              01234679999999876554 44321 0


Q ss_pred             chhhhhceeeeecCCcceeeccCCCEEEEEEecCCCCCeEEEEEcCCCceeEeecCCCC----CCCccCCceEEEEEEcC
Q 004475          414 REKYFETAVALVFGQGEEDINLNQLKILTSKESKTEITQYHILSWPLKKSSQITNFPHP----YPTLASLQKEMIKYQRK  489 (751)
Q Consensus       414 ~~~~~~~~~~~~~~~~~~~~s~dg~~l~~~~~~~~~~~~l~~~~~~~g~~~~lt~~~~~----~~~~~~~~~e~i~~~~~  489 (751)
                      ..         ......++|||||+.++++..++. ++.+++++..+++..+++..+..    .........+.+++ ..
T Consensus       413 ~~---------~~~~~~~~~S~dg~~~~~~~s~~~-~p~~~l~~~~~~~~~~~l~~n~~~~~~~~~~~~~~~~~~~~-~~  481 (740)
T 4a5s_A          413 PE---------RCQYYSVSFSKEAKYYQLRCSGPG-LPLYTLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFI-IL  481 (740)
T ss_dssp             TT---------TBCBEEEEECTTSSEEEEEECSBS-SCEEEEEETTTTEEEEEEECCHHHHHHHTTEECCEEEEEEE-EE
T ss_pred             CC---------CCceEEEEECCCCCEEEEEeCCCC-CCEEEEEECCCCcEEEEeccChhhhhhhhhccCCccEEEEE-cc
Confidence            00         011234689999999999998877 88999999988887777655421    12233334677777 67


Q ss_pred             CCceEEEEEEcCCCCCCCCCCCccEEEEEcCCCCcCcccCCcccCCCCccCCCCchHHHHHH-hCCeEEEEcCCCCCCCC
Q 004475          490 DGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFL-ARRFAVLAGPSIPIIGE  568 (751)
Q Consensus       490 ~~~~i~~~~~~P~~~~~~~~~~~P~vv~~HGg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~G~~v~~~~~~~~~g~  568 (751)
                      +|..+.+++++|+++++.+  ++|+||++||++....           ....+.......++ ++||+|+++++++..+.
T Consensus       482 dg~~l~~~~~~P~~~~~~~--~~P~vv~~HGg~~~~~-----------~~~~~~~~~~~~l~~~~G~~Vv~~D~rG~g~~  548 (740)
T 4a5s_A          482 NETKFWYQMILPPHFDKSK--KYPLLLDVYAGPCSQK-----------ADTVFRLNWATYLASTENIIVASFDGRGSGYQ  548 (740)
T ss_dssp             TTEEEEEEEEECTTCCTTS--CEEEEEECCCCTTCCC-----------CCCCCCCSHHHHHHHTTCCEEEEECCTTCSSS
T ss_pred             CCeEEEEEEEeCCCCCCCC--CccEEEEECCCCcccc-----------cccccCcCHHHHHHhcCCeEEEEEcCCCCCcC
Confidence            8899999999999875443  5999999999863211           01111222345556 59999999666543332


Q ss_pred             CCCCC---CchhHHHHHHHHHHHHHHHHHcCCCCCCcEEEEEeChHHHHHHHHHHhCCCceeEEEEccCCCCCCCCccCc
Q 004475          569 GDKLP---NDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYNKTLTPFGF  645 (751)
Q Consensus       569 g~~~~---~~~~~~~~~~d~~~~v~~l~~~~~id~~~i~l~G~S~GG~~a~~~a~~~p~~~~~~v~~~~~~d~~~~~~~~  645 (751)
                      |....   ...+....++|+.+++++|.+++.+|++||+|+||||||++|+.++.++|++|+++|+.+|+.++......+
T Consensus       549 g~~~~~~~~~~~~~~~~~D~~~~i~~l~~~~~~d~~ri~i~G~S~GG~~a~~~a~~~p~~~~~~v~~~p~~~~~~~~~~~  628 (740)
T 4a5s_A          549 GDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVY  628 (740)
T ss_dssp             CHHHHGGGTTCTTSHHHHHHHHHHHHHHTSTTEEEEEEEEEEETHHHHHHHHHHTTTCSCCSEEEEESCCCCGGGSBHHH
T ss_pred             ChhHHHHHHhhhCcccHHHHHHHHHHHHhcCCcCCccEEEEEECHHHHHHHHHHHhCCCceeEEEEcCCccchHHhhhHH
Confidence            22110   111223458999999999998888999999999999999999999999999999999999998754322111


Q ss_pred             ccc-ccc--chhhHHHHHhcCcccccCCCCC-CEEEEEcCCCCCCCCChHHHHHHHHHHHhCCCcEEEEEeCCCCCcCCc
Q 004475          646 QTE-FRT--LWEATNVYIEMSPITHANKIKK-PILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLVLLPFEHHVYAA  721 (751)
Q Consensus       646 ~~~-~~~--~~~~~~~~~~~~~~~~~~~~~~-P~li~~G~~D~~vp~~~~~~~~~~~~l~~~~~~~~~~~~~~~~H~~~~  721 (751)
                      ... ...  .+...+.|...++...++++++ |+|++||+.|..||  +.++.+++++|.+++++++++++|+++|.+..
T Consensus       629 ~~~~~~~p~~~~~~~~~~~~~~~~~~~~i~~~P~Lii~G~~D~~v~--~~~~~~l~~~l~~~g~~~~~~~~~~~~H~~~~  706 (740)
T 4a5s_A          629 TERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVH--FQQSAQISKALVDVGVDFQAMWYTDEDHGIAS  706 (740)
T ss_dssp             HHHHHCCSSTTTTHHHHHHSCSGGGGGGGGGSEEEEEEETTCSSSC--THHHHHHHHHHHHTTCCCEEEEETTCCTTCCS
T ss_pred             HHHHcCCCCccccHHHHHhCCHHHHHhcCCCCcEEEEEcCCCCccC--HHHHHHHHHHHHHCCCCeEEEEECCCCCcCCC
Confidence            100 112  2456677888899999999986 99999999999999  99999999999999999999999999999866


Q ss_pred             cccHHHHHHHHHHHHHHHhcCC
Q 004475          722 RENVMHVIWETDRWLQKYCLSN  743 (751)
Q Consensus       722 ~~~~~~~~~~~~~fl~~~l~~~  743 (751)
                      .+....+...+.+||.++++..
T Consensus       707 ~~~~~~~~~~i~~fl~~~l~~~  728 (740)
T 4a5s_A          707 STAHQHIYTHMSHFIKQCFSLP  728 (740)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCC
T ss_pred             CccHHHHHHHHHHHHHHHcCCC
Confidence            6777889999999999999753



>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 751
d1vlqa_322 c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Therm 3e-18
d1xfda2258 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-li 8e-17
d2d81a1 318 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymer 5e-16
d2gzsa1265 c.69.1.38 (A:41-305) Enterobactin and salmochelin 8e-15
d2bgra2258 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26 5e-14
d1qfma2280 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-term 3e-13
d3c8da2246 c.69.1.2 (A:151-396) Enterochelin esterase, cataly 5e-12
d1wb4a1273 c.69.1.2 (A:803-1075) Feruloyl esterase domain of 2e-11
d2jbwa1360 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine h 5e-11
d2hu7a2260 c.69.1.33 (A:322-581) Acylamino-acid-releasing enz 8e-11
d1l7aa_318 c.69.1.25 (A:) Cephalosporin C deacetylase {Bacill 9e-11
d1mpxa2381 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrol 2e-10
d2b9va2385 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrol 3e-09
d1lnsa3405 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopep 4e-09
d1pv1a_299 c.69.1.34 (A:) Hypothetical esterase YJL068C {Bake 3e-08
d1jjfa_255 c.69.1.2 (A:) Feruloyl esterase domain of the cell 4e-08
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 8e-07
d1sfra_288 c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculo 9e-07
d1r88a_267 c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tu 9e-06
d1jjia_311 c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl 1e-05
d1uxoa_186 c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus 4e-05
d1vkha_263 c.69.1.32 (A:) Putative serine hydrolase Ydr428c { 2e-04
d1dqza_280 c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculo 3e-04
d1qlwa_318 c.69.1.15 (A:) A novel bacterial esterase {Alcalig 3e-04
d1dina_233 c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas 4e-04
d2hqsa1269 b.68.4.1 (A:163-431) TolB, C-terminal domain {Esch 0.001
d1ju3a2347 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-t 0.001
d1lzla_317 c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [Ta 0.002
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Length = 322 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetyl xylan esterase-like
domain: Acetyl xylan esterase TM0077
species: Thermotoga maritima [TaxId: 2336]
 Score = 84.0 bits (206), Expect = 3e-18
 Identities = 37/290 (12%), Positives = 79/290 (27%), Gaps = 34/290 (11%)

Query: 470 PHPYPTLASLQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFW--------AYPE 521
                 L +++   + +    G  +   L +P      ++  LPC+           +P 
Sbjct: 45  RMESH-LKTVEAYDVTFSGYRGQRIKGWLLVPKL----EEEKLPCVVQYIGYNGGRGFPH 99

Query: 522 DYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVLAGPSIPIIGEGDKLPNDRFVEQL 581
           D+    + G +    +     +              +       +  G   P   +  ++
Sbjct: 100 DWLFWPSMGYICFVMDTRGQGSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYYRRV 159

Query: 582 VSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGSYN---- 637
            + A  AVE        D  RI + G S G  +   + A +              +    
Sbjct: 160 FTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKAKALLCDVPFLCHFRRA 219

Query: 638 KTLTPFGFQTEFR--------TLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLF 689
             L       E                        +  A + K P L   G +D+     
Sbjct: 220 VQLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNIC--P 277

Query: 690 PMQAERFFDALKGHGALSRLVLLPFEHHVYAARENVMHVIWETDRWLQKY 739
           P      ++   G      + + P+ +H        +  +    ++L+K 
Sbjct: 278 PSTVFAAYNYYAGP---KEIRIYPYNNHEGGGSFQAVEQV----KFLKKL 320


>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Length = 318 Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Length = 265 Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 258 Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 280 Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Length = 246 Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Length = 273 Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 360 Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Length = 260 Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Length = 318 Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Length = 381 Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Length = 385 Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Length = 405 Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 299 Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Length = 255 Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Length = 288 Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 267 Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Length = 186 Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 263 Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 280 Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Length = 318 Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Length = 233 Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 269 Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Length = 347 Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Length = 317 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query751
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.96
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.96
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.95
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.92
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.9
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.89
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.89
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.89
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.89
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.88
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.88
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.87
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.87
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.86
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.86
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.84
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 99.84
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.84
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.83
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.83
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.82
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.81
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.81
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.81
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 99.8
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.8
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.8
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 99.79
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.78
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.78
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.78
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 99.77
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 99.77
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 99.77
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 99.76
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 99.76
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.75
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 99.75
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 99.74
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.74
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 99.74
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.72
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 99.7
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 99.7
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 99.7
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 99.7
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 99.7
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.7
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.69
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 99.69
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 99.68
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.68
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.67
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 99.67
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 99.66
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 99.66
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 99.66
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 99.66
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 99.66
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 99.65
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 99.65
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.64
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 99.64
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.63
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 99.62
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 99.62
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 99.61
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.6
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 99.6
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 99.59
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.59
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.58
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.57
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 99.56
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 99.56
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.56
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.54
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.54
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 99.53
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.51
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.5
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.49
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 99.49
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.49
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.48
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.47
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 99.47
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.47
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 99.47
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.46
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.46
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.44
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.44
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.39
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.39
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.38
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 99.38
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.37
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.36
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 99.36
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.33
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.31
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.26
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.26
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.22
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.22
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.21
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.21
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 99.2
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.17
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 99.17
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 99.09
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 99.09
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.06
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 99.03
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 99.01
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.0
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 99.0
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 98.84
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.82
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.82
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.78
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 98.78
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 98.76
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 98.76
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 98.76
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.75
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.68
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.67
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.66
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.63
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.62
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.6
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 98.59
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 98.57
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 98.55
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 98.55
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 98.55
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 98.48
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 98.48
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 98.46
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 98.45
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.44
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 98.41
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 98.41
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.41
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.4
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 98.39
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.39
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.35
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 98.35
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 98.33
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 98.32
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 98.29
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.27
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.26
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 98.26
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 98.2
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.17
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 98.16
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 98.13
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.05
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 97.83
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.78
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 97.72
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.64
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 97.45
g1wht.1 409 Serine carboxypeptidase II {Wheat (Triticum vulgar 97.43
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.19
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 97.13
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 97.02
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 96.98
d1wpxa1 421 Serine carboxypeptidase II {Baker's yeast (Sacchar 96.92
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 96.79
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.51
g1gxs.1 425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 96.48
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 96.41
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 95.87
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 95.8
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.71
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 94.98
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 93.76
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 93.69
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 93.01
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 92.38
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 92.28
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 92.27
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 91.88
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 91.84
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 86.61
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 86.29
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 85.73
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 84.82
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acylamino-acid-releasing enzyme, C-terminal donain
domain: Acylamino-acid-releasing enzyme, C-terminal donain
species: Aeropyrum pernix [TaxId: 56636]
Probab=99.96  E-value=1.1e-28  Score=243.53  Aligned_cols=242  Identities=18%  Similarity=0.187  Sum_probs=190.9

Q ss_pred             CceEEEEEEcCCCceEEEEEEcCCCCCCCCCCCccEEEEEcCCCCcCcccCCcccCCCCccCCCCchHHHHHHhCCeEEE
Q 004475          479 LQKEMIKYQRKDGVPLTATLYLPPGYDQSKDGPLPCLFWAYPEDYKSKDAAGQVRGSPNEFSGMTPTSSLIFLARRFAVL  558 (751)
Q Consensus       479 ~~~e~i~~~~~~~~~i~~~~~~P~~~~~~~~~~~P~vv~~HGg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~~v~  558 (751)
                      ...+.+.|++.+|.+|+++++.|++.    +++.|+||++|||++....         ..+    ......|+++||+|+
T Consensus        10 ~~~~~v~~~s~dG~~i~~~l~~p~~~----~~~~Pviv~~HGG~~~~~~---------~~~----~~~~~~la~~G~~v~   72 (260)
T d2hu7a2          10 AGSRLVWVESFDGSRVPTYVLESGRA----PTPGPTVVLVHGGPFAEDS---------DSW----DTFAASLAAAGFHVV   72 (260)
T ss_dssp             EEEEEEEEECTTSCEEEEEEEEETTS----CSSEEEEEEECSSSSCCCC---------SSC----CHHHHHHHHHTCEEE
T ss_pred             CceEEEEEECCCCCEEEEEEEeCCCC----CCCceEEEEECCCCccCCC---------ccc----cHHHHHHHhhccccc
Confidence            46788999999999999999999762    3468999999997643211         111    245678899999999


Q ss_pred             EcCCCCCCCCCCCCC---CchhHHHHHHHHHHHHHHHHHcCCCCCCcEEEEEeChHHHHHHHHHHhCCCceeEEEEccCC
Q 004475          559 AGPSIPIIGEGDKLP---NDRFVEQLVSSAEAAVEEVVRRGVADPSRIAVGGHSYGAFMTAHLLAHAPHLFCCGIARSGS  635 (751)
Q Consensus       559 ~~~~~~~~g~g~~~~---~~~~~~~~~~d~~~~v~~l~~~~~id~~~i~l~G~S~GG~~a~~~a~~~p~~~~~~v~~~~~  635 (751)
                      +++++...++|....   ...+....++|+..+++++.++.  +..+++++|+|+||.+++.++..+|+.++++++.+|.
T Consensus        73 ~~d~r~~~~~g~~~~~~~~~~~~~~~~~D~~~~~~~l~~~~--~~~~~~i~g~s~gg~~~~~~~~~~~~~~~a~i~~~~~  150 (260)
T d2hu7a2          73 MPNYRGSTGYGEEWRLKIIGDPCGGELEDVSAAARWARESG--LASELYIMGYSYGGYMTLCALTMKPGLFKAGVAGASV  150 (260)
T ss_dssp             EECCTTCSSSCHHHHHTTTTCTTTHHHHHHHHHHHHHHHTT--CEEEEEEEEETHHHHHHHHHHHHSTTSSSEEEEESCC
T ss_pred             cceeeeccccccccccccccccchhhhhhhccccccccccc--ccceeeccccccccccccchhccCCcccccccccccc
Confidence            977765555544311   11223456789999999999875  5679999999999999999999999999999999998


Q ss_pred             CCCCCCccCcc-----cccccchhhHHHHHhcCcccccCCCCCCEEEEEcCCCCCCCCChHHHHHHHHHHHhCCCcEEEE
Q 004475          636 YNKTLTPFGFQ-----TEFRTLWEATNVYIEMSPITHANKIKKPILIIHGEVDDKVGLFPMQAERFFDALKGHGALSRLV  710 (751)
Q Consensus       636 ~d~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~P~li~~G~~D~~vp~~~~~~~~~~~~l~~~~~~~~~~  710 (751)
                      .+.........     ......+...+.+...++..+++++++|+|++||+.|.+||  +.++.+++++|++++++++++
T Consensus       151 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~liihG~~D~~vp--~~~~~~~~~~l~~~~~~~~~~  228 (260)
T d2hu7a2         151 VDWEEMYELSDAAFRNFIEQLTGGSREIMRSRSPINHVDRIKEPLALIHPQNDSRTP--LKPLLRLMGELLARGKTFEAH  228 (260)
T ss_dssp             CCHHHHHHTCCHHHHHHHHHHHCSCHHHHHHTCGGGCGGGCCSCEEEEEETTCSSSC--SHHHHHHHHHHHHTTCCEEEE
T ss_pred             hhhhhhhcccccccccccccccccccccccccchhhcccccCCCceeeecccCceec--HHHHHHHHHHHHHCCCCeEEE
Confidence            66321100000     00111224466788889999999999999999999999999  999999999999999999999


Q ss_pred             EeCCCCCcCCccccHHHHHHHHHHHHHHHhc
Q 004475          711 LLPFEHHVYAARENVMHVIWETDRWLQKYCL  741 (751)
Q Consensus       711 ~~~~~~H~~~~~~~~~~~~~~~~~fl~~~l~  741 (751)
                      +||+++|.+...++..+++..+++||.++++
T Consensus       229 ~~~g~~H~~~~~e~~~~~~~~~~~fl~~hl~  259 (260)
T d2hu7a2         229 IIPDAGHAINTMEDAVKILLPAVFFLATQRE  259 (260)
T ss_dssp             EETTCCSSCCBHHHHHHHHHHHHHHHHHHHH
T ss_pred             EECcCCCCCCChHhHHHHHHHHHHHHHHHhc
Confidence            9999999998778888899999999999986



>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure