Citrus Sinensis ID: 004584

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740----
MTSRFGSQSSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVFEDAYKSPLSIIILDDIERLLEYVPIGPRFSNIISQTMLVLLKRLPPKGKKLLVIGTTSEVSFLDSVGICDAFSVTYHVPTLKTDDAKKVLKQLNVFAEEDVDSASEALNDMPIKKLYMLIEMAAQGEQGGAAEAIYSGREKIKISHFYDCLQDMVRY
cccccccccccccEEEEEcccccccccccEEEEcHHHHHHcccccccEEEEEEEccEEEEEEEcccccccccEEEcHHHHHccccccccEEEEEEEcccccccEEEEEccHHHHHcccccccccHHHHHHHHHHHHcccccccccEEEEEEcccEEEEEEEEEEEcccccccccccEEEccccEEEEEEccccccEEEccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHcccccEEEcccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEccccccccccccccccccEEEEEccccHHHHHHHHHHHHccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccccEEcHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccHHHHHHHHHHHcccccccccEEEEEEccccccccccccccccccEEEcccccHHHHHHHHHHcccccHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHcccccccHHHHHHHHHHHccc
ccccccccccccEEEEEEcccccccccEEEEEEcHHHHHHccccccEEEEEcccccEEEEEEcccccccccEEEEcHEHHHccccccccEEEEEEccccccccEEEEEccHHHcccccccccccHHHHHHHHHHHHccccEEEccEEEEEccccEEEEEEccEcEEEEEEcccccEEEEccccEEEEEcccccHHHHHccccccHccEEEEEcccccHcccccHHHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHcccHHHHHHHHHHHHHccccccccccccEEEEcHHHHHccccccccccccHHHHHHHHHHHHHcHHHccccEEEEEEccccccccHHHcccccccEEEEEccccHHHHHHHHHHHHccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHcccccHHHHHHccccHHHHHHHHHHcccccccEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHHHcccEEEEEcHHHcccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHcccEccccEccHHHHHHHHHHcccccccccEEEEEEEEccHHHHHHccHHHcccEEEEcccEEEHHHHHHHHHccccccccHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHcccccccHHHHHHHHHHHHcc
mtsrfgsqssgvttmnvintpsadlaltnlaycspadllnfrvpnsnlflASVAGDSFVLSlashpsvnkgqiALNSVQRRhakvstgdhvslnrfippedfNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFeyhgnnyiftvngaavegqeksNALERGIITNETYFVFEAsndsgikivnqregansnifrhkefnlqslgigglsaEFADIFRRAFasrvfpphvtsklgikhvkgmllygppgtgktLMARQIGKMlngmepkivngpevlsKFVGETEKNIRDLFAdaendqrtrgdqsdlHVIIFDEIDAICksrgstrdgtgvHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLdeallrpgrleVQVEislpdengrLQILQIHTNkmkensflapdvNLQELAARTknysgaeleGVAKSAVSFALNRqlsmddltkpvdeesIKVTMDDFLHALYEIVpafgastddlERSRlngmvdcgdRHKHIYQRAMLLVEQVKvskgsplvtcllegpsgsgktalaatagidsdfpfvKIISAEsmiglhestkCAQIVKVFEDAYKSPLSIIILDDIERLleyvpigprfsnIISQTMLVLLkrlppkgkkllvigttsevsfldsvgicdafsvtyhvptlktddAKKVLKQLNVFAEEDVDSASealndmpikKLYMLIEMAAQGEQGGAAEAIYSGREKIKISHFYDCLQDMVRY
mtsrfgsqssgvtTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFAsrvfpphvtsklgikhvkgMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFadaendqrtrgdqsdlhvIIFDEIDAICKSrgstrdgtgvHDSIVNQLltkidgveSLNNVLLIGMTNRKDMLDEALLRPGRLEVQVeislpdengRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVFEDAYKSPLSIIILDDIERLLEYVPIGPRFSNIISQTMLVLLKRLPPKGKKLLVIGTTSEVSFLDSVGICDAFSVTYHVPTLKTDDAKKVLKQLNVFaeedvdsasealNDMPIKKLYMLIEMAAQGEQGGAAEAIYSGREKIKISHFYDCLQDMVRY
MTSRFGSQSSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVFEDAYKSPlsiiilddierlleYVPIGPRFSNIISQTMlvllkrlppkgkkllvIGTTSEVSFLDSVGICDAFSVTYHVPTLKTDDAKKVLKQLNVFAEEDVDSASEALNDMPIKKLYMLIEMaaqgeqggaaeaIYSGREKIKISHFYDCLQDMVRY
**************MNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLF**************DLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQL***********ESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVFEDAYKSPLSIIILDDIERLLEYVPIGPRFSNIISQTMLVLLKRLPPKGKKLLVIGTTSEVSFLDSVGICDAFSVTYHVPTLKTDDAKKVLKQLNVFAEEDV*****ALNDMPIKKLYMLIEMAAQGEQGGAAEAIYSGREKIKISHFYDCLQD****
******************NTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKG****QVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEAS*************************LQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAI****************IVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNR************EESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVFEDAYKSPLSIIILDDIERLLEYVPIGPRFSNIISQTMLVLLKRLPPKGKKLLVIGTTSEVSFLDSVGICDAFSVTYHVPTLKTDDAKKVLKQLNVFAEEDVDSASEALNDMPIKKLYMLIEMAAQGE********YSGREKIKISHFYDCLQDMVRY
***********VTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNS**********GDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVFEDAYKSPLSIIILDDIERLLEYVPIGPRFSNIISQTMLVLLKRLPPKGKKLLVIGTTSEVSFLDSVGICDAFSVTYHVPTLKTDDAKKVLKQLNVFAEEDVDSASEALNDMPIKKLYMLIEMAAQGEQGGAAEAIYSGREKIKISHFYDCLQDMVRY
**********GVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKI*N*REGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKS*******TGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVFEDAYKSPLSIIILDDIERLLEYVPIGPRFSNIISQTMLVLLKRLPPKGKKLLVIGTTSEVSFLDSVGICDAFSVTYHVPTLKTDDAKKVLKQLNVFAEEDVDSASEALNDMPIKKLYMLIEMAAQGEQGGAAEAIYSGREKIKISHFYDCLQDMVRY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSRFGSQSSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIITNETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVFEDAYKSPLSIIILDDIERLLEYVPIGPRFSNIISQTMLVLLKRLPPKGKKLLVIGTTSEVSFLDSVGICDAFSVTYHVPTLKTDDAKKVLKQLNVFAEEDVDSASEALNDMPIKKLYMLIEMAAQGEQGGAAEAIYSGREKIKISHFYDCLQDMVRY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query744 2.2.26 [Sep-21-2011]
Q9M0Y8742 Vesicle-fusing ATPase OS= yes no 0.994 0.997 0.809 0.0
P46459744 Vesicle-fusing ATPase OS= yes no 0.928 0.928 0.463 1e-174
Q5R410744 Vesicle-fusing ATPase OS= yes no 0.928 0.928 0.463 1e-174
P18708744 Vesicle-fusing ATPase OS= yes no 0.926 0.926 0.460 1e-174
P46460744 Vesicle-fusing ATPase OS= yes no 0.926 0.926 0.462 1e-173
Q9QUL6744 Vesicle-fusing ATPase OS= yes no 0.926 0.926 0.460 1e-173
Q75JI3738 Vesicle-fusing ATPase OS= yes no 0.938 0.945 0.457 1e-172
Q9P7Q4792 Vesicular-fusion protein yes no 0.920 0.864 0.443 1e-170
P46461745 Vesicle-fusing ATPase 1 O yes no 0.942 0.940 0.439 1e-164
P54351752 Vesicle-fusing ATPase 2 O no no 0.926 0.916 0.451 1e-162
>sp|Q9M0Y8|NSF_ARATH Vesicle-fusing ATPase OS=Arabidopsis thaliana GN=NSF PE=2 SV=2 Back     alignment and function desciption
 Score = 1264 bits (3272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/744 (80%), Positives = 676/744 (90%), Gaps = 4/744 (0%)

Query: 1   MTSRFGSQSSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVL 60
           M  R+GSQ   V TM V NTPSADLA TNLAYCS +DL  F VP S+LFLA+VA DSF+L
Sbjct: 1   MAGRYGSQ---VMTMTVTNTPSADLAFTNLAYCSSSDLRQFSVPGSDLFLANVA-DSFIL 56

Query: 61  SLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKN 120
           SL  H S+  G IALN++QRRHA+VSTGD VS++RF+PPE+F+LA+LT+ELEFVKKG+K+
Sbjct: 57  SLCGHGSIRDGNIALNAIQRRHARVSTGDMVSVSRFVPPENFDLAMLTLELEFVKKGTKS 116

Query: 121 EQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIIT 180
           EQVDA LL+ QL++++ NQV+T GQ+  FEYHG NYI TVN A VEGQ+ +N +ERG+++
Sbjct: 117 EQVDAALLSTQLKRKYTNQVLTVGQKATFEYHGTNYILTVNRADVEGQDHTNGIERGLLS 176

Query: 181 NETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRV 240
            +TY VFEASN SGIKIVNQRE A+SNIF+HKEFNL+SLGIGGL AEFADIFRRAFASRV
Sbjct: 177 KDTYIVFEASNASGIKIVNQREAASSNIFKHKEFNLESLGIGGLGAEFADIFRRAFASRV 236

Query: 241 FPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETE 300
           FPPHVTS+LGIKHVKGMLL+GPPGTGKTLMARQIGKMLNG +PKIVNGPEVLSKFVGETE
Sbjct: 237 FPPHVTSRLGIKHVKGMLLFGPPGTGKTLMARQIGKMLNGKDPKIVNGPEVLSKFVGETE 296

Query: 301 KNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID 360
           KN+RDLFADAE DQRT GD S+LHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID
Sbjct: 297 KNVRDLFADAEQDQRTLGDASELHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID 356

Query: 361 GVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSF 420
           GVE+LNNVLLIGMTNRKD+LDEALLRPGRLEVQVEISLPDE GRLQILQIHTNKMKENSF
Sbjct: 357 GVEALNNVLLIGMTNRKDLLDEALLRPGRLEVQVEISLPDEAGRLQILQIHTNKMKENSF 416

Query: 421 LAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFL 480
           L  D+NLQELAARTKNYSGAELEGV KSA S+ALNRQLSMDDLTKPV+EE+IK+TM+DFL
Sbjct: 417 LGTDINLQELAARTKNYSGAELEGVVKSATSYALNRQLSMDDLTKPVEEENIKITMEDFL 476

Query: 481 HALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLE 540
           HA+YE+ PAFGASTDDLER RLNGMVDCG RH HIY+RAMLLVEQVKVS  SPLVTCLLE
Sbjct: 477 HAIYEVQPAFGASTDDLERCRLNGMVDCGHRHNHIYKRAMLLVEQVKVSTRSPLVTCLLE 536

Query: 541 GPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVFEDAYKSPLSIIIL 600
           GPSGSGKTALAAT GIDSDFP+VKI+SAE+MIGL ESTKCA IVKVFEDAYKSP+SIIIL
Sbjct: 537 GPSGSGKTALAATIGIDSDFPYVKIVSAETMIGLSESTKCAHIVKVFEDAYKSPMSIIIL 596

Query: 601 DDIERLLEYVPIGPRFSNIISQTMLVLLKRLPPKGKKLLVIGTTSEVSFLDSVGICDAFS 660
           DDIERLLE++ IGPRFSNIISQT++VLLKRLPPKGKKLLV GTTSEV+FL+SVGI D FS
Sbjct: 597 DDIERLLEFIAIGPRFSNIISQTLMVLLKRLPPKGKKLLVFGTTSEVTFLESVGISDCFS 656

Query: 661 VTYHVPTLKTDDAKKVLKQLNVFAEEDVDSASEALNDMPIKKLYMLIEMAAQGEQGGAAE 720
           VT+ VPTL+ +DAKKVL QLN+F+E+DVDSA+EALNDMPIKK+YMLIEMAAQGE GG+AE
Sbjct: 657 VTHSVPTLQKEDAKKVLNQLNLFSEDDVDSAAEALNDMPIKKIYMLIEMAAQGENGGSAE 716

Query: 721 AIYSGREKIKISHFYDCLQDMVRY 744
           AIY+GREKI I+HFYDCL D +R+
Sbjct: 717 AIYAGREKININHFYDCLGDFIRF 740
Involved in vesicle-mediated transport. The ATPase activity of NSF serves to disassemble the SNARE complex, freeing the components for subsequent pairing and fusion events.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 6
>sp|P46459|NSF_HUMAN Vesicle-fusing ATPase OS=Homo sapiens GN=NSF PE=1 SV=3 Back     alignment and function description
>sp|Q5R410|NSF_PONAB Vesicle-fusing ATPase OS=Pongo abelii GN=NSF PE=2 SV=1 Back     alignment and function description
>sp|P18708|NSF_CRIGR Vesicle-fusing ATPase OS=Cricetulus griseus GN=NSF PE=1 SV=1 Back     alignment and function description
>sp|P46460|NSF_MOUSE Vesicle-fusing ATPase OS=Mus musculus GN=Nsf PE=1 SV=2 Back     alignment and function description
>sp|Q9QUL6|NSF_RAT Vesicle-fusing ATPase OS=Rattus norvegicus GN=Nsf PE=1 SV=1 Back     alignment and function description
>sp|Q75JI3|NSF_DICDI Vesicle-fusing ATPase OS=Dictyostelium discoideum GN=nsfA PE=1 SV=1 Back     alignment and function description
>sp|Q9P7Q4|SEC18_SCHPO Vesicular-fusion protein sec18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec18 PE=1 SV=1 Back     alignment and function description
>sp|P46461|NSF1_DROME Vesicle-fusing ATPase 1 OS=Drosophila melanogaster GN=comt PE=2 SV=1 Back     alignment and function description
>sp|P54351|NSF2_DROME Vesicle-fusing ATPase 2 OS=Drosophila melanogaster GN=Nsf2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query744
224079215738 predicted protein [Populus trichocarpa] 0.991 1.0 0.881 0.0
224125340750 predicted protein [Populus trichocarpa] 0.994 0.986 0.866 0.0
449443540743 PREDICTED: vesicle-fusing ATPase-like [C 0.998 1.0 0.848 0.0
356521353746 PREDICTED: vesicle-fusing ATPase-like [G 0.997 0.994 0.849 0.0
225461445739 PREDICTED: vesicle-fusing ATPase-like [V 0.993 1.0 0.852 0.0
356546235742 PREDICTED: vesicle-fusing ATPase-like [G 0.978 0.981 0.850 0.0
302143010739 unnamed protein product [Vitis vinifera] 0.993 1.0 0.848 0.0
1449179739 N-ethylmaleimide sensitive fusion protei 0.993 1.0 0.831 0.0
147828765754 hypothetical protein VITISV_011590 [Viti 0.993 0.980 0.832 0.0
30679915742 vesicle-fusing ATPase [Arabidopsis thali 0.994 0.997 0.809 0.0
>gi|224079215|ref|XP_002305796.1| predicted protein [Populus trichocarpa] gi|222848760|gb|EEE86307.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1358 bits (3515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/744 (88%), Positives = 700/744 (94%), Gaps = 6/744 (0%)

Query: 1   MTSRFGSQSSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVL 60
           M SRFG QS   TTM V NTP+ADLALTNLAYCSP+DL NF VP + LFLA VA  S   
Sbjct: 1   MASRFGFQS---TTMIVTNTPAADLALTNLAYCSPSDLHNFAVPGTKLFLALVADSS--- 54

Query: 61  SLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKN 120
           ++  H ++  GQIALN++QRRHAKVS+GD VS++RFIPPEDFNLALLT+ELEFVKKG++N
Sbjct: 55  AITPHENIRTGQIALNAIQRRHAKVSSGDTVSVSRFIPPEDFNLALLTLELEFVKKGTRN 114

Query: 121 EQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIIT 180
           EQ+DAV+LANQLRKRF NQVMT+GQR  FEYHGNNYIFTV  A VEG+E SN +ERG+I+
Sbjct: 115 EQIDAVILANQLRKRFANQVMTSGQRATFEYHGNNYIFTVTQATVEGREDSNDVERGMIS 174

Query: 181 NETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRV 240
           ++TY VFEASN SGIKIVNQRE A+SNIFRHKEFNLQSLGIGGL AEFADIFRRAFASRV
Sbjct: 175 SDTYIVFEASNSSGIKIVNQREAASSNIFRHKEFNLQSLGIGGLGAEFADIFRRAFASRV 234

Query: 241 FPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETE 300
           FPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNG EPKIVNGPEVLSKFVGETE
Sbjct: 235 FPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGREPKIVNGPEVLSKFVGETE 294

Query: 301 KNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID 360
           KN+RDLFADAENDQRT GDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID
Sbjct: 295 KNVRDLFADAENDQRTNGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID 354

Query: 361 GVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSF 420
           GVESLNNVLLIGMTNRKD+LDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSF
Sbjct: 355 GVESLNNVLLIGMTNRKDLLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSF 414

Query: 421 LAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFL 480
           LAPDVNLQELAARTKNYSGAELEGV KSAVSFALNRQLS+DDLTKPVDEESIKVTMDDFL
Sbjct: 415 LAPDVNLQELAARTKNYSGAELEGVVKSAVSFALNRQLSLDDLTKPVDEESIKVTMDDFL 474

Query: 481 HALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLE 540
           HAL+EIVPAFGASTDDLER RLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSP+VTCLLE
Sbjct: 475 HALHEIVPAFGASTDDLERCRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPMVTCLLE 534

Query: 541 GPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVFEDAYKSPLSIIIL 600
           GPSGSGKTALAAT GIDSDFP+VKIISAE+MIGLHESTKCAQIVKVFEDAYKSPLSIIIL
Sbjct: 535 GPSGSGKTALAATVGIDSDFPYVKIISAETMIGLHESTKCAQIVKVFEDAYKSPLSIIIL 594

Query: 601 DDIERLLEYVPIGPRFSNIISQTMLVLLKRLPPKGKKLLVIGTTSEVSFLDSVGICDAFS 660
           DDIERLLEYV IGPRFSNIISQT++VLLKRLPPKGKKLLV+GTTSEVSFLDSVGICDAFS
Sbjct: 595 DDIERLLEYVAIGPRFSNIISQTLMVLLKRLPPKGKKLLVLGTTSEVSFLDSVGICDAFS 654

Query: 661 VTYHVPTLKTDDAKKVLKQLNVFAEEDVDSASEALNDMPIKKLYMLIEMAAQGEQGGAAE 720
           VTYH+PTLK DDAKKVL+QLNVFAE+DV +A+EALNDM IKKLYMLIEMAAQGEQGGAAE
Sbjct: 655 VTYHLPTLKADDAKKVLEQLNVFAEDDVSAAAEALNDMTIKKLYMLIEMAAQGEQGGAAE 714

Query: 721 AIYSGREKIKISHFYDCLQDMVRY 744
           AIYSG+EKIKI+HFYDCLQD+VR+
Sbjct: 715 AIYSGKEKIKIAHFYDCLQDIVRF 738

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224125340|ref|XP_002329781.1| predicted protein [Populus trichocarpa] gi|222870843|gb|EEF07974.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449443540|ref|XP_004139535.1| PREDICTED: vesicle-fusing ATPase-like [Cucumis sativus] gi|449513613|ref|XP_004164372.1| PREDICTED: vesicle-fusing ATPase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356521353|ref|XP_003529321.1| PREDICTED: vesicle-fusing ATPase-like [Glycine max] Back     alignment and taxonomy information
>gi|225461445|ref|XP_002284987.1| PREDICTED: vesicle-fusing ATPase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356546235|ref|XP_003541535.1| PREDICTED: vesicle-fusing ATPase-like [Glycine max] Back     alignment and taxonomy information
>gi|302143010|emb|CBI20305.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|1449179|dbj|BAA13101.1| N-ethylmaleimide sensitive fusion protein [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|147828765|emb|CAN70797.1| hypothetical protein VITISV_011590 [Vitis vinifera] Back     alignment and taxonomy information
>gi|30679915|ref|NP_192400.2| vesicle-fusing ATPase [Arabidopsis thaliana] gi|28201831|sp|Q9M0Y8.2|NSF_ARATH RecName: Full=Vesicle-fusing ATPase; AltName: Full=N-ethylmaleimide-sensitive fusion protein; AltName: Full=Vesicular-fusion protein NSF gi|20856713|gb|AAM26681.1| AT4g04910/T1J1_4 [Arabidopsis thaliana] gi|332657040|gb|AEE82440.1| vesicle-fusing ATPase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query744
TAIR|locus:2135378742 NSF "N-ethylmaleimide sensitiv 0.994 0.997 0.758 1.6e-301
UNIPROTKB|F1P6Z3745 NSF "Uncharacterized protein" 0.928 0.927 0.442 2.3e-149
UNIPROTKB|E2RFV4811 NSF "Uncharacterized protein" 0.927 0.850 0.442 3e-149
UNIPROTKB|F1MZU2746 NSF "Uncharacterized protein" 0.927 0.924 0.438 4.3e-148
UNIPROTKB|E1BQU4745 NSF "Uncharacterized protein" 0.924 0.923 0.434 7.1e-148
UNIPROTKB|E1C646744 NSF "Uncharacterized protein" 0.924 0.924 0.434 7.1e-148
UNIPROTKB|E1C649747 NSF "Uncharacterized protein" 0.924 0.921 0.434 7.1e-148
UNIPROTKB|F1LQ81744 Nsf "Vesicle-fusing ATPase" [R 0.931 0.931 0.435 1.2e-147
UNIPROTKB|P46459744 NSF "Vesicle-fusing ATPase" [H 0.927 0.927 0.437 1.9e-147
UNIPROTKB|I3L0N3739 NSF "Vesicle-fusing ATPase" [H 0.926 0.932 0.437 2.4e-147
TAIR|locus:2135378 NSF "N-ethylmaleimide sensitive factor" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2894 (1023.8 bits), Expect = 1.6e-301, P = 1.6e-301
 Identities = 564/744 (75%), Positives = 635/744 (85%)

Query:     1 MTSRFGSQSSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVL 60
             M  R+GSQ   V TM V NTPSADLA TNLAYCS +DL  F VP S+LFLA+VA DSF+L
Sbjct:     1 MAGRYGSQ---VMTMTVTNTPSADLAFTNLAYCSSSDLRQFSVPGSDLFLANVA-DSFIL 56

Query:    61 SLASHPSVNKGQIALNSVQRRHAKVSTGDHVSLNRFIPPEDFNLALLTVELEFVKKGSKN 120
             SL  H S+  G IALN++QRRHA+VSTGD VS++RF+PPE+F+LA+LT+ELEFVKKG+K+
Sbjct:    57 SLCGHGSIRDGNIALNAIQRRHARVSTGDMVSVSRFVPPENFDLAMLTLELEFVKKGTKS 116

Query:   121 EQVDAVLLANQLRKRFINQVMTAGQRVVFEYHGNNYIFTVNGAAVEGQEKSNALERGIIT 180
             EQVDA LL+ QL++++ NQV+T GQ+  FEYHG NYI TVN A VEGQ+ +N +ERG+++
Sbjct:   117 EQVDAALLSTQLKRKYTNQVLTVGQKATFEYHGTNYILTVNRADVEGQDHTNGIERGLLS 176

Query:   181 NETYFVFEASNDSGIKIVNQREGANSNIFRHKEFNLQSLGIGGLSAEFADIFRRAFASRV 240
              +TY VFEASN SGIKIVNQRE A+SNIF+HKEFNL+SLGIGGL AEFADIFRRAFASRV
Sbjct:   177 KDTYIVFEASNASGIKIVNQREAASSNIFKHKEFNLESLGIGGLGAEFADIFRRAFASRV 236

Query:   241 FPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETE 300
             FPPHVTS+LGIKHVKGMLL+GPPGTGKTLMARQIGKMLNG +PKIVNGPEVLSKFVGETE
Sbjct:   237 FPPHVTSRLGIKHVKGMLLFGPPGTGKTLMARQIGKMLNGKDPKIVNGPEVLSKFVGETE 296

Query:   301 KNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID 360
             KN+RDLFADAE DQRT GD S+LHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID
Sbjct:   297 KNVRDLFADAEQDQRTLGDASELHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKID 356

Query:   361 GVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSF 420
             GVE+LNNVLLIGMTNRKD+LDEALLRPGRLEVQVEISLPDE GRLQILQIHTNKMKENSF
Sbjct:   357 GVEALNNVLLIGMTNRKDLLDEALLRPGRLEVQVEISLPDEAGRLQILQIHTNKMKENSF 416

Query:   421 LAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFL 480
             L  D+NLQELAARTKNYSGAELEGV KSA S+ALNRQLSMDDLTKPV+EE+IK+TM+DFL
Sbjct:   417 LGTDINLQELAARTKNYSGAELEGVVKSATSYALNRQLSMDDLTKPVEEENIKITMEDFL 476

Query:   481 HALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLE 540
             HA+YE+ PAFGASTDDLER RLNGMVDCG RH HIY+RAMLLVEQVKVS  SPLVTCLLE
Sbjct:   477 HAIYEVQPAFGASTDDLERCRLNGMVDCGHRHNHIYKRAMLLVEQVKVSTRSPLVTCLLE 536

Query:   541 GPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVFEDAYKSPXXXXXX 600
             GPSGSGKTALAAT GIDSDFP+VKI+SAE+MIGL ESTKCA IVKVFEDAYKSP      
Sbjct:   537 GPSGSGKTALAATIGIDSDFPYVKIVSAETMIGLSESTKCAHIVKVFEDAYKSPMSIIIL 596

Query:   601 XXXXXXXXYVPIGPRFSNIISQTMXXXXXXXXXXXXXXXXIGTTSEVSFLDSVGICDAFS 660
                     ++ IGPRFSNIISQT+                 GTTSEV+FL+SVGI D FS
Sbjct:   597 DDIERLLEFIAIGPRFSNIISQTLMVLLKRLPPKGKKLLVFGTTSEVTFLESVGISDCFS 656

Query:   661 VTYHVPTLKTDDAKKVLKQLNVFAEEDVDSASEALNDMPIKKLYMLIEMXXXXXXXXXXX 720
             VT+ VPTL+ +DAKKVL QLN+F+E+DVDSA+EALNDMPIKK+YMLIEM           
Sbjct:   657 VTHSVPTLQKEDAKKVLNQLNLFSEDDVDSAAEALNDMPIKKIYMLIEMAAQGENGGSAE 716

Query:   721 XIYSGREKIKISHFYDCLQDMVRY 744
              IY+GREKI I+HFYDCL D +R+
Sbjct:   717 AIYAGREKININHFYDCLGDFIRF 740
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM;IDA
GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA
GO:0005773 "vacuole" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
UNIPROTKB|F1P6Z3 NSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFV4 NSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MZU2 NSF "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQU4 NSF "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C646 NSF "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C649 NSF "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQ81 Nsf "Vesicle-fusing ATPase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P46459 NSF "Vesicle-fusing ATPase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L0N3 NSF "Vesicle-fusing ATPase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q75JI3NSF_DICDI3, ., 6, ., 4, ., 60.45740.93810.9457yesno
P18708NSF_CRIGR3, ., 6, ., 4, ., 60.46060.92600.9260yesno
P46460NSF_MOUSE3, ., 6, ., 4, ., 60.46200.92600.9260yesno
P46461NSF1_DROME3, ., 6, ., 4, ., 60.43950.94220.9409yesno
Q9P7Q4SEC18_SCHPONo assigned EC number0.44320.92060.8648yesno
Q5R410NSF_PONAB3, ., 6, ., 4, ., 60.46330.92870.9287yesno
Q9M0Y8NSF_ARATH3, ., 6, ., 4, ., 60.80910.99460.9973yesno
P18759SEC18_YEASTNo assigned EC number0.44930.86550.8496yesno
P46459NSF_HUMAN3, ., 6, ., 4, ., 60.46330.92870.9287yesno
Q9QUL6NSF_RAT3, ., 6, ., 4, ., 60.46060.92600.9260yesno
Q94392NSF_CAEEL3, ., 6, ., 4, ., 60.40560.94480.8531yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.998
3rd Layer3.6.4.60.994

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query744
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-66
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 1e-60
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 4e-59
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 8e-58
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 2e-57
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 5e-56
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 9e-53
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 6e-45
pfam00004131 pfam00004, AAA, ATPase family associated with vari 2e-41
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 2e-41
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 2e-39
CHL00176638 CHL00176, ftsH, cell division protein; Validated 3e-38
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 1e-36
PRK10733644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 2e-33
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 2e-33
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 4e-30
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 4e-20
smart00382148 smart00382, AAA, ATPases associated with a variety 6e-12
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 5e-11
pfam00004131 pfam00004, AAA, ATPase family associated with vari 7e-11
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 1e-09
smart00382148 smart00382, AAA, ATPases associated with a variety 5e-08
smart0107382 smart01073, CDC48_N, Cell division protein 48 (CDC 5e-07
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 6e-07
pfam0293361 pfam02933, CDC48_2, Cell division protein 48 (CDC4 5e-05
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 5e-05
PRK13342413 PRK13342, PRK13342, recombination factor protein R 1e-04
pfam13401124 pfam13401, AAA_22, AAA domain 2e-04
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 4e-04
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 0.001
pfam0235984 pfam02359, CDC48_N, Cell division protein 48 (CDC4 0.001
PRK05342412 PRK05342, clpX, ATP-dependent protease ATP-binding 0.001
COG1474366 COG1474, CDC6, Cdc6-related protein, AAA superfami 0.001
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 0.002
smart0107264 smart01072, CDC48_2, Cell division protein 48 (CDC 0.002
COG1219408 COG1219, ClpX, ATP-dependent protease Clp, ATPase 0.003
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding reg 0.003
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score =  228 bits (583), Expect = 1e-66
 Identities = 151/414 (36%), Positives = 215/414 (51%), Gaps = 31/414 (7%)

Query: 243 PHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKN 302
           P +  KLGI+  KG+LL+GPPGTGKTL+AR +     G E   +NGPE+LSK+VGE+E  
Sbjct: 7   PELFKKLGIEPPKGVLLHGPPGTGKTLLARAL--ANEGAEFLSINGPEILSKYVGESELR 64

Query: 303 IRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGV 362
           +R+LF +AE             +I  DEIDA+   R S +    V   +V QLL  +DG+
Sbjct: 65  LRELFEEAEKLAP--------SIIFIDEIDALAPKRSSDQGE--VERRVVAQLLALMDGL 114

Query: 363 ESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLA 422
           +    V++IG TNR D LD A  RPGR + ++E++LPDE GRL+ILQIHT  M    FL 
Sbjct: 115 KRGQ-VIVIGATNRPDGLDPAKRRPGRFDREIEVNLPDEAGRLEILQIHTRLM----FLG 169

Query: 423 PDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLHA 482
           P    + LAART   SGA+L  +AK A    L R + +         E I VT DDF  A
Sbjct: 170 PPGTGKTLAARTVGKSGADLGALAKEAALRELRRAIDLVG-------EYIGVTEDDFEEA 222

Query: 483 LYEIVPAFGAST--DDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLE 540
           L +++P+ G     +D+    + G+ +  +  K   +  +   E  +     P    LL 
Sbjct: 223 LKKVLPSRGVLFEDEDVTLDDIGGLEEAKEELKEAIETPLKRPELFRKLGLRPPKGVLLY 282

Query: 541 GPSGSGKTALAATAGIDSDFPFVKIISAE-SMIGLHESTKCAQIVKVFEDAYKSPLSIII 599
           GP G+GKT LA    ++S   F+ +  +E     + ES K   I ++FE A K   SII 
Sbjct: 283 GPPGTGKTLLAKAVALESRSRFISVKGSELLSKWVGESEK--NIRELFEKARKLAPSIIF 340

Query: 600 LDDIERLLEYVPIGPRFSNI-ISQTMLVLLKRLPPKGKKLLVIGTTSEVSFLDS 652
           +D+I+ L          S   +   +L  L  +    + +LVI  T+    LD 
Sbjct: 341 IDEIDSLASGRGPSEDGSGRRVVGQLLTELDGIEKA-EGVLVIAATNRPDDLDP 393

Length = 494
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|215012 smart01073, CDC48_N, Cell division protein 48 (CDC48) N-terminal domain Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|202475 pfam02933, CDC48_2, Cell division protein 48 (CDC48), domain 2 Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|216993 pfam02359, CDC48_N, Cell division protein 48 (CDC48), N-terminal domain Back     alignment and domain information
>gnl|CDD|235422 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>gnl|CDD|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|215011 smart01072, CDC48_2, Cell division protein 48 (CDC48) domain 2 Back     alignment and domain information
>gnl|CDD|224140 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 744
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0734752 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
KOG0731774 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 100.0
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 100.0
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 100.0
CHL00176638 ftsH cell division protein; Validated 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 100.0
CHL00195489 ycf46 Ycf46; Provisional 99.98
CHL00206 2281 ycf2 Ycf2; Provisional 99.98
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.97
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.97
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.97
CHL00095821 clpC Clp protease ATP binding subunit 99.97
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.96
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.96
PRK10865 857 protein disaggregation chaperone; Provisional 99.95
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.95
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 99.95
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 99.95
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 99.95
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 99.94
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 99.94
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 99.94
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 99.94
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 99.93
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.92
PRK03992389 proteasome-activating nucleotidase; Provisional 99.92
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 99.92
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 99.92
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 99.91
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 99.91
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.91
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.9
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.9
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.89
CHL00206 2281 ycf2 Ycf2; Provisional 99.89
CHL00176 638 ftsH cell division protein; Validated 99.89
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 99.88
CHL00181287 cbbX CbbX; Provisional 99.88
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 99.87
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.86
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.86
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.85
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.85
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.85
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.84
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.84
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.82
PF00004132 AAA: ATPase family associated with various cellula 99.82
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.81
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.81
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.81
PF00004132 AAA: ATPase family associated with various cellula 99.77
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.76
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.74
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.74
CHL00181287 cbbX CbbX; Provisional 99.73
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.73
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.7
KOG2028 554 consensus ATPase related to the helicase subunit o 99.69
PTZ00112 1164 origin recognition complex 1 protein; Provisional 99.67
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.66
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.66
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.66
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.66
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.66
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.64
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.61
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 99.61
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.6
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.59
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 99.58
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 99.57
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 99.56
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.56
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.56
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.56
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.55
PRK13342 413 recombination factor protein RarA; Reviewed 99.55
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.55
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.55
PRK00411 394 cdc6 cell division control protein 6; Reviewed 99.54
PF0235987 CDC48_N: Cell division protein 48 (CDC48), N-termi 99.54
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.54
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.54
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.53
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.53
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.53
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 99.52
PRK07940394 DNA polymerase III subunit delta'; Validated 99.52
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.52
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.51
PLN03025319 replication factor C subunit; Provisional 99.51
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.51
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.51
PRK04195 482 replication factor C large subunit; Provisional 99.51
PRK13341 725 recombination factor protein RarA/unknown domain f 99.51
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.51
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.51
PRK06893229 DNA replication initiation factor; Validated 99.5
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.5
PRK00149450 dnaA chromosomal replication initiation protein; R 99.5
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.49
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.49
PTZ001121164 origin recognition complex 1 protein; Provisional 99.49
KOG2004906 consensus Mitochondrial ATP-dependent protease PIM 99.49
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.49
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 99.48
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.48
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.48
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.48
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.48
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.47
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.47
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.47
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.47
COG2204464 AtoC Response regulator containing CheY-like recei 99.47
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.47
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.46
PRK06893229 DNA replication initiation factor; Validated 99.46
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.46
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 99.45
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 99.45
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.45
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.45
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.45
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.45
PRK08084235 DNA replication initiation factor; Provisional 99.44
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.44
PRK00149450 dnaA chromosomal replication initiation protein; R 99.44
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.44
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.44
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.44
KOG2028554 consensus ATPase related to the helicase subunit o 99.43
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.43
PRK06620214 hypothetical protein; Validated 99.43
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.43
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.42
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.42
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 99.42
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 99.42
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.41
PRK12422445 chromosomal replication initiation protein; Provis 99.41
PRK04195482 replication factor C large subunit; Provisional 99.41
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.41
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.41
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.41
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 99.41
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.41
PRK12402337 replication factor C small subunit 2; Reviewed 99.41
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.41
PRK12402337 replication factor C small subunit 2; Reviewed 99.4
PRK13342413 recombination factor protein RarA; Reviewed 99.4
PRK14088440 dnaA chromosomal replication initiation protein; P 99.4
PRK08084235 DNA replication initiation factor; Provisional 99.4
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 99.4
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 99.4
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.39
PRK14086617 dnaA chromosomal replication initiation protein; P 99.39
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.39
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.39
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.39
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 99.39
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 99.39
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 99.39
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.38
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.38
PRK12422445 chromosomal replication initiation protein; Provis 99.38
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.37
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.37
CHL00095 821 clpC Clp protease ATP binding subunit 99.37
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 99.37
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 99.37
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.37
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 99.36
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.36
PRK14088 440 dnaA chromosomal replication initiation protein; P 99.36
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.36
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.36
PRK13341 725 recombination factor protein RarA/unknown domain f 99.36
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.36
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.35
PRK05642234 DNA replication initiation factor; Validated 99.35
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.35
KOG1514 767 consensus Origin recognition complex, subunit 1, a 99.35
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.35
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.35
PRK08727233 hypothetical protein; Validated 99.35
PLN03025319 replication factor C subunit; Provisional 99.35
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 99.35
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.34
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.33
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.33
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.33
PRK07940 394 DNA polymerase III subunit delta'; Validated 99.33
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.33
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 99.32
PHA02544316 44 clamp loader, small subunit; Provisional 99.32
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 99.32
PRK08727233 hypothetical protein; Validated 99.32
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 99.31
PRK00440319 rfc replication factor C small subunit; Reviewed 99.31
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 99.31
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.31
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.3
PRK14086617 dnaA chromosomal replication initiation protein; P 99.3
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.3
PHA02544316 44 clamp loader, small subunit; Provisional 99.3
PRK05642234 DNA replication initiation factor; Validated 99.3
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 99.3
PRK14087450 dnaA chromosomal replication initiation protein; P 99.3
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.29
PRK10865 857 protein disaggregation chaperone; Provisional 99.29
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.28
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.28
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.28
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.28
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.27
PRK14087450 dnaA chromosomal replication initiation protein; P 99.27
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.27
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.26
PRK09087226 hypothetical protein; Validated 99.26
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 99.26
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 99.26
PRK04132846 replication factor C small subunit; Provisional 99.26
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 99.25
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 99.25
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.25
COG1221403 PspF Transcriptional regulators containing an AAA- 99.25
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.25
PRK15424538 propionate catabolism operon regulatory protein Pr 99.24
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.24
PRK06620214 hypothetical protein; Validated 99.24
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.24
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.24
COG0593408 DnaA ATPase involved in DNA replication initiation 99.23
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 99.23
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.23
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.22
PRK11608326 pspF phage shock protein operon transcriptional ac 99.22
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.21
PRK00440319 rfc replication factor C small subunit; Reviewed 99.2
KOG1969 877 consensus DNA replication checkpoint protein CHL12 99.2
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.2
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.2
PRK15429686 formate hydrogenlyase transcriptional activator Fh 99.18
COG0593408 DnaA ATPase involved in DNA replication initiation 99.18
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.16
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 99.16
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.16
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 99.15
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 99.14
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.13
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.13
PRK09112351 DNA polymerase III subunit delta'; Validated 99.13
PRK13531 498 regulatory ATPase RavA; Provisional 99.13
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 99.12
PRK09087226 hypothetical protein; Validated 99.12
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 99.11
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 99.11
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 99.1
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.09
KOG2227 529 consensus Pre-initiation complex, subunit CDC6, AA 99.09
PRK11331459 5-methylcytosine-specific restriction enzyme subun 99.09
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.08
PRK05707328 DNA polymerase III subunit delta'; Validated 99.08
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.07
PRK09112351 DNA polymerase III subunit delta'; Validated 99.06
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.06
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 99.05
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.05
PHA02244383 ATPase-like protein 99.04
PRK07471365 DNA polymerase III subunit delta'; Validated 99.03
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 99.02
KOG1969877 consensus DNA replication checkpoint protein CHL12 99.02
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.01
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 99.01
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.0
PRK15115444 response regulator GlrR; Provisional 99.0
PRK05564313 DNA polymerase III subunit delta'; Validated 98.99
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.98
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.98
PRK07471365 DNA polymerase III subunit delta'; Validated 98.98
COG3283511 TyrR Transcriptional regulator of aromatic amino a 98.97
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.97
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.97
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.97
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 98.97
smart00382148 AAA ATPases associated with a variety of cellular 98.95
PRK07399314 DNA polymerase III subunit delta'; Validated 98.95
smart00382148 AAA ATPases associated with a variety of cellular 98.95
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.95
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.95
PRK05707328 DNA polymerase III subunit delta'; Validated 98.94
PHA02244383 ATPase-like protein 98.94
COG0714329 MoxR-like ATPases [General function prediction onl 98.94
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 98.92
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.92
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.92
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.92
TIGR02442633 Cob-chelat-sub cobaltochelatase subunit. A number 98.92
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.91
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.91
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.89
TIGR00764608 lon_rel lon-related putative ATP-dependent proteas 98.88
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.88
PRK06964342 DNA polymerase III subunit delta'; Validated 98.87
PRK08058329 DNA polymerase III subunit delta'; Validated 98.86
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 98.86
PRK08058329 DNA polymerase III subunit delta'; Validated 98.86
PRK07993334 DNA polymerase III subunit delta'; Validated 98.86
PRK13531498 regulatory ATPase RavA; Provisional 98.85
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.84
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.83
PRK04132846 replication factor C small subunit; Provisional 98.83
PRK10365441 transcriptional regulatory protein ZraR; Provision 98.83
COG0714329 MoxR-like ATPases [General function prediction onl 98.82
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 98.82
smart00350509 MCM minichromosome maintenance proteins. 98.82
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.81
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.81
PRK06964342 DNA polymerase III subunit delta'; Validated 98.81
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.81
PRK08769319 DNA polymerase III subunit delta'; Validated 98.8
PRK07399314 DNA polymerase III subunit delta'; Validated 98.8
TIGR00602637 rad24 checkpoint protein rad24. This family is bas 98.79
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.79
PRK05564313 DNA polymerase III subunit delta'; Validated 98.78
PRK06871325 DNA polymerase III subunit delta'; Validated 98.77
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.77
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.77
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.76
PRK06871325 DNA polymerase III subunit delta'; Validated 98.76
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.75
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.74
PRK08769319 DNA polymerase III subunit delta'; Validated 98.74
PRK11608326 pspF phage shock protein operon transcriptional ac 98.73
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.73
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.73
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.73
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.72
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.72
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.72
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.72
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.72
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.7
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.7
smart00350509 MCM minichromosome maintenance proteins. 98.69
PF07726131 AAA_3: ATPase family associated with various cellu 98.69
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.68
PRK07993334 DNA polymerase III subunit delta'; Validated 98.68
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.67
PF07726131 AAA_3: ATPase family associated with various cellu 98.67
PRK08116268 hypothetical protein; Validated 98.66
PRK15424538 propionate catabolism operon regulatory protein Pr 98.65
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.65
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.65
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.65
COG1221403 PspF Transcriptional regulators containing an AAA- 98.64
PRK06090319 DNA polymerase III subunit delta'; Validated 98.64
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.64
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.62
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.6
PRK09862506 putative ATP-dependent protease; Provisional 98.59
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.59
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.56
PRK06090319 DNA polymerase III subunit delta'; Validated 98.56
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.56
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.55
PRK09862506 putative ATP-dependent protease; Provisional 98.53
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.52
PRK08699325 DNA polymerase III subunit delta'; Validated 98.52
COG2204464 AtoC Response regulator containing CheY-like recei 98.49
COG1239 423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.48
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 98.48
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.46
KOG1970 634 consensus Checkpoint RAD17-RFC complex, RAD17/RAD2 98.46
PRK08699325 DNA polymerase III subunit delta'; Validated 98.44
PRK12377248 putative replication protein; Provisional 98.44
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 98.42
PF13173128 AAA_14: AAA domain 98.42
PTZ00111915 DNA replication licensing factor MCM4; Provisional 98.42
PRK08181269 transposase; Validated 98.41
PRK06526254 transposase; Provisional 98.41
PRK07952244 DNA replication protein DnaC; Validated 98.4
PF03215519 Rad17: Rad17 cell cycle checkpoint protein 98.36
PTZ00111 915 DNA replication licensing factor MCM4; Provisional 98.36
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.35
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.34
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.33
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 98.32
PRK08939306 primosomal protein DnaI; Reviewed 98.31
PRK09183259 transposase/IS protein; Provisional 98.31
PRK06921266 hypothetical protein; Provisional 98.3
PRK08181269 transposase; Validated 98.29
PRK08116268 hypothetical protein; Validated 98.28
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.27
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 98.27
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.27
PRK05818261 DNA polymerase III subunit delta'; Validated 98.26
PRK12377248 putative replication protein; Provisional 98.26
PRK06526254 transposase; Provisional 98.26
PF13173128 AAA_14: AAA domain 98.25
PRK06835329 DNA replication protein DnaC; Validated 98.24
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.24
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.24
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.23
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.22
PRK13765637 ATP-dependent protease Lon; Provisional 98.22
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.21
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 98.21
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 98.2
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.19
PRK09302509 circadian clock protein KaiC; Reviewed 98.18
PRK09183259 transposase/IS protein; Provisional 98.18
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 98.17
PRK13765 637 ATP-dependent protease Lon; Provisional 98.16
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 98.16
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.16
PF05729166 NACHT: NACHT domain 98.16
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.15
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.14
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 98.13
PRK08939306 primosomal protein DnaI; Reviewed 98.13
PRK07132299 DNA polymerase III subunit delta'; Validated 98.12
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.09
PRK06921266 hypothetical protein; Provisional 98.09
PRK07952244 DNA replication protein DnaC; Validated 98.08
PRK05917290 DNA polymerase III subunit delta'; Validated 98.08
PRK15115444 response regulator GlrR; Provisional 98.06
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.06
PRK06835329 DNA replication protein DnaC; Validated 98.03
COG4650531 RtcR Sigma54-dependent transcription regulator con 98.02
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 98.02
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.02
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.02
PRK05818261 DNA polymerase III subunit delta'; Validated 97.99
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 97.99
PRK05917290 DNA polymerase III subunit delta'; Validated 97.98
KOG2228408 consensus Origin recognition complex, subunit 4 [R 97.97
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 97.97
KOG2228 408 consensus Origin recognition complex, subunit 4 [R 97.97
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.95
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 97.94
PRK06851367 hypothetical protein; Provisional 97.94
PRK10365441 transcriptional regulatory protein ZraR; Provision 97.93
PF0293364 CDC48_2: Cell division protein 48 (CDC48), domain 97.92
PRK07276290 DNA polymerase III subunit delta'; Validated 97.92
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.92
COG3283511 TyrR Transcriptional regulator of aromatic amino a 97.89
PRK07132299 DNA polymerase III subunit delta'; Validated 97.88
PRK07276290 DNA polymerase III subunit delta'; Validated 97.85
PRK13406584 bchD magnesium chelatase subunit D; Provisional 97.84
PF05729166 NACHT: NACHT domain 97.83
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.82
KOG1968 871 consensus Replication factor C, subunit RFC1 (larg 97.82
KOG2543 438 consensus Origin recognition complex, subunit 5 [R 97.8
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.76
PHA00729226 NTP-binding motif containing protein 97.73
PF00493331 MCM: MCM2/3/5 family This family extends the MCM d 97.73
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.72
TIGR02237209 recomb_radB DNA repair and recombination protein R 97.7
COG1373 398 Predicted ATPase (AAA+ superfamily) [General funct 97.69
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.68
KOG3595 1395 consensus Dyneins, heavy chain [Cytoskeleton] 97.67
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 97.67
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.66
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.64
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=7.5e-127  Score=993.92  Aligned_cols=699  Identities=56%  Similarity=0.883  Sum_probs=648.9

Q ss_pred             CCCceeEEEeecCCcccccccEEEeChhhhcccCCCCCCceEEEEeCCcEEEEEeeCCCCCCCcEeecHHHHhccCccCC
Q 004584            9 SSGVTTMNVINTPSADLALTNLAYCSPADLLNFRVPNSNLFLASVAGDSFVLSLASHPSVNKGQIALNSVQRRHAKVSTG   88 (744)
Q Consensus         9 ~~~~~~l~v~~~p~~~~a~tn~v~vs~~~~~~l~~~g~~~~~v~i~~~~~v~~~~~~~~~~~~~i~~~~~~r~~~~~~~~   88 (744)
                      ++..+.++|.+||++++++|||+||||.||.+.       .|+.+.+-+|+|+.+.++++++|.|++|..||+|+++++|
T Consensus         5 ~~~~~~~~v~k~ps~e~altn~a~v~~~DF~~~-------~~~~vd~~~~~Fs~~~~~~i~~g~i~fs~~qR~wa~~Sl~   77 (744)
T KOG0741|consen    5 VSNIKAFQVTKCPSNELALTNCAYVSPSDFRQF-------QVIIVDNFHYVFSTEFTPSIPPGNIGFSLPQRKWAGWSLG   77 (744)
T ss_pred             cccceeeeeecCCchhhhccCcceeCccccccc-------eeeEEeeeeEEEEeeccCCCCCceeccchhhhhhhhcccC
Confidence            445778999999999999999999999999753       3545533479999999999999999999999999999999


Q ss_pred             CeEEEEEeCCC-CcceeEeEEEEeeeeecCC-cccccCHHHHHHHHHHHhcCCccccCcEEEEEEcC-eEEEEEEEEeee
Q 004584           89 DHVSLNRFIPP-EDFNLALLTVELEFVKKGS-KNEQVDAVLLANQLRKRFINQVMTAGQRVVFEYHG-NNYIFTVNGAAV  165 (744)
Q Consensus        89 ~~v~~~~~~~~-~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~-~~~~~~v~~~~~  165 (744)
                      |.|.|+|+.++ ...+++.++++++|.+++. +...+|.++++..|+.+|.+|++++||.+.++|.+ ..+.++|.+++.
T Consensus        78 qev~V~~~~~~~~~~~l~~m~le~dF~~k~~~~sep~Dad~ma~qF~~~y~~q~fsvgQ~~~f~f~~~~~l~l~v~~ie~  157 (744)
T KOG0741|consen   78 QEVEVKPFTFDGSCDYLGSMTLEIDFLNKKNTTSEPFDADEMAKQFKRQYNSQAFSVGQQLVFEFNGNKLLGLKVKDIEA  157 (744)
T ss_pred             ceeEEEecccCcccccceeEEEEehhhhcCCCCCCCCCHHHHHHHHHHHhcCcccCCccEEEEEecCceEeeeEEEEEee
Confidence            99999999877 4468999999999998875 56789999999999999999999999999999998 446788888765


Q ss_pred             c------Ccc---cccccccceecCCcEEEEEecCCCceeeeccc--cCccccccccCCccccccCcCchHHHHHHHHHH
Q 004584          166 E------GQE---KSNALERGIITNETYFVFEASNDSGIKIVNQR--EGANSNIFRHKEFNLQSLGIGGLSAEFADIFRR  234 (744)
Q Consensus       166 ~------~~~---~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~igGl~~~~~~i~~~  234 (744)
                      -      +..   ......+|+++++|.|.|.+...+.+++.++.  ++....++. |+|+|+++||||||+++..|||+
T Consensus       158 ~D~~~~~~~~a~~~~~~~~~G~l~~nT~i~F~k~~~s~lnL~~~~~~k~~~n~ii~-Pdf~Fe~mGIGGLd~EFs~IFRR  236 (744)
T KOG0741|consen  158 FDPGISEGESAVTKRQKIERGLLLGNTQIVFEKAENSSLNLIGKSKTKPASNSIIN-PDFNFESMGIGGLDKEFSDIFRR  236 (744)
T ss_pred             eccccccCCcccccccceeeeEeecCcEEEEEeccCcceEeeccccccchhccccC-CCCChhhcccccchHHHHHHHHH
Confidence            1      111   11345689999999999999999999998774  333444455 99999999999999999999999


Q ss_pred             HHhccCCChhHHhHhCCCCCceEEEEcCCCChHHHHHHHHHHHhcCCCcEEecccchhcccccchHHHHHHHHHHHHhcc
Q 004584          235 AFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQ  314 (744)
Q Consensus       235 ~~~~~~~~~~~~~~~g~~~~~giLL~GppGtGKT~lar~la~~l~~~~~~~v~~~~l~~~~~g~~~~~i~~~f~~a~~~~  314 (744)
                      +|.++++||++.+++|++|.||+|||||||||||++||.+++.|+++++++|||+++++||+|++|+++|++|+.|++.+
T Consensus       237 AFAsRvFpp~vie~lGi~HVKGiLLyGPPGTGKTLiARqIGkMLNArePKIVNGPeIL~KYVGeSE~NvR~LFaDAEeE~  316 (744)
T KOG0741|consen  237 AFASRVFPPEVIEQLGIKHVKGILLYGPPGTGKTLIARQIGKMLNAREPKIVNGPEILNKYVGESEENVRKLFADAEEEQ  316 (744)
T ss_pred             HHHhhcCCHHHHHHcCccceeeEEEECCCCCChhHHHHHHHHHhcCCCCcccCcHHHHHHhhcccHHHHHHHHHhHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCCCeeEEEEcCcchhcccCCCCCCCCccHHHHHHHHHHhccCccCCCcEEEEEEeCCCCccchhhcCCCccceEE
Q 004584          315 RTRGDQSDLHVIIFDEIDAICKSRGSTRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQV  394 (744)
Q Consensus       315 ~~~~~~~~p~Il~iDEid~l~~~~~~~~~~~~~~~~~~~~LL~~~d~~~~~~~v~vI~~tn~~~~id~al~r~gRf~~~i  394 (744)
                      +..|..++.|||++||||++|++|++..+++++++.+++|||+.|||+++.+|++|||+|||.|+||+||+|||||+.++
T Consensus       317 r~~g~~SgLHIIIFDEiDAICKqRGS~~g~TGVhD~VVNQLLsKmDGVeqLNNILVIGMTNR~DlIDEALLRPGRlEVqm  396 (744)
T KOG0741|consen  317 RRLGANSGLHIIIFDEIDAICKQRGSMAGSTGVHDTVVNQLLSKMDGVEQLNNILVIGMTNRKDLIDEALLRPGRLEVQM  396 (744)
T ss_pred             HhhCccCCceEEEehhhHHHHHhcCCCCCCCCccHHHHHHHHHhcccHHhhhcEEEEeccCchhhHHHHhcCCCceEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEcCCCHHHHHHHHHHHHhcccccCCCCCcccHHHHHHhcCCCChHHHHHHHHHHHHHHHHhccccC--CCCCCCccccc
Q 004584          395 EISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMD--DLTKPVDEESI  472 (744)
Q Consensus       395 ~i~~Pd~~~r~~Il~~~~~~~~~~~~~~~~~~l~~la~~t~g~sg~dl~~l~~~A~~~a~~r~~~~~--~~~~~~~~~~~  472 (744)
                      +|.+||+++|.+||++|+++|..+..+..++|+.+||..|.+||||+|+.+++.|.++|++|++...  ....+...+.+
T Consensus       397 EIsLPDE~gRlQIl~IHT~rMre~~~l~~dVdl~elA~lTKNfSGAEleglVksA~S~A~nR~vk~~~~~~~~~~~~e~l  476 (744)
T KOG0741|consen  397 EISLPDEKGRLQILKIHTKRMRENNKLSADVDLKELAALTKNFSGAELEGLVKSAQSFAMNRHVKAGGKVEVDPVAIENL  476 (744)
T ss_pred             EEeCCCccCceEEEEhhhhhhhhcCCCCCCcCHHHHHHHhcCCchhHHHHHHHHHHHHHHHhhhccCcceecCchhhhhe
Confidence            9999999999999999999999999999999999999999999999999999999999999998766  33344567889


Q ss_pred             eeehhHHHHHHhhhccCCcccccccccccccceeecCcchhhHHHHHHHHHHHHHhcCCCCceeeeeecCCCCChhHHHH
Q 004584          473 KVTMDDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAA  552 (744)
Q Consensus       473 ~it~~df~~al~~~~Ps~~~~~~~l~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ll~GppG~GKT~la~  552 (744)
                      +|+++||..|+++++|+|+.++++++....+|++.|+..+.++++..+.++++++.+.+.+..++||.||||+|||++|.
T Consensus       477 kV~r~DFl~aL~dVkPAFG~see~l~~~~~~Gmi~~g~~v~~il~~G~llv~qvk~s~~s~lvSvLl~Gp~~sGKTaLAA  556 (744)
T KOG0741|consen  477 KVTRGDFLNALEDVKPAFGISEEDLERFVMNGMINWGPPVTRILDDGKLLVQQVKNSERSPLVSVLLEGPPGSGKTALAA  556 (744)
T ss_pred             eecHHHHHHHHHhcCcccCCCHHHHHHHHhCCceeecccHHHHHhhHHHHHHHhhccccCcceEEEEecCCCCChHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCCEEEEcccccccccchhhHhhHHHHHHHHHhcCCCeEEEEeccchhhccCCCCcchhHHHHHHHHHHhccCC
Q 004584          553 TAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVFEDAYKSPLSIIILDDIERLLEYVPIGPRFSNIISQTMLVLLKRLP  632 (744)
Q Consensus       553 ~~a~~~~~~~i~v~~~~~~~g~~~~~~~~~i~~if~~a~~~~~~il~iDEid~l~~~~~~g~~~~~~~~~~Ll~~l~~~~  632 (744)
                      .+|..+++|||++.+|+.++|.+|.+++.+++++|++||+++.+||++|+|++|++|+++||||||.++|+|+.++++.|
T Consensus       557 ~iA~~S~FPFvKiiSpe~miG~sEsaKc~~i~k~F~DAYkS~lsiivvDdiErLiD~vpIGPRfSN~vlQaL~VllK~~p  636 (744)
T KOG0741|consen  557 KIALSSDFPFVKIISPEDMIGLSESAKCAHIKKIFEDAYKSPLSIIVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKQP  636 (744)
T ss_pred             HHHhhcCCCeEEEeChHHccCccHHHHHHHHHHHHHHhhcCcceEEEEcchhhhhcccccCchhhHHHHHHHHHHhccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcEEEEEeCCCCCCCCccccccccceEEEcCCCC-HHHHHHHHHHccCCCHHHHHHHHHhCC----CCcHHHHHHHH
Q 004584          633 PKGKKLLVIGTTSEVSFLDSVGICDAFSVTYHVPTLK-TDDAKKVLKQLNVFAEEDVDSASEALN----DMPIKKLYMLI  707 (744)
Q Consensus       633 ~~~~~v~vi~~tn~~~~l~~~~l~~rf~~~i~~p~~~-~~~~~~Il~~~~~~~~~~~~~~~~~~~----~g~ir~l~~~l  707 (744)
                      +++++++|+|||++.+.|..+.+..+|+..+++|.++ .+++.++++..+.|++.+...+.....    ...|+++++++
T Consensus       637 pkg~kLli~~TTS~~~vL~~m~i~~~F~~~i~Vpnl~~~~~~~~vl~~~n~fsd~~~~~~~~~~~~~~~~vgIKklL~li  716 (744)
T KOG0741|consen  637 PKGRKLLIFGTTSRREVLQEMGILDCFSSTIHVPNLTTGEQLLEVLEELNIFSDDEVRAIAEQLLSKKVNVGIKKLLMLI  716 (744)
T ss_pred             CCCceEEEEecccHHHHHHHcCHHHhhhheeecCccCchHHHHHHHHHccCCCcchhHHHHHHHhccccchhHHHHHHHH
Confidence            9999999999999999999999999999999999999 699999999999999888766554433    67799999999


Q ss_pred             HHHHhccc
Q 004584          708 EMAAQGEQ  715 (744)
Q Consensus       708 ~~a~~~a~  715 (744)
                      ++|.+..+
T Consensus       717 e~a~q~e~  724 (744)
T KOG0741|consen  717 EMARQDEQ  724 (744)
T ss_pred             HHHhccCc
Confidence            99998754

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF02359 CDC48_N: Cell division protein 48 (CDC48), N-terminal domain; InterPro: IPR003338 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05818 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK05917 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PF02933 CDC48_2: Cell division protein 48 (CDC48), domain 2; InterPro: IPR004201 This domain has a double psi-beta barrel fold and includes VCP-like ATPase and N-ethylmaleimide sensitive fusion protein N-terminal domains Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK07132 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07276 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13406 bchD magnesium chelatase subunit D; Provisional Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG1968 consensus Replication factor C, subunit RFC1 (large subunit) [Replication, recombination and repair] Back     alignment and domain information
>KOG2543 consensus Origin recognition complex, subunit 5 [Replication, recombination and repair] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3595 consensus Dyneins, heavy chain [Cytoskeleton] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query744
3cf1_A806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 1e-44
1r7r_A816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 1e-44
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 6e-42
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 6e-42
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 7e-42
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 2e-41
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 4e-39
3cf0_A301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 1e-35
1nsf_A273 D2 Hexamerization Domain Of N-Ethylmaleimide Sensit 3e-35
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 2e-34
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 5e-34
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 6e-34
1d2n_A272 D2 Domain Of N-Ethylmaleimide-Sensitive Fusion Prot 6e-34
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 3e-33
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 9e-33
2ce7_A476 Edta Treated Length = 476 1e-32
3kds_E465 Apo-ftsh Crystal Structure Length = 465 5e-32
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 1e-30
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 1e-30
4eiw_A508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-28
2dhr_A499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-28
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 7e-28
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 9e-28
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 8e-27
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 2e-26
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 2e-23
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 2e-21
3vfd_A389 Human Spastin Aaa Domain Length = 389 9e-21
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 3e-20
1xwi_A322 Crystal Structure Of Vps4b Length = 322 8e-20
3b9p_A297 Spastin Length = 297 1e-17
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 1e-17
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 1e-17
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 1e-17
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 2e-17
1qdn_A204 Amino Terminal Domain Of The N-Ethylmaleimide Sensi 4e-09
1qcs_A211 N-Terminal Domain Of N-Ethylmaleimide Sensitive Fac 6e-08
2krk_A86 Solution Nmr Structure Of 26s Protease Regulatory S 2e-04
1um8_A376 Crystal Structure Of Helicobacter Pylori Clpx Lengt 3e-04
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure 
Iteration: 1

 Score =  178 bits (451), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 126/381 (33%), Positives = 198/381 (51%), Gaps = 25/381 (6%)
Query: 221 IGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNG 280
           IGG   + A I +      +  P +   +G+K  +G+LLYGPPGTGKTL+AR +     G
Sbjct: 206 IGGCRKQLAQI-KEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANE-TG 263
Query: 281 MEPKIVNGPEVLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGS 340
               ++NGPE++SK  GE+E N+R  F +AE +           +I  DE+DAI   R  
Sbjct: 264 AFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPA--------IIFIDELDAIAPKREK 315
Query: 341 TRDGTGVHDSIVNQLLTKIDGVESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPD 400
           T     V   IV+QLLT +DG++   +V+++  TNR + +D AL R GR + +V+I +PD
Sbjct: 316 TH--GEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPD 373
Query: 401 ENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSM 460
             GRL+ILQIHT  MK    LA DV+L+++A  T  + GA+L  +   A   A+ +++ +
Sbjct: 374 ATGRLEILQIHTKNMK----LADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDL 429
Query: 461 DDLT-KPVDEE---SIKVTMDDFLHALYEIVPAFGAST----DDLERSRLNGMVDCGDRH 512
            DL  + +D E   S+ VTMDDF  AL +  P+    T      +    + G+ D     
Sbjct: 430 IDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKREL 489
Query: 513 KHIYQRAMLLVEQVKVSKGSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMI 572
           + + Q  +   ++      +P    L  GP G GKT LA     +    F+ I   E ++
Sbjct: 490 QELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPE-LL 548
Query: 573 GLHESTKCAQIVKVFEDAYKS 593
            +      A + ++F+ A ++
Sbjct: 549 TMWFGESEANVREIFDKARQA 569
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|1NSF|A Chain A, D2 Hexamerization Domain Of N-Ethylmaleimide Sensitive Factor (Nsf) Length = 273 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|1D2N|A Chain A, D2 Domain Of N-Ethylmaleimide-Sensitive Fusion Protein Length = 272 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|1QDN|A Chain A, Amino Terminal Domain Of The N-Ethylmaleimide Sensitive Fusion Protein (Nsf) Length = 204 Back     alignment and structure
>pdb|1QCS|A Chain A, N-Terminal Domain Of N-Ethylmaleimide Sensitive Factor (Nsf) Length = 211 Back     alignment and structure
>pdb|2KRK|A Chain A, Solution Nmr Structure Of 26s Protease Regulatory Subunit 8 From H.Sapiens, Northeast Structural Genomics Consortium Target Target Hr3102a Length = 86 Back     alignment and structure
>pdb|1UM8|A Chain A, Crystal Structure Of Helicobacter Pylori Clpx Length = 376 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query744
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 2e-94
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 8e-42
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-84
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 1e-82
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 4e-82
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 4e-07
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 4e-77
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 8e-77
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 1e-67
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 7e-04
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 3e-55
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 3e-54
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 6e-54
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 3e-53
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 1e-52
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 8e-52
1qcs_A211 N-ethylmaleimide sensitive factor (NSF-N); double- 4e-51
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 4e-51
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 3e-49
2r62_A268 Cell division protease FTSH homolog; ATPase domain 7e-47
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 7e-46
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 2e-45
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-44
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-44
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 1e-41
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 1e-41
1cr5_A189 SEC18P (residues 22 - 210); double-PSI beta barrel 1e-39
2krk_A86 26S protease regulatory subunit 8; structural geno 2e-19
3kw6_A78 26S protease regulatory subunit 8; structural geno 4e-18
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-17
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-16
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 5e-16
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 3e-13
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 2e-12
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 2e-12
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 2e-08
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 5e-08
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 1e-07
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 2e-07
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 2e-07
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 2e-04
2v1u_A387 Cell division control protein 6 homolog; DNA repli 5e-04
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 8e-04
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
 Score =  293 bits (753), Expect = 2e-94
 Identities = 110/255 (43%), Positives = 160/255 (62%), Gaps = 6/255 (2%)

Query: 472 IKVTM-DDFLHALYEIVPAFGASTDDLERSRLNGMVDCGDRHKHIYQRAMLLVEQVKVSK 530
           ++ +       +  +I PAFG + +D     +NG++  GD    +     LLV+Q K S 
Sbjct: 1   MRGSHHHHHHGSTMDIKPAFGTNQEDYASYIMNGIIKWGDPVTRVLDDGELLVQQTKNSD 60

Query: 531 GSPLVTCLLEGPSGSGKTALAATAGIDSDFPFVKIISAESMIGLHESTKCAQIVKVFEDA 590
            +PLV+ LLEGP  SGKTALAA    +S+FPF+KI S + MIG  E+ KC  + K+F+DA
Sbjct: 61  RTPLVSVLLEGPPHSGKTALAAKIAEESNFPFIKICSPDKMIGFSETAKCQAMKKIFDDA 120

Query: 591 YKSPLSIIILDDIERLLEYVPIGPRFSNIISQTMLVLLKRLPPKGKKLLVIGTTSEVSFL 650
           YKS LS +++DDIERLL+YVPIGPRFSN++ Q +LVLLK+ PP+G+KLL+IGTTS    L
Sbjct: 121 YKSQLSCVVVDDIERLLDYVPIGPRFSNLVLQALLVLLKKAPPQGRKLLIIGTTSRKDVL 180

Query: 651 DSVGICDAFSVTYHVPTLKT-DDAKKVLKQLNVFAEEDVDSASEALND----MPIKKLYM 705
             + + +AFS T HVP + T +   + L+ L  F +++  + ++ +      + IKKL M
Sbjct: 181 QEMEMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLM 240

Query: 706 LIEMAAQGEQGGAAE 720
           LIEM+ Q +      
Sbjct: 241 LIEMSLQMDPEYRVR 255
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>1qcs_A N-ethylmaleimide sensitive factor (NSF-N); double-PSI beta barrel alpha beta roll, fusion protein; 1.90A {Cricetulus griseus} SCOP: b.52.2.3 d.31.1.1 PDB: 1qdn_A Length = 211 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>1cr5_A SEC18P (residues 22 - 210); double-PSI beta barrel, vesicle fusion, endocytosis/exocytosis complex; 2.30A {Saccharomyces cerevisiae} SCOP: b.52.2.3 d.31.1.1 Length = 189 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Length = 387 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 744
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 1e-67
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 7e-08
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 7e-65
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 6e-09
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 2e-50
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 2e-04
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 8e-42
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 0.001
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 1e-38
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 7e-05
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 3e-36
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 2e-25
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 3e-26
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 2e-25
d1qcsa186 b.52.2.3 (A:0-85) N-terminal domain of NSF-N, NSF- 5e-19
d1cr5a182 b.52.2.3 (A:26-107) N-terminal domain of NSF-N, NS 8e-18
d1qcsa2116 d.31.1.1 (A:86-201) C-terminal domain of NSF-N, NS 1e-16
d1cr5a2103 d.31.1.1 (A:108-210) C-terminal domain of NSF-N, N 1e-16
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 5e-15
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 6e-14
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 7e-13
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 4e-07
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 2e-06
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 3e-06
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 2e-04
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 3e-04
d1g41a_443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 6e-04
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 7e-04
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

 Score =  221 bits (565), Expect = 1e-67
 Identities = 85/246 (34%), Positives = 126/246 (51%), Gaps = 27/246 (10%)

Query: 243 PHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPEVLSKFVGETEKN 302
           P    KLG K  KG+L+ GPPGTGKTL+A+ I      +    ++G + +  FVG     
Sbjct: 34  PSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEA-KVPFFTISGSDFVEMFVGVGASR 92

Query: 303 IRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRDG-TGVHDSIVNQLLTKIDG 361
           +RD+F  A+             +I  DEIDA+ + RG+   G     +  +NQ+L ++DG
Sbjct: 93  VRDMFEQAKKAAPC--------IIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDG 144

Query: 362 VESLNNVLLIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFL 421
            E    +++I  TNR D+LD ALLRPGR + QV + LPD  GR QIL++H  ++     L
Sbjct: 145 FEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVP----L 200

Query: 422 APDVNLQELAARTKNYSGAELEGVAKSAVSFALNRQLSMDDLTKPVDEESIKVTMDDFLH 481
           APD++   +A  T  +SGA+L  +   A  FA                    V+M +F  
Sbjct: 201 APDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKR-------------VVSMVEFEK 247

Query: 482 ALYEIV 487
           A  +I+
Sbjct: 248 AKDKIM 253
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1qcsa1 b.52.2.3 (A:0-85) N-terminal domain of NSF-N, NSF-Nn {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 86 Back     information, alignment and structure
>d1cr5a1 b.52.2.3 (A:26-107) N-terminal domain of NSF-N, NSF-Nn {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} Length = 82 Back     information, alignment and structure
>d1qcsa2 d.31.1.1 (A:86-201) C-terminal domain of NSF-N, NSF-Nc {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 116 Back     information, alignment and structure
>d1cr5a2 d.31.1.1 (A:108-210) C-terminal domain of NSF-N, NSF-Nc {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} Length = 103 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query744
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 100.0
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.97
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.97
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.96
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.93
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.9
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.9
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.89
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.89
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.88
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.86
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.84
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.81
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.8
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.79
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.78
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.78
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.78
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.77
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.77
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.77
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.77
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.76
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.76
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.76
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.74
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.74
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.74
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.71
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.71
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.7
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.69
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.69
d1cr5a182 N-terminal domain of NSF-N, NSF-Nn {Baker's yeast 99.68
d1qcsa186 N-terminal domain of NSF-N, NSF-Nn {Hamster (Crice 99.68
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.67
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.66
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.66
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.64
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.63
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.61
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.6
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.58
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.55
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.55
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.54
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.54
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.52
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.52
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.51
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 99.46
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.43
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.4
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.39
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 99.19
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.18
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.18
d1cz5a191 N-terminal domain of VAT-N, VAT-Nn {Archaeon Therm 99.15
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 99.13
d1e32a186 Membrane fusion ATPase p97 N-terminal domain , P97 99.11
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 99.09
d1qcsa2116 C-terminal domain of NSF-N, NSF-Nc {Hamster (Crice 99.06
d1cr5a2103 C-terminal domain of NSF-N, NSF-Nc {Baker's yeast 98.93
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.9
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.74
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.46
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.29
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.25
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.22
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.87
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.84
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.82
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.82
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.82
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.81
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.78
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.77
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.74
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.73
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.68
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.66
d2qy9a2211 GTPase domain of the signal recognition particle r 97.64
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.63
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.59
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.59
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.58
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.56
d1okkd2207 GTPase domain of the signal recognition particle r 97.52
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.51
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.48
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.48
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.47
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.47
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.46
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.45
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.44
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.44
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.44
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.44
d1okkd2207 GTPase domain of the signal recognition particle r 97.44
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.44
d2qy9a2211 GTPase domain of the signal recognition particle r 97.43
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.42
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.42
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.4
d1vmaa2213 GTPase domain of the signal recognition particle r 97.38
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.38
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.37
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.36
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.36
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.35
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.35
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.35
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.35
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.34
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.34
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.33
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.33
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.33
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 97.32
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.32
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.32
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.31
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.31
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.3
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.29
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 97.27
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.27
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.26
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.26
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.26
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.25
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.25
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.24
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.24
d1vmaa2213 GTPase domain of the signal recognition particle r 97.23
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.23
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.19
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.18
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.18
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.17
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 97.16
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.15
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.15
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.14
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.13
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.13
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.12
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.12
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.07
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.05
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.04
d1tuea_205 Replication protein E1 helicase domain {Human papi 97.04
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.04
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.96
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.95
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.95
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.95
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.94
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 96.93
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.93
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.91
d1g2912240 Maltose transport protein MalK, N-terminal domain 96.88
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 96.88
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.87
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.86
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.82
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.78
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.78
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.76
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.76
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.75
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.74
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.73
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.73
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.72
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.71
d2awna2232 Maltose transport protein MalK, N-terminal domain 96.67
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.63
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 96.63
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.61
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 96.6
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.59
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 96.59
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 96.58
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 96.56
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 96.54
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.53
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 96.53
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.52
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 96.52
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 96.5
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.49
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.48
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.47
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.47
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.47
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 96.44
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.44
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.41
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.41
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 96.39
d2hyda1255 Putative multidrug export ATP-binding/permease pro 96.36
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.32
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 96.29
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.28
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 96.24
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.23
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.2
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.14
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.11
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.05
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.04
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 96.03
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 95.98
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 95.97
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.96
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 95.95
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 95.92
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.92
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.91
d2fh5b1207 Signal recognition particle receptor beta-subunit 95.91
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 95.88
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 95.85
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 95.85
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.84
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 95.82
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 95.82
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 95.79
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 95.73
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 95.73
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 95.71
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.69
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.68
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.68
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 95.64
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.62
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.6
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 95.57
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 95.48
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.42
d1e32a394 Membrane fusion atpase p97 domain 2, P97-Nc {Mouse 95.31
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 95.28
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 95.27
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.26
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 95.24
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 95.22
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 95.21
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.19
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 95.18
d1cz5a294 C-terminal domain of VAT-N, VAT-Nc {Archaeon Therm 95.18
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.13
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 95.05
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.05
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 95.04
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 95.04
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.02
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 95.02
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 95.0
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 94.95
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 94.93
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.91
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.82
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 94.81
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.79
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 94.72
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 94.69
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 94.66
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.63
d1nrjb_209 Signal recognition particle receptor beta-subunit 94.59
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.49
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 94.47
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.44
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 94.42
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 94.37
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 94.37
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 94.3
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 94.26
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.25
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 94.23
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 94.18
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 94.15
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 94.13
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 94.13
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 94.09
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 94.05
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.05
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 94.05
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 94.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 94.0
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 94.0
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 93.99
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 93.99
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 93.93
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.9
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 93.86
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.78
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.7
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.69
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 93.69
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 93.68
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.67
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 93.61
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 93.48
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 93.45
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.38
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.37
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.36
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 93.34
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 93.34
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.34
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 93.32
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.3
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 93.3
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 93.27
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 93.24
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.24
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 93.22
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.22
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.21
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 93.2
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 93.15
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 93.13
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 93.08
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 93.08
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 93.04
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.04
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 93.01
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 92.97
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 92.94
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 92.92
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.9
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 92.88
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 92.88
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.87
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 92.82
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.81
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.73
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.72
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 92.72
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.67
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.67
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.62
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.62
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.59
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 92.58
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 92.55
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.54
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 92.5
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 92.41
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.39
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 92.36
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.35
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 92.35
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.34
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 92.33
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 92.32
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.3
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.28
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 92.28
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.27
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.23
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 92.2
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 92.19
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 92.19
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 92.16
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.14
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.11
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 92.11
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 92.1
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 92.1
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.09
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.07
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.06
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 92.05
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 91.97
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.94
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 91.93
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 91.91
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.88
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 91.85
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 91.84
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 91.77
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 91.73
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 91.7
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.7
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 91.61
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 91.6
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 91.58
d1xpua3289 Transcription termination factor Rho, ATPase domai 91.54
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 91.5
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.47
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 91.46
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 91.45
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 91.44
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 91.42
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 91.4
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 91.39
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 91.35
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.31
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 91.26
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 91.26
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 91.16
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 90.91
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 90.89
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.83
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 90.67
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 90.66
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 90.55
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.54
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 90.48
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 90.4
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 90.32
d1f6va_91 C-terminal domain of B transposition protein {Bact 90.26
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 90.15
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.09
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 89.94
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 89.94
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 89.82
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 89.75
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 89.7
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 89.66
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 89.64
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.59
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 89.52
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 89.51
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 89.42
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.12
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 88.91
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 88.9
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 88.77
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 88.73
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 88.72
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 88.64
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 88.62
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 88.43
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 88.32
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 88.23
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 88.18
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 88.07
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 88.0
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.99
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 87.97
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 87.96
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 87.82
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 87.73
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 87.71
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 87.66
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 87.59
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 87.58
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 87.58
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 87.47
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 87.43
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 87.43
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 87.23
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.22
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 87.13
d2iv2x1151 Formate dehydrogenase H {Escherichia coli [TaxId: 86.86
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 86.83
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 86.75
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 86.74
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 86.7
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 86.67
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 86.48
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 86.35
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 86.13
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 86.03
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 85.87
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 85.84
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 85.79
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 85.75
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 85.6
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 85.47
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 85.47
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 85.29
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 85.25
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 85.07
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 84.95
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 84.77
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 84.6
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 84.14
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 83.85
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 83.81
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 83.52
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 83.42
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 82.5
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 82.48
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 82.35
d1g8ka1143 Arsenite oxidase large subunit {Alcaligenes faecal 81.6
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 81.54
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 81.0
d1vlfm1147 Transhydroxylase alpha subunit, AthL {Pelobacter a 80.69
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=0  Score=323.42  Aligned_cols=247  Identities=35%  Similarity=0.569  Sum_probs=222.6

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCCEEECCCC
Q ss_conf             67766322676760999999999998635799357747199888508999279991899999999995599738834210
Q 004584          211 HKEFNLQSLGIGGLSAEFADIFRRAFASRVFPPHVTSKLGIKHVKGMLLYGPPGTGKTLMARQIGKMLNGMEPKIVNGPE  290 (744)
Q Consensus       211 ~~~~~~~~~~igGl~~~~~~i~~~~~~~~~~~~~~~~~~g~~~~~giLL~GppGtGKT~lar~ia~~l~~~~~~~i~~~~  290 (744)
                      ++.++|+|  |+|++++++++ ++.+.. +.+|+.|.++|.+.|+|+|||||||||||++|+++|+++ +.+++.+++++
T Consensus         6 ~~~~t~~D--i~Gl~~~k~~l-~e~v~~-~~~~~~~~~~g~~~~~~iLL~GppGtGKT~la~~iA~~~-~~~~~~i~~~~   80 (256)
T d1lv7a_           6 QIKTTFAD--VAGCDEAKEEV-AELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEA-KVPFFTISGSD   80 (256)
T ss_dssp             SSCCCGGG--SCSCHHHHHHT-HHHHHH-HHCGGGC-----CCCCEEEEECCTTSCHHHHHHHHHHHH-TCCEEEECSCS
T ss_pred             CCCCCHHH--HHCHHHHHHHH-HHHHHH-HHCHHHHHHCCCCCCCEEEEECCCCCCCCHHHHHHHHHC-CCCEEEEEHHH
T ss_conf             99989999--81639999999-999999-879999998699988867866899888228999999982-99879988699


Q ss_pred             HHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCEEEEEECCCCHHCCCCCCCCC-CCCCHHHHHHHHHHHCCCCCCCCCEE
Q ss_conf             21012020499999999999820022499998169999174100003798888-87407889999997402965789489
Q 004584          291 VLSKFVGETEKNIRDLFADAENDQRTRGDQSDLHVIIFDEIDAICKSRGSTRD-GTGVHDSIVNQLLTKIDGVESLNNVL  369 (744)
Q Consensus       291 ~~~~~~g~~~~~i~~if~~a~~~~~~~~~~~~p~Ii~iDEid~l~~~~~~~~~-~~~~~~~i~~~Ll~~~d~~~~~~~v~  369 (744)
                      +.++|+|+++.+++++|+.|+...        ||||||||+|.+++++++... ......+++++|+..+|++....+++
T Consensus        81 l~~~~~g~~~~~l~~~f~~A~~~~--------P~il~iDeiD~l~~~r~~~~~~~~~~~~~~~~~ll~~~d~~~~~~~v~  152 (256)
T d1lv7a_          81 FVEMFVGVGASRVRDMFEQAKKAA--------PCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGII  152 (256)
T ss_dssp             STTSCCCCCHHHHHHHHHHHHTTC--------SEEEEETTHHHHTCCCSTTSCCTTCHHHHHHHHHHHHHHTCCSSSCEE
T ss_pred             HHHCCHHHHHHHHHHHHHHHHHCC--------CEEEEEECHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             426001078999999999999759--------989999775665756789888874899999999999953877779989


Q ss_pred             EEEEECCCCCCCHHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             99980788763333138996311799739997789999999970333468899864589999743899957899999999
Q 004584          370 LIGMTNRKDMLDEALLRPGRLEVQVEISLPDENGRLQILQIHTNKMKENSFLAPDVNLQELAARTKNYSGAELEGVAKSA  449 (744)
Q Consensus       370 vI~~tn~~~~id~al~r~gRf~~~i~i~~Pd~~~r~~Il~~~~~~~~~~~~~~~~~~l~~la~~t~g~sg~dl~~l~~~A  449 (744)
                      +||+||+|+.+|++++|||||+.+|++++|+.++|.+||+.++++++    +..++++..+++.|.||+++||.++|++|
T Consensus       153 vIatTn~~~~ld~al~R~gRfd~~i~i~~P~~~~R~~il~~~l~~~~----~~~~~~~~~la~~t~G~s~adi~~l~~~A  228 (256)
T d1lv7a_         153 VIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVP----LAPDIDAAIIARGTPGFSGADLANLVNEA  228 (256)
T ss_dssp             EEEEESCTTTSCGGGGSTTSSCEEEECCCCCHHHHHHHHHHHHTTSC----BCTTCCHHHHHHTCTTCCHHHHHHHHHHH
T ss_pred             EEEECCCCCCCCHHHCCCCCCCEEEECCCCCHHHHHHHHHHHCCCCC----CCCCCCHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             99807993107985768987877987799599999999998425998----68656999999868998999999999999


Q ss_pred             HHHHHHHCCCCCCCCCCCCCCCCEEEHHHHHHHHHHHC
Q ss_conf             99999830245778998764462541567999875204
Q 004584          450 VSFALNRQLSMDDLTKPVDEESIKVTMDDFLHALYEIV  487 (744)
Q Consensus       450 ~~~a~~r~~~~~~~~~~~~~~~~~it~~df~~al~~~~  487 (744)
                      ...+.++.             ...++.+||..|++++.
T Consensus       229 ~~~a~~~~-------------~~~i~~~d~~~Al~rv~  253 (256)
T d1lv7a_         229 ALFAARGN-------------KRVVSMVEFEKAKDKIM  253 (256)
T ss_dssp             HHHHHHTT-------------CSSBCHHHHHHHHHHHT
T ss_pred             HHHHHHCC-------------CCCCCHHHHHHHHHHHH
T ss_conf             99999828-------------98348999999999996
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1cr5a1 b.52.2.3 (A:26-107) N-terminal domain of NSF-N, NSF-Nn {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} Back     information, alignment and structure
>d1qcsa1 b.52.2.3 (A:0-85) N-terminal domain of NSF-N, NSF-Nn {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1cz5a1 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT-Nn {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e32a1 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qcsa2 d.31.1.1 (A:86-201) C-terminal domain of NSF-N, NSF-Nc {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1cr5a2 d.31.1.1 (A:108-210) C-terminal domain of NSF-N, NSF-Nc {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a3 d.31.1.1 (A:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1cz5a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1f6va_ a.49.1.1 (A:) C-terminal domain of B transposition protein {Bacteriophage mu [TaxId: 10677]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d2iv2x1 b.52.2.2 (X:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1g8ka1 b.52.2.2 (A:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlfm1 b.52.2.2 (M:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure