Citrus Sinensis ID: 004969


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-
MATDIHTLEQRYFDSCRRHDVLPNPAILSGFFKADVRKSQNEPCTLEIILEYLKDIDFQPLLEVCMQIGATEIEAVDVRSGTSCMLTGEFALSLMHAIDQKLRVVDLHDSSFGKDFIRNLSQRGLMCEVLNLRSSRFRKLNMIGEFKRIHTLNLDYSTSLTSFKEDCFSCMPNLICLSMCETRVGNLWTTIAALSKLPSLAELRFQNWLCCDDTGNSSGSSDQDDKTDFSQLNICSSFGAYGNVVINPDSQILVEDSSDDSEVDFSIQHREYDYLELLSNLVPQLDGEIDLWNEVSFDAFSNQNEEESSAGVLARCTADVSLKYISCHASPICFEKHYRDYMIASLPKLKFLDNLPIRKVDRERATITYSQYFEHLPYGRKHKESVVSILQQREIKASQTRGKTSRHKTSYPSGMSQYFYTRSLCAAKVGSSAWPCLHTLTVSGNHMGDENRSFRPRQFEYHPSISCLMVFGTLDGEIVVVNHENENIVSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHMPPSIRGMHYGAGTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGRRLQVFADMHKEHINVVKFSNHSPSIFATSSFDQDVKLWDLRQKPIQPCYTASSSKGNVMVCFSPDDHYLLGKGSGTSMFVQSLRGDPFRDFNMSILAAYTRPSSKSEIVKVNLLASTDHCDKECSHGQHSRPSRSMGG
ccccHHHHHHHHHHHHccccccccHHHHHHHHHHHcccccccccEEEEEEccccccccHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHHccEEEEEEcccccHHHHHHHHHHcccccEEEEEccccccccccccccccccEEEEEccccccccccccccccccccEEEEccccccccHHHHHHHHHcccccEEEEEEEccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHccccccccccEEHHHHHHHHHHHcccccccccccccccccccEEEEEccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccccccccccEEEEEcccccEEEEEEccccEEEEEcccccEEcccccccccccEEEEEEccccccEEEEEcccccEEEEEccccccccccccccccEEEccccccEEEEEEcccccEEEEEEccccEEEEEcccccccccccccccccEEEEEEccccccEEEEccccccEEEEEccccccccEEcccccccEEEEEEcccccEEEEEcccccEEEEEccccccccccccEEEEEEcccccEEEEEcccccccccccccccccccccccccccc
ccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHcccccEEEEEEEcccccEccHHHHHHHHHHHHHHccEEEcccccccHHHHHHHHHccccEEEEEEcccHHHHEcccccHHHEEEEEEcccccccccccccHcccccHHEEcccccHHHHHHHHHHHHHHcHHHHHHHHHHHEccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccHccccccccccccEcHHHEcccccccccccccccHHHHcccccccccHHcccccccccHHHHHHHHHHHHcccccHcccccccHccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccEEEEccccccEEEEEccccEEEEEEcccccEEEEEccccccccEEEEEEccccccEEEEEccccEEEEEEcccccccccEEccccEEEEccccEEEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEcccccccEEEEEEcccccEEEEEccccccEEEEEccccccccEEEEcccccEEEEEEcccccEEEEEccccEEEEEEccccccccccHHHHHHHcccccccHHHHHccccccccccccccccccccccccccc
MATDIHTLEQRYFDscrrhdvlpnpailsgffkadvrksqnepcTLEIILEYLKDIDFQPLLEVCMQIGATEieavdvrsgtscmlTGEFALSLMHAIDQKLRvvdlhdssfgKDFIRNLSQRGLMCEVLNLRSSRFRKLNMIGEFkrihtlnldystsltsfkedcfscmpnliclsMCETRVGNLWTTIAALSKLPSLAELRFqnwlccddtgnssgssdqddktdfsqlnicssfgaygnvvinpdsqilvedssddsevdfsiqHREYDYLELLSNLvpqldgeidlwnevsfdafsnqneeessagvlARCTADVSLKYIschaspicfekHYRDYMIaslpklkfldnlpirkvdreraTITYSQYfehlpygrkhKESVVSILQQREIKasqtrgktsrhktsypsgmsqyFYTRSLCAAkvgssawpclhtltvsgnhmgdenrsfrprqfeyhpsisclmvfgtLDGEIVVVNHENENIVSYIPSFGAMNSVLGLCwlkkypskliagsdngslklydirhmppsirgmhygagtvtfdefdQLTSVHVNSMDELFLAsgysknialydinsgRRLQVFADMHKEHINvvkfsnhspsifatssfdqdvklwdlrqkpiqpcytassskgnvmvcfspddhyllgkgsgtSMFVqslrgdpfrdfNMSILAaytrpsskseIVKVNLLASTdhcdkecshgqhsrpsrsmgg
MATDIHTLEQRYFDSCRRHDVLPNPAILSGFFKADVRKSQNEPCTLEIILEYLKDIDFQPLLEVCMQIGATEIEAVDVRSGTSCMLTGEFALSLMHAIDQKLRVVDLHDSSFGKDFIRNLSQRGLMCEVLNLRSSRFRKLNMIGEFKRIHTLNLDYSTSLTSFKEDCFSCMPNLICLSMCETRVGNLWTTIAALSKLPSLAELRFQNWLCCDDTGNSSGSSDQDDKTDFSQLNICSSFGAYGNVVINPDSQILVEDSSDDSEVDFSIQHREYDYLELLSNLVPQLDGEIDLWNEVSFDAFSNQNEEESSAGVLARCTADVSLKYISCHASPICFEKHYRDYMIASlpklkfldnlpirkvdrerATITYsqyfehlpygrKHKESVVSILQQReikasqtrgktsrhktsypsgmsqYFYTRSLCAAKVGSSAWPCLHTLTVSGNHMGDENRSFRPRQFEYHPSISCLMVFGTLDGEIVVVNHENENIVSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHMPPSIRGMHYGAGTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGRRLQVFADMHKEHINVVKFSNHSPSIFATSSFDQDVKLWDLRQKPIQPcytassskgnVMVCFSPDDHYLLGKGSGTSMFVQSLRGDPFRDFNMSILAaytrpsskseIVKVNLLASTDHcdkecshgqhsrpsrsmgg
MATDIHTLEQRYFDSCRRHDVLPNPAILSGFFKADVRKSQNEPCTLEIILEYLKDIDFQPLLEVCMQIGATEIEAVDVRSGTSCMLTGEFALSLMHAIDQKLRVVDLHDSSFGKDFIRNLSQRGLMCEVLNLRSSRFRKLNMIGEFKRIHTLNLDYSTSLTSFKEDCFSCMPNLICLSMCETRVGNLWTTIAALSKLPSLAELRFQNWLCCDDTGNSSGSSDQDDKTDFSQLNICSSFGAYGNVVINPDSQILvedssddsevdfsIQHREYDYLELLSNLVPQLDGEIDLWNEVSFDAFSNQNEEESSAGVLARCTADVSLKYISCHASPICFEKHYRDYMIASLPKLKFLDNLPIRKVDRERATITYSQYFEHLPYGRKHKESVVSILQQREIKASQTRGKTSRHKTSYPSGMSQYFYTRSLCAAKVGSSAWPCLHTLTVSGNHMGDENRSFRPRQFEYHPSISCLMVFGTLDGeivvvnhenenivSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHMPPSIRGMHYGAGTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGRRLQVFADMHKEHINVVKFSNHSPSIFATSSFDQDVKLWDLRQKPIQPCYTASSSKGNVMVCFSPDDHYLLGKGSGTSMFVQSLRGDPFRDFNMSILAAYTRPSSKSEIVKVNLLASTDHCDKECSHGQHSRPSRSMGG
******TLEQRYFDSCRRHDVLPNPAILSGFFKADVRKSQNEPCTLEIILEYLKDIDFQPLLEVCMQIGATEIEAVDVRSGTSCMLTGEFALSLMHAIDQKLRVVDLHDSSFGKDFIRNLSQRGLMCEVLNLRSSRFRKLNMIGEFKRIHTLNLDYSTSLTSFKEDCFSCMPNLICLSMCETRVGNLWTTIAALSKLPSLAELRFQNWLCCDD****************SQLNICSSFGAYGNVVINPDSQILV********VDFSIQHREYDYLELLSNLVPQLDGEIDLWNEVSFDAFS********AGVLARCTADVSLKYISCHASPICFEKHYRDYMIASLPKLKFLDNLPIRKVDRERATITYSQYFEHLPYGRKHKESVVSI**************************SQYFYTRSLCAAKVGSSAWPCLHTLTVSGNHM******FRPRQFEYHPSISCLMVFGTLDGEIVVVNHENENIVSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHMPPSIRGMHYGAGTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGRRLQVFADMHKEHINVVKFSNHSPSIFATSSFDQDVKLWDLRQKPIQPCYTASSSKGNVMVCFSPDDHYLLGKGSGTSMFVQSLRGDPFRDFNMSILAAYTR*****EIVKVNLLA***********************
***DIHTLEQRYFDSCRRHDVLPNPAILSGFFKADV*****EPCTLEIILEYLKDIDFQPLLEVCMQIGATEIEAVDVRSGTSCMLTGEFALSLMHAIDQKLRVVDLHDSSFGKDFIRNLSQRGLMCEVLNLRSSRFRKLNMIGEFKRIHTLNLDYSTSLTSFKEDCFSCMPNLICLSMCETRVGNLWTTIAALSKLPSLAELRFQNWLCC******************SQLNI********************************IQHREYDYLELLSNLVPQLDGEIDLWN***************************SLKYISCHASPICFEKHYRDYMIASLPKLKFLDNLPI****RERATITYSQYFEHLPYGRKHKESVVSIL****************************************SSAWPCLHTLTVSGNHMGDENRSFRPRQFEYHPSISCLMVFGTLDGEIVVVNHENENIVSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHMPPSIRGMHYGAGTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGRRLQVFADMHKEHINVVKFSNHSPSIFATSSFDQDVKLWDLRQKPIQ***TASSSKGNVMVCFSPDDHYLLGKGSGTSMFVQSLRGDPFRDFNMSILAAYTRPSSKSEIVKVNLLASTDHCDKECSHGQHS********
MATDIHTLEQRYFDSCRRHDVLPNPAILSGFFKADVRKSQNEPCTLEIILEYLKDIDFQPLLEVCMQIGATEIEAVDVRSGTSCMLTGEFALSLMHAIDQKLRVVDLHDSSFGKDFIRNLSQRGLMCEVLNLRSSRFRKLNMIGEFKRIHTLNLDYSTSLTSFKEDCFSCMPNLICLSMCETRVGNLWTTIAALSKLPSLAELRFQNWLCCDDT************TDFSQLNICSSFGAYGNVVINPDSQILVEDSSDDSEVDFSIQHREYDYLELLSNLVPQLDGEIDLWNEVSFDAFS***********LARCTADVSLKYISCHASPICFEKHYRDYMIASLPKLKFLDNLPIRKVDRERATITYSQYFEHLPYGRKHKESVVSILQQREI***************YPSGMSQYFYTRSLCAAKVGSSAWPCLHTLTVSGNHMGDENRSFRPRQFEYHPSISCLMVFGTLDGEIVVVNHENENIVSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHMPPSIRGMHYGAGTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGRRLQVFADMHKEHINVVKFSNHSPSIFATSSFDQDVKLWDLRQKPIQPCYTASSSKGNVMVCFSPDDHYLLGKGSGTSMFVQSLRGDPFRDFNMSILAAYTRPSSKSEIVKVNLLASTDHC******************
*ATDIHTLEQRYFDSCRRHDVLPNPAILSGFFKADVRKSQNEPCTLEIILEYLKDIDFQPLLEVCMQIGATEIEAVDVRSGTSCMLTGEFALSLMHAIDQKLRVVDLHDSSFGKDFIRNLSQRGLMCEVLNLRSSRFRKLNMIGEFKRIHTLNLDYSTSLTSFKEDCFSCMPNLICLSMCETRVGNLWTTIAALSKLPSLAELRFQNWLCCDDT*************DFSQLNICSSFGAYGNVVINPDSQILVEDSSDDSEVDFSIQHREYDYLELLSNLVPQLDGEIDLWNEVSFDAF******ESSAGVLARCTADVSLKYISCHASPICFEKHYRDYMIASLPKLKFLDNLPIRKVDRERATITYSQYFEHLPYGRKHKESVVSILQQREIK******KTSRHKTSYPSGMSQYFYTRSLCAAKVGSSAWPCLHTLTVSGNHMGDENRSFRPRQFEYHPSISCLMVFGTLDGEIVVVNHENENIVSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHMPPSIRGMHYGAGTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGRRLQVFADMHKEHINVVKFSNHSPSIFATSSFDQDVKLWDLRQKPIQPCYTASSSKGNVMVCFSPDDHYLLGKGSGTSMFVQSLRGDPFRDFNMSILAAYTRPSSKSEIVKVNLLAS**********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATDIHTLEQRYFDSCRRHDVLPNPAILSGFFKADVRKSQNEPCTLEIILEYLKDIDFQPLLEVCMQIGATEIEAVDVRSGTSCMLTGEFALSLMHAIDQKLRVVDLHDSSFGKDFIRNLSQRGLMCEVLNLRSSRFRKLNMIGEFKRIHTLNLDYSTSLTSFKEDCFSCMPNLICLSMCETRVGNLWTTIAALSKLPSLAELRFQNWLCCDDTGNSSGSSDQDDKTDFSQLNICSSFGAYGNVVINPDSQILVEDSSDDSEVDFSIQHREYDYLELLSNLVPQLDGEIDLWNEVSFDAFSNQNEEESSAGVLARCTADVSLKYISCHASPICFEKHYRDYMIASLPKLKFLDNLPIRKVDRERATITYSQYFEHLPYGRKHKESVVSILQQREIKASQTRGKTSRHKTSYPSGMSQYFYTRSLCAAKVGSSAWPCLHTLTVSGNHMGDENRSFRPRQFEYHPSISCLMVFGTLDGEIVVVNHENENIVSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHMPPSIRGMHYGAGTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGRRLQVFADMHKEHINVVKFSNHSPSIFATSSFDQDVKLWDLRQKPIQPCYTASSSKGNVMVCFSPDDHYLLGKGSGTSMFVQSLRGDPFRDFNMSILAAYTRPSSKSEIVKVNLLASTDHCDKECSHGQHSRPSRSMGG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query721 2.2.26 [Sep-21-2011]
Q92466427 DNA damage-binding protei yes no 0.310 0.524 0.25 2e-08
Q66JG1 501 DNA damage-binding protei yes no 0.251 0.361 0.264 7e-07
Q7ZUV2 694 Katanin p80 WD40 repeat-c yes no 0.264 0.275 0.265 5e-06
Q0VBY8426 DNA damage-binding protei yes no 0.266 0.450 0.229 8e-06
O74340436 Protein sof1 OS=Schizosac yes no 0.203 0.337 0.238 9e-06
O61585 690 Katanin p80 WD40 repeat-c yes no 0.162 0.169 0.305 1e-05
P40066 365 Nucleoporin GLE2 OS=Sacch yes no 0.145 0.287 0.319 1e-05
Q9XF57317 Peroxisome biogenesis pro no no 0.167 0.381 0.270 2e-05
Q6P3H7424 Histone-binding protein R no no 0.289 0.492 0.248 4e-05
Q5M7K4425 Histone-binding protein R no no 0.289 0.491 0.244 4e-05
>sp|Q92466|DDB2_HUMAN DNA damage-binding protein 2 OS=Homo sapiens GN=DDB2 PE=1 SV=1 Back     alignment and function desciption
 Score = 61.6 bits (148), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 107/244 (43%), Gaps = 20/244 (8%)

Query: 421 TRSLCAAKVGSSAWPCLHT-LTVSGNHMGDENRSF--------RPRQFEYHPSISCLMVF 471
            R+L   K+G ++WP +   L  S  H  D  R          R     +HP+    +  
Sbjct: 70  VRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAV 129

Query: 472 GTLDGEIVVVNHENENIVSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHM 531
           G+  G+I++ N   ++  ++I   GA  S+ GL +     ++  A S  G+ +L D +  
Sbjct: 130 GSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKG- 188

Query: 532 PPSIRGMHYGAGTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGRRLQVFADM 591
             +I  +   + T+         S+ V++   + +      N+ L +++ G+ L     M
Sbjct: 189 --NILRVFASSDTINI----WFCSLDVSASSRMVVTGDNVGNVILLNMD-GKELWNL-RM 240

Query: 592 HKEHINVVKFSNHSPSIFATSSFDQDVKLWDLRQKPIQPCYTASSSKGNVM--VCFSPDD 649
           HK+ +  V  +       AT+S DQ VK+WDLRQ   +  +  S    + +   CFSPD 
Sbjct: 241 HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG 300

Query: 650 HYLL 653
             LL
Sbjct: 301 ARLL 304




Required for DNA repair. Binds to DDB1 to form the UV-damaged DNA-binding protein complex (the UV-DDB complex). The UV-DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The UV-DDB complex preferentially binds to cyclobutane pyrimidine dimers (CPD), 6-4 photoproducts (6-4 PP), apurinic sites and short mismatches. Also appears to function as the substrate recognition module for the DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex DDB1-CUL4-ROC1 (also known as CUL4-DDB-ROC1 and CUL4-DDB-RBX1). The DDB1-CUL4-ROC1 complex may ubiquitinate histone H2A, histone H3 and histone H4 at sites of UV-induced DNA damage. The ubiquitination of histones may facilitate their removal from the nucleosome and promote subsequent DNA repair. The DDB1-CUL4-ROC1 complex also ubiquitinates XPC, which may enhance DNA-binding by XPC and promote NER. Isoform D1 and isoform D2 inhibit UV-damaged DNA repair.
Homo sapiens (taxid: 9606)
>sp|Q66JG1|DDB2_XENTR DNA damage-binding protein 2 OS=Xenopus tropicalis GN=ddb2 PE=2 SV=1 Back     alignment and function description
>sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 Back     alignment and function description
>sp|Q0VBY8|DDB2_BOVIN DNA damage-binding protein 2 OS=Bos taurus GN=DDB2 PE=2 SV=1 Back     alignment and function description
>sp|O74340|DCA13_SCHPO Protein sof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sof1 PE=3 SV=1 Back     alignment and function description
>sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 Back     alignment and function description
>sp|P40066|GLE2_YEAST Nucleoporin GLE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLE2 PE=1 SV=1 Back     alignment and function description
>sp|Q9XF57|PEX7_ARATH Peroxisome biogenesis protein 7 OS=Arabidopsis thaliana GN=PEX7 PE=1 SV=2 Back     alignment and function description
>sp|Q6P3H7|RBBP4_DANRE Histone-binding protein RBBP4 OS=Danio rerio GN=rbbp4 PE=2 SV=3 Back     alignment and function description
>sp|Q5M7K4|RBBP4_XENTR Histone-binding protein RBBP4 OS=Xenopus tropicalis GN=rbbp4 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query721
224105657783 predicted protein [Populus trichocarpa] 0.890 0.819 0.686 0.0
224060678817 predicted protein [Populus trichocarpa] 0.908 0.801 0.655 0.0
255555221794 nucleotide binding protein, putative [Ri 0.904 0.821 0.667 0.0
356534295804 PREDICTED: uncharacterized protein LOC10 0.890 0.798 0.643 0.0
296083092814 unnamed protein product [Vitis vinifera] 0.884 0.783 0.660 0.0
147861826806 hypothetical protein VITISV_026521 [Viti 0.894 0.800 0.638 0.0
356574293787 PREDICTED: uncharacterized protein LOC10 0.866 0.794 0.630 0.0
359475456794 PREDICTED: uncharacterized protein LOC10 0.894 0.812 0.641 0.0
359480634804 PREDICTED: uncharacterized protein LOC10 0.873 0.783 0.559 0.0
296087358742 unnamed protein product [Vitis vinifera] 0.828 0.804 0.550 0.0
>gi|224105657|ref|XP_002313890.1| predicted protein [Populus trichocarpa] gi|222850298|gb|EEE87845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/651 (68%), Positives = 520/651 (79%), Gaps = 9/651 (1%)

Query: 11  RYFDSCRRHDVLPNPAILSGFFKADVRKSQNEPCTLEIILEYLKDIDFQPLLEVCMQIGA 70
           RY DSC+R DVLPN  ILSGFFKA+V+KS NE C+LEIIL++LKDID  PLL+VC  I  
Sbjct: 1   RYIDSCKRRDVLPNTEILSGFFKAEVKKSCNELCSLEIILDHLKDIDVPPLLDVCATIET 60

Query: 71  TEIEAVDVRSGTSCMLTGEFALSLMHAIDQKLRVVDLHDSSFGKDFIRNLSQRGLMCEVL 130
           +EIEAVD+R+G SC L GE ALSLM A +QKLR VDL DS FGKDF+R LSQRGL C++L
Sbjct: 61  SEIEAVDIRNGPSCSLNGECALSLMRAFNQKLRAVDLQDSPFGKDFLRELSQRGLACQIL 120

Query: 131 NLRSSRFRKLNMIGEFKRIHTLNLDYSTSLTSFKEDCFSCMPNLICLSMCETRVGNLWTT 190
           NLRSS FRKLNM G+F +IHTLNLD+STSLTSF EDCF+CMPNLICLSMCETRV NLWTT
Sbjct: 121 NLRSSHFRKLNMAGKFMQIHTLNLDFSTSLTSFLEDCFTCMPNLICLSMCETRVANLWTT 180

Query: 191 IAALSKLPSLAELRFQNWLCCDDTGNSSGSS-DQDDKTDFSQLNICSSFGAYGNVVINPD 249
           I+ALSKL  L ELRFQ WLC D    S+ S  + +D+ D      C+  G     + + +
Sbjct: 181 ISALSKLSCLVELRFQKWLCNDSASPSASSGGNLEDQPDVGLPISCTDIGEQ---LTDIE 237

Query: 250 SQILVEDSSDDS----EVDFSIQHREYDYLELLSNLVPQLDGEIDLWNEVSFDAFSNQNE 305
            +  +   +D++    EVDFS   RE+ Y +LL+N     + +++L NEVS  A  NQ +
Sbjct: 238 EETYLNPGTDEAFRNFEVDFSSNWREFGYTDLLANFSSGWNRQVNLQNEVSSGASLNQ-K 296

Query: 306 EESSAGVLARCTADVSLKYISCHASPICFEKHYRDYMIASLPKLKFLDNLPIRKVDRERA 365
           EES  G   R  ADV LKYI  HASPICFEKHYR+YMIASLP LK LDNLP+RK+DRERA
Sbjct: 297 EESLTGSFGRHIADVPLKYIPRHASPICFEKHYREYMIASLPNLKVLDNLPVRKIDRERA 356

Query: 366 TITYSQYFEHLPYGRKHKESVVSILQQREIKASQTRGKTSRHKTSYPSGMSQYFYTRSLC 425
            +T+SQYFE+LPY RKHKESVVSIL +REIK +++  ++   K SY  G SQYFYTRSL 
Sbjct: 357 AVTFSQYFEYLPYNRKHKESVVSILHKREIKETRSHIQSKNQKLSYSHGNSQYFYTRSLG 416

Query: 426 AAKVGSSAWPCLHTLTVSGNHMGDENRSFRPRQFEYHPSISCLMVFGTLDGEIVVVNHEN 485
           AAKVGSSAWP LH+L+VSG  +GD +RSFRPRQFEYHPS+S LMVFGTLDGE+VVVNHEN
Sbjct: 417 AAKVGSSAWPFLHSLSVSGCDLGDGSRSFRPRQFEYHPSLSSLMVFGTLDGEVVVVNHEN 476

Query: 486 ENIVSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHMPPSIRGMHYGAGTV 545
             +V Y+PS GAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDI H+PP++ G + GAG++
Sbjct: 477 GKVVRYVPSLGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIEHLPPTVTGRYLGAGSI 536

Query: 546 TFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGRRLQVFADMHKEHINVVKFSNHS 605
           TFD+FDQLTSVH+NS DELFLASGYSKN+ALYDIN GRR+QVF DMH+EHINVVKFSNHS
Sbjct: 537 TFDDFDQLTSVHINSTDELFLASGYSKNVALYDINYGRRIQVFTDMHREHINVVKFSNHS 596

Query: 606 PSIFATSSFDQDVKLWDLRQKPIQPCYTASSSKGNVMVCFSPDDHYLLGKG 656
           PSIFATSSFDQDVKLWDLR KPI+PCYT SSS+GNVMVCFSPDDHYLL   
Sbjct: 597 PSIFATSSFDQDVKLWDLRLKPIRPCYTTSSSRGNVMVCFSPDDHYLLASA 647




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224060678|ref|XP_002300252.1| predicted protein [Populus trichocarpa] gi|222847510|gb|EEE85057.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255555221|ref|XP_002518647.1| nucleotide binding protein, putative [Ricinus communis] gi|223542028|gb|EEF43572.1| nucleotide binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356534295|ref|XP_003535692.1| PREDICTED: uncharacterized protein LOC100806443 [Glycine max] Back     alignment and taxonomy information
>gi|296083092|emb|CBI22496.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147861826|emb|CAN78929.1| hypothetical protein VITISV_026521 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356574293|ref|XP_003555283.1| PREDICTED: uncharacterized protein LOC100811988 [Glycine max] Back     alignment and taxonomy information
>gi|359475456|ref|XP_002269406.2| PREDICTED: uncharacterized protein LOC100267918 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480634|ref|XP_002279255.2| PREDICTED: uncharacterized protein LOC100247452 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296087358|emb|CBI33732.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query721
TAIR|locus:2116179783 AT4G34280 "AT4G34280" [Arabido 0.875 0.805 0.509 8.7e-184
UNIPROTKB|E2R0N2427 DDB2 "Uncharacterized protein" 0.325 0.550 0.250 1.4e-06
WB|WBGene00009341 331 thoc-3 [Caenorhabditis elegans 0.138 0.302 0.262 1.4e-05
UNIPROTKB|Q92466427 DDB2 "DNA damage-binding prote 0.309 0.522 0.242 1.8e-05
TAIR|locus:2176085299 AT5G64730 "AT5G64730" [Arabido 0.147 0.354 0.268 1.8e-05
DICTYBASE|DDB_G0284101244 snrpA1 "U2 small nuclear ribon 0.156 0.463 0.264 3.7e-05
UNIPROTKB|O93377425 rbbp4-a "Histone-binding prote 0.212 0.36 0.273 3.7e-05
UNIPROTKB|Q5M7K4425 rbbp4 "Histone-binding protein 0.212 0.36 0.273 3.7e-05
UNIPROTKB|Q6INH0425 rbbp4-b "Histone-binding prote 0.212 0.36 0.273 3.7e-05
UNIPROTKB|B0W517425 CPIJ001500 "Ribosome biogenesi 0.213 0.362 0.233 3.7e-05
TAIR|locus:2116179 AT4G34280 "AT4G34280" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1581 (561.6 bits), Expect = 8.7e-184, Sum P(2) = 8.7e-184
 Identities = 336/659 (50%), Positives = 434/659 (65%)

Query:     3 TDIHTLEQRYFDSCRRHDVLPNPAILSGFFKADVRKSQNEPCTLEIILEYLKDIDFQPLL 62
             T+I TLE++Y + C+ H +LPN AILS FF+A+V+KS+N+ C + + ++ +K  D+ PLL
Sbjct:     5 TEIATLEEKYIELCKMHGILPNTAILSAFFEAEVKKSRNQRCIMNLYVDRVKYDDYLPLL 64

Query:    63 EVCMQIGATEIEAVDVRSGTSCMLTGEFALSLMHAIDQKLRVVDLHDSSFGKDFIRNLSQ 122
             E+C +I  +E++ +D+   ++C L   +AL L+ +++QKLRVV LHDS FGK+F +++  
Sbjct:    65 ELCNEINTSEVQGIDLFVRSACSLEDHYALPLIRSVNQKLRVVHLHDS-FGKNFWQDVFF 123

Query:   123 RGLMCEVLNLRSSRFRKLNMIGEFKRIHTLNLDYSTSLTSFKEDCFSCMPNLICLSMCET 182
             +GL C+VLN+RS    KLN++GEF ++HTL LD    +  F EDCFSCMP L  LSMC+T
Sbjct:   124 QGLSCKVLNVRSMHIHKLNIVGEFTQLHTLILD-KNRIVGFGEDCFSCMPKLTYLSMCDT 182

Query:   183 RVGNLWTTIAALSKLPSLAELRFQNWLCCDDTG-----NSSGSSDQDDKTDFSQLNICSS 237
              V +LWT+ AAL KLPSL ELRFQ W+ C D+      +S  SS +DD   F + +    
Sbjct:   183 LVSDLWTSAAALLKLPSLKELRFQIWISCSDSSPLNSESSPSSSTKDDINTFIESDPPVE 242

Query:   238 FGAYGNVVINPDSQILXXXXXXXXXXXXXIQHREYDYLELLSNLVPQLDGEIDLWNEVSF 297
                + +V    D  +              I   E D L+   ++   L+GE+ +  +V  
Sbjct:   243 ADMW-DVAEQMDPSLPVEETLHSMDFSYKIP--EQDDLDSHVSVSAGLNGEVLMREKVRR 299

Query:   298 DAFSNQNEEESSAGVLARCTADVSLKYISCHASPICFEKHYRDYMIASLPKLKFLDNLPI 357
                  Q ++ S      R   +V LKYIS  ASPIC EKHYR YMI SLPKL+ LDNL I
Sbjct:   300 GKMPYQPKDVSPVDTFTRQFGNVGLKYISSKASPICSEKHYRMYMINSLPKLQVLDNLAI 359

Query:   358 RKVDRERATITYSQYFEHLPYGRKHKESVVSILQQREIKASQTRGKTSRHKTSYPSGMSQ 417
             RK DR++A  TYS  FE LPY RK KESVV +L+ RE ++S+              G SQ
Sbjct:   360 RKSDRDKAIETYSANFEDLPYKRK-KESVVRVLENREKRSSK--------------GKSQ 404

Query:   418 YFYTRSLCAAKVGSSAWPCLHTLTVSGNHMG--DENRSFRPRQFEYHPSISCLMVFGTLD 475
               Y RSLCAAK+GS A P LH+L    + +   D+N    PRQFEYHP    LMVFGTLD
Sbjct:   405 NSYKRSLCAAKMGSPASPLLHSLPFLSSRIQQEDDNSRLCPRQFEYHPLDPSLMVFGTLD 464

Query:   476 GXXXXXXXXXXXXXSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHMPPSI 535
             G              YIPS G+ +++LGLCWLK YPS +IAGS NGSLKLYDI+    ++
Sbjct:   465 GEVVVLNHESGKIFRYIPSNGSQSTILGLCWLKIYPSMVIAGSANGSLKLYDIQKASSTV 524

Query:   536 R-GMHYGAGTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGRRLQVFADMHKE 594
                 H  +G+VTFDEFDQLTSVH NS D+LFLASGYSK++ALYDI  G RLQVFA+MH+E
Sbjct:   525 TTSSHSTSGSVTFDEFDQLTSVHANSTDQLFLASGYSKDVALYDIGRGTRLQVFANMHQE 584

Query:   595 HINVVKFSNHSPSIFATSSFDQDVKLWDLRQKPIQPCYTASSSKGNVMVCFSPDDHYLL 653
             HINVVKFSNHSP +FATSSFD+DVKLWDLRQ+P +PCYTASS+KGNVMVCFSPDD YLL
Sbjct:   585 HINVVKFSNHSPFLFATSSFDKDVKLWDLRQEPSRPCYTASSTKGNVMVCFSPDDRYLL 643


GO:0000166 "nucleotide binding" evidence=ISS
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
UNIPROTKB|E2R0N2 DDB2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00009341 thoc-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q92466 DDB2 "DNA damage-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2176085 AT5G64730 "AT5G64730" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284101 snrpA1 "U2 small nuclear ribonucleoprotein A'" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|O93377 rbbp4-a "Histone-binding protein RBBP4-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q5M7K4 rbbp4 "Histone-binding protein RBBP4" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q6INH0 rbbp4-b "Histone-binding protein RBBP4-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|B0W517 CPIJ001500 "Ribosome biogenesis protein WDR12 homolog" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.IX.2461.1
hypothetical protein (783 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query721
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-12
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-12
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 6e-10
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-09
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-08
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-07
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-07
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-07
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-05
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 67.4 bits (165), Expect = 4e-12
 Identities = 50/197 (25%), Positives = 82/197 (41%), Gaps = 24/197 (12%)

Query: 468 LMVFGTLDGEIVVVN-HENENIVSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLY 526
           L+  G+ DG I V +    E + +     G +  V            L +GS + +++L+
Sbjct: 23  LLATGSGDGTIKVWDLETGELLRTLKGHTGPVRDVAASADGTY----LASGSSDKTIRLW 78

Query: 527 DIRHMPPSIR--GMHYGAGTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGRR 584
           D+      +R    H             ++SV  +    +  +S   K I ++D+ +G+ 
Sbjct: 79  DLE-TGECVRTLTGH----------TSYVSSVAFSPDGRILSSSSRDKTIKVWDVETGKC 127

Query: 585 LQVFADMHKEHINVVKFSNHSPSIFATSSFDQDVKLWDLRQKPIQPCYTASSSKGNVM-V 643
           L      H + +N V FS    +  A+SS D  +KLWDLR    +   T +   G V  V
Sbjct: 128 LTTLRG-HTDWVNSVAFS-PDGTFVASSSQDGTIKLWDLRT--GKCVATLTGHTGEVNSV 183

Query: 644 CFSPD-DHYLLGKGSGT 659
            FSPD +  L     GT
Sbjct: 184 AFSPDGEKLLSSSSDGT 200


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 721
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.97
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.97
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.97
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.97
KOG0286343 consensus G-protein beta subunit [General function 99.96
KOG0263707 consensus Transcription initiation factor TFIID, s 99.96
KOG0263707 consensus Transcription initiation factor TFIID, s 99.95
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.95
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.95
KOG0268 433 consensus Sof1-like rRNA processing protein (conta 99.95
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.95
KOG0284 464 consensus Polyadenylation factor I complex, subuni 99.94
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.94
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.94
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.94
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.94
KOG0315311 consensus G-protein beta subunit-like protein (con 99.93
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.93
KOG0266456 consensus WD40 repeat-containing protein [General 99.93
KOG0645312 consensus WD40 repeat protein [General function pr 99.93
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.93
KOG0266456 consensus WD40 repeat-containing protein [General 99.93
KOG0295406 consensus WD40 repeat-containing protein [Function 99.92
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.92
PLN00181793 protein SPA1-RELATED; Provisional 99.92
PTZ00421 493 coronin; Provisional 99.92
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.92
PTZ00420 568 coronin; Provisional 99.92
KOG0315311 consensus G-protein beta subunit-like protein (con 99.92
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.92
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.92
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.91
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.91
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.91
PLN00181793 protein SPA1-RELATED; Provisional 99.91
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.9
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.9
KOG0286343 consensus G-protein beta subunit [General function 99.9
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.9
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.9
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.9
KOG0645312 consensus WD40 repeat protein [General function pr 99.9
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.9
KOG0285 460 consensus Pleiotropic regulator 1 [RNA processing 99.9
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.89
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.89
KOG0295406 consensus WD40 repeat-containing protein [Function 99.89
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.89
PTZ00421 493 coronin; Provisional 99.89
PTZ00420 568 coronin; Provisional 99.89
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.88
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.88
KOG0296399 consensus Angio-associated migratory cell protein 99.88
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.88
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.88
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.88
KOG0289506 consensus mRNA splicing factor [General function p 99.87
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.87
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.87
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.87
KOG1539 910 consensus WD repeat protein [General function pred 99.87
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.87
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.87
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.87
KOG0289506 consensus mRNA splicing factor [General function p 99.87
KOG0643327 consensus Translation initiation factor 3, subunit 99.86
KOG0293519 consensus WD40 repeat-containing protein [Function 99.86
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.86
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.86
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.86
KOG4283397 consensus Transcription-coupled repair protein CSA 99.85
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.85
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.85
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.85
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.84
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.84
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.84
KOG0283712 consensus WD40 repeat-containing protein [Function 99.84
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.84
KOG0318 603 consensus WD40 repeat stress protein/actin interac 99.84
KOG4328498 consensus WD40 protein [Function unknown] 99.83
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.83
KOG0641350 consensus WD40 repeat protein [General function pr 99.83
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.83
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.83
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.82
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.82
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.82
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.82
KOG0646 476 consensus WD40 repeat protein [General function pr 99.81
KOG0300481 consensus WD40 repeat-containing protein [Function 99.81
KOG0643327 consensus Translation initiation factor 3, subunit 99.81
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.81
KOG0293519 consensus WD40 repeat-containing protein [Function 99.81
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.81
KOG0302440 consensus Ribosome Assembly protein [General funct 99.8
KOG0294362 consensus WD40 repeat-containing protein [Function 99.8
KOG0270463 consensus WD40 repeat-containing protein [Function 99.79
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.79
KOG0296399 consensus Angio-associated migratory cell protein 99.78
KOG0302440 consensus Ribosome Assembly protein [General funct 99.78
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.78
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.77
KOG2055514 consensus WD40 repeat protein [General function pr 99.77
KOG0267 825 consensus Microtubule severing protein katanin p80 99.77
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.77
KOG0639705 consensus Transducin-like enhancer of split protei 99.77
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.77
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.77
KOG1273405 consensus WD40 repeat protein [General function pr 99.77
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.76
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.76
KOG0641350 consensus WD40 repeat protein [General function pr 99.76
KOG0300481 consensus WD40 repeat-containing protein [Function 99.76
KOG0270463 consensus WD40 repeat-containing protein [Function 99.75
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.75
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.75
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.75
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.74
KOG0267 825 consensus Microtubule severing protein katanin p80 99.74
KOG1274 933 consensus WD40 repeat protein [General function pr 99.74
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.73
KOG2096420 consensus WD40 repeat protein [General function pr 99.73
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.73
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.73
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.73
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.72
KOG0639705 consensus Transducin-like enhancer of split protei 99.72
KOG0268433 consensus Sof1-like rRNA processing protein (conta 99.72
KOG1274 933 consensus WD40 repeat protein [General function pr 99.71
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.71
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.71
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.71
KOG0294362 consensus WD40 repeat-containing protein [Function 99.71
KOG2106626 consensus Uncharacterized conserved protein, conta 99.71
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.71
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.7
KOG2048 691 consensus WD40 repeat protein [General function pr 99.69
KOG1539 910 consensus WD repeat protein [General function pred 99.69
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.68
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.68
KOG4227 609 consensus WD40 repeat protein [General function pr 99.67
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.67
KOG2055514 consensus WD40 repeat protein [General function pr 99.66
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.66
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.66
KOG0649325 consensus WD40 repeat protein [General function pr 99.65
KOG1188376 consensus WD40 repeat protein [General function pr 99.65
KOG4283 397 consensus Transcription-coupled repair protein CSA 99.64
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.64
KOG4328498 consensus WD40 protein [Function unknown] 99.64
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.63
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.63
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.62
KOG2048 691 consensus WD40 repeat protein [General function pr 99.62
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.62
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.6
KOG0646 476 consensus WD40 repeat protein [General function pr 99.6
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.59
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.58
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.58
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.58
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.56
KOG1009 434 consensus Chromatin assembly complex 1 subunit B/C 99.56
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 99.56
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.56
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.55
COG2319 466 FOG: WD40 repeat [General function prediction only 99.55
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.55
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.54
KOG2096420 consensus WD40 repeat protein [General function pr 99.54
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.53
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.52
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.51
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.51
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.5
KOG2139445 consensus WD40 repeat protein [General function pr 99.48
COG2319466 FOG: WD40 repeat [General function prediction only 99.48
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.47
KOG1310 758 consensus WD40 repeat protein [General function pr 99.45
KOG2110391 consensus Uncharacterized conserved protein, conta 99.45
KOG1273 405 consensus WD40 repeat protein [General function pr 99.45
KOG1063 764 consensus RNA polymerase II elongator complex, sub 99.44
PRK11028330 6-phosphogluconolactonase; Provisional 99.43
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.43
KOG0771398 consensus Prolactin regulatory element-binding pro 99.42
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.41
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.41
PRK01742429 tolB translocation protein TolB; Provisional 99.39
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.39
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.39
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.39
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.38
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.38
KOG4227 609 consensus WD40 repeat protein [General function pr 99.35
KOG1009 434 consensus Chromatin assembly complex 1 subunit B/C 99.35
PRK11028330 6-phosphogluconolactonase; Provisional 99.35
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.34
PRK03629429 tolB translocation protein TolB; Provisional 99.32
PRK01742429 tolB translocation protein TolB; Provisional 99.31
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.29
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.29
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.28
KOG1334559 consensus WD40 repeat protein [General function pr 99.28
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.27
KOG0649325 consensus WD40 repeat protein [General function pr 99.26
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.26
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.25
KOG1310 758 consensus WD40 repeat protein [General function pr 99.25
PRK04922433 tolB translocation protein TolB; Provisional 99.24
KOG0771398 consensus Prolactin regulatory element-binding pro 99.23
KOG2111346 consensus Uncharacterized conserved protein, conta 99.23
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.23
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.22
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.21
KOG1188376 consensus WD40 repeat protein [General function pr 99.21
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 99.21
PRK05137435 tolB translocation protein TolB; Provisional 99.21
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.19
KOG2139 445 consensus WD40 repeat protein [General function pr 99.18
PRK02889427 tolB translocation protein TolB; Provisional 99.17
PRK05137435 tolB translocation protein TolB; Provisional 99.16
KOG1523 361 consensus Actin-related protein Arp2/3 complex, su 99.15
PRK02889427 tolB translocation protein TolB; Provisional 99.13
KOG1963 792 consensus WD40 repeat protein [General function pr 99.12
PRK04922433 tolB translocation protein TolB; Provisional 99.12
KOG1963 792 consensus WD40 repeat protein [General function pr 99.12
PRK03629429 tolB translocation protein TolB; Provisional 99.1
KOG2111346 consensus Uncharacterized conserved protein, conta 99.09
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.08
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.07
KOG4547 541 consensus WD40 repeat-containing protein [General 99.05
KOG2315 566 consensus Predicted translation initiation factor 99.05
PRK00178430 tolB translocation protein TolB; Provisional 99.0
PRK04792448 tolB translocation protein TolB; Provisional 99.0
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.99
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.98
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.98
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.95
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.94
KOG2321 703 consensus WD40 repeat protein [General function pr 98.94
KOG2321 703 consensus WD40 repeat protein [General function pr 98.93
KOG1272545 consensus WD40-repeat-containing subunit of the 18 98.92
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.91
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.87
KOG4497447 consensus Uncharacterized conserved protein WDR8, 98.86
PRK01029428 tolB translocation protein TolB; Provisional 98.84
PRK00178430 tolB translocation protein TolB; Provisional 98.84
KOG0280339 consensus Uncharacterized conserved protein [Amino 98.83
KOG4497 447 consensus Uncharacterized conserved protein WDR8, 98.82
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 98.79
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.79
PRK04792448 tolB translocation protein TolB; Provisional 98.75
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.74
KOG2041 1189 consensus WD40 repeat protein [General function pr 98.74
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 98.73
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.72
KOG4547 541 consensus WD40 repeat-containing protein [General 98.72
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 98.71
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 98.67
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.66
COG4946668 Uncharacterized protein related to the periplasmic 98.61
KOG1334559 consensus WD40 repeat protein [General function pr 98.6
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.56
PRK01029428 tolB translocation protein TolB; Provisional 98.55
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.54
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.51
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.43
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.42
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.4
KOG2695425 consensus WD40 repeat protein [General function pr 98.39
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.39
KOG1409404 consensus Uncharacterized conserved protein, conta 98.36
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.36
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.35
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.35
PRK04043419 tolB translocation protein TolB; Provisional 98.33
PRK04043419 tolB translocation protein TolB; Provisional 98.33
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.31
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 98.28
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.28
KOG2314698 consensus Translation initiation factor 3, subunit 98.27
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.27
KOG2695425 consensus WD40 repeat protein [General function pr 98.23
KOG2315 566 consensus Predicted translation initiation factor 98.22
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.2
COG4946 668 Uncharacterized protein related to the periplasmic 98.19
KOG41901034 consensus Uncharacterized conserved protein [Funct 98.18
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.13
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.11
KOG3914 390 consensus WD repeat protein WDR4 [Function unknown 98.1
KOG1409 404 consensus Uncharacterized conserved protein, conta 98.09
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.08
KOG1008 783 consensus Uncharacterized conserved protein, conta 98.08
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.07
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.06
KOG4532344 consensus WD40-like repeat containing protein [Gen 98.05
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.02
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.99
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 97.97
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 97.96
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.94
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 97.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.91
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.9
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.89
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.84
KOG2041 1189 consensus WD40 repeat protein [General function pr 97.83
KOG2314 698 consensus Translation initiation factor 3, subunit 97.82
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 97.8
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 97.79
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.75
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.73
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 97.71
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.66
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.64
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.64
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 97.63
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 97.61
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 97.47
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 97.38
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 97.38
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.37
KOG1912 1062 consensus WD40 repeat protein [General function pr 97.37
KOG4194873 consensus Membrane glycoprotein LIG-1 [Signal tran 97.27
KOG1008 783 consensus Uncharacterized conserved protein, conta 97.19
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 97.1
KOG1912 1062 consensus WD40 repeat protein [General function pr 97.08
KOG3621 726 consensus WD40 repeat-containing protein [General 96.98
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 96.98
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 96.96
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.95
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 96.95
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 96.95
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.94
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.91
PF04841 410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 96.89
PRK02888 635 nitrous-oxide reductase; Validated 96.87
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 96.85
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 96.81
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.8
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.8
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.79
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.78
COG3391381 Uncharacterized conserved protein [Function unknow 96.77
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 96.74
PRK02888 635 nitrous-oxide reductase; Validated 96.74
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 96.73
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 96.73
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 96.71
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.68
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.67
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.65
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.64
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.6
COG3391381 Uncharacterized conserved protein [Function unknow 96.56
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.56
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.53
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 96.45
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 96.45
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 96.41
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.41
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.37
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 96.31
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.3
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 96.28
KOG3621 726 consensus WD40 repeat-containing protein [General 96.17
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.12
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 96.11
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 95.99
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 95.99
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 95.81
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.7
COG3204316 Uncharacterized protein conserved in bacteria [Fun 95.69
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.64
KOG2395644 consensus Protein involved in vacuole import and d 95.58
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.55
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 95.52
PHA02713557 hypothetical protein; Provisional 95.42
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.33
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 95.28
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 95.28
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 95.22
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 94.91
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 94.83
PHA03098534 kelch-like protein; Provisional 94.73
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 94.65
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 94.58
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 94.42
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 94.34
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 94.32
KOG2395644 consensus Protein involved in vacuole import and d 94.21
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 94.04
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 93.96
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 93.9
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 93.64
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 93.56
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 93.43
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 93.42
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 93.38
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 93.34
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 93.08
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 92.99
PRK13616591 lipoprotein LpqB; Provisional 92.71
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 92.68
KOG2444238 consensus WD40 repeat protein [General function pr 92.53
PHA02790480 Kelch-like protein; Provisional 92.52
PF14727 418 PHTB1_N: PTHB1 N-terminus 92.37
KOG2444238 consensus WD40 repeat protein [General function pr 92.36
PLN03150623 hypothetical protein; Provisional 92.32
PLN032101153 Resistant to P. syringae 6; Provisional 92.2
PRK13616591 lipoprotein LpqB; Provisional 92.05
PLN032101153 Resistant to P. syringae 6; Provisional 92.02
PHA02713557 hypothetical protein; Provisional 92.02
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 91.94
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.7
COG3490366 Uncharacterized protein conserved in bacteria [Fun 91.57
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 91.14
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 91.04
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 90.62
smart0044626 LRRcap occurring C-terminal to leucine-rich repeat 90.5
KOG2982418 consensus Uncharacterized conserved protein [Funct 90.48
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 90.11
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 90.1
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 90.09
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 89.82
COG3490 366 Uncharacterized protein conserved in bacteria [Fun 89.78
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 89.27
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 89.26
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 89.02
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 88.95
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 88.82
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 88.71
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 88.56
KOG18971096 consensus Damage-specific DNA binding complex, sub 88.55
KOG06181081 consensus Serine/threonine phosphatase 2C containi 88.53
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 88.05
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 87.82
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 87.72
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 87.7
PF14727 418 PHTB1_N: PTHB1 N-terminus 87.63
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 87.59
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 87.12
COG3386307 Gluconolactonase [Carbohydrate transport and metab 87.1
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 87.09
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 87.08
PLN03150623 hypothetical protein; Provisional 86.87
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 85.95
PHA03098534 kelch-like protein; Provisional 85.53
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 84.86
KOG1259490 consensus Nischarin, modulator of integrin alpha5 84.57
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 84.53
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 84.47
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 84.45
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 84.12
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 84.03
KOG4237498 consensus Extracellular matrix protein slit, conta 83.6
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 83.55
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 83.49
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 83.33
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 83.16
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 83.1
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 82.76
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 82.52
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 82.18
COG5167776 VID27 Protein involved in vacuole import and degra 81.71
KOG1983 993 consensus Tomosyn and related SNARE-interacting pr 81.63
PRK10115 686 protease 2; Provisional 81.12
PHA02790480 Kelch-like protein; Provisional 81.03
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 80.54
KOG2982418 consensus Uncharacterized conserved protein [Funct 80.54
COG3204316 Uncharacterized protein conserved in bacteria [Fun 80.37
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 80.2
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 80.12
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
Probab=99.97  E-value=8.1e-31  Score=270.89  Aligned_cols=228  Identities=20%  Similarity=0.316  Sum_probs=197.4

Q ss_pred             CeEEEEEeCCCCCEEEEEECCCeEEEEECCCCeEEEEeecCCCCCCeEEEEEeeCCCCEEEEEeCCCeEEEEEcCCCCCc
Q 004969          455 RPRQFEYHPSISCLMVFGTLDGEIVVVNHENENIVSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHMPPS  534 (721)
Q Consensus       455 ~V~~lafsP~dg~~LasGs~DG~I~IWdl~tg~~i~~l~~~~H~~~V~sl~fsp~d~~~LaSgs~DGtVrIWDi~~~~~~  534 (721)
                      .|.|++|+| ++..||+|+.|.++|+||+.+..+..+.+  +|...|.+++|+ |++..|++|+.||+|++||.+++++.
T Consensus       117 ~Vl~~~fsp-~g~~l~tGsGD~TvR~WD~~TeTp~~t~K--gH~~WVlcvaws-PDgk~iASG~~dg~I~lwdpktg~~~  192 (480)
T KOG0271|consen  117 AVLSVQFSP-TGSRLVTGSGDTTVRLWDLDTETPLFTCK--GHKNWVLCVAWS-PDGKKIASGSKDGSIRLWDPKTGQQI  192 (480)
T ss_pred             cEEEEEecC-CCceEEecCCCceEEeeccCCCCcceeec--CCccEEEEEEEC-CCcchhhccccCCeEEEecCCCCCcc
Confidence            689999999 99999999999999999999999999988  999999999998 79999999999999999999998876


Q ss_pred             ccccccCcceeEeccCCCeEEEEEec-----CCCEEEEEeCCCcEEEEECCCCcEEEEEccccCCCeEEEEEcCCCCcEE
Q 004969          535 IRGMHYGAGTVTFDEFDQLTSVHVNS-----MDELFLASGYSKNIALYDINSGRRLQVFADMHKEHINVVKFSNHSPSIF  609 (721)
Q Consensus       535 ~~~~~~~~~~~~~~~~~~V~sv~~sp-----~~~~lls~g~Dg~IrlWDl~s~~~v~~l~~~h~~~V~sI~fsPdg~~lL  609 (721)
                      ...+.+        |...|++++|.|     ....+++++.||.|+|||+..++++..+.+ |..+|+|+.|.-+|  ++
T Consensus       193 g~~l~g--------H~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~~~~~~lsg-HT~~VTCvrwGG~g--li  261 (480)
T KOG0271|consen  193 GRALRG--------HKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGTCVRTLSG-HTASVTCVRWGGEG--LI  261 (480)
T ss_pred             cccccC--------cccceeEEeecccccCCCccceecccCCCCEEEEEccCceEEEEecc-CccceEEEEEcCCc--eE
Confidence            555544        445689999876     457899999999999999999999999997 99999999998766  99


Q ss_pred             EEEECCCcEEEEECCCCCc-------------------------------------------------------------
Q 004969          610 ATSSFDQDVKLWDLRQKPI-------------------------------------------------------------  628 (721)
Q Consensus       610 aSgs~DgtIrIWDlrs~~~-------------------------------------------------------------  628 (721)
                      ++||.|++|++|+...+.+                                                             
T Consensus       262 ySgS~DrtIkvw~a~dG~~~r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~~~~~~~~erlVS  341 (480)
T KOG0271|consen  262 YSGSQDRTIKVWRALDGKLCRELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYEAVLKDSGERLVS  341 (480)
T ss_pred             EecCCCceEEEEEccchhHHHhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHHHHHhhccCcceeEE
Confidence            9999999999999765321                                                             


Q ss_pred             ----------------eeEEEecCCCCeE-EEEEecCCCEEEEEeCCCcEEEEEcC-CC---cccccccCeEEEEECCCC
Q 004969          629 ----------------QPCYTASSSKGNV-MVCFSPDDHYLLGKGSGTSMFVQSLR-GD---PFRDFNMSILAAYTRPSS  687 (721)
Q Consensus       629 ----------------~~~~~~~~~~~~v-sl~fSpdg~~Lasgs~Dg~I~VWDl~-g~---~l~~~~~~V~~v~fsP~~  687 (721)
                                      +++....+|...+ .+.||||++|+++++-|.+|++|+-+ |+   .+++|-..|..++|+.++
T Consensus       342 gsDd~tlflW~p~~~kkpi~rmtgHq~lVn~V~fSPd~r~IASaSFDkSVkLW~g~tGk~lasfRGHv~~VYqvawsaDs  421 (480)
T KOG0271|consen  342 GSDDFTLFLWNPFKSKKPITRMTGHQALVNHVSFSPDGRYIASASFDKSVKLWDGRTGKFLASFRGHVAAVYQVAWSADS  421 (480)
T ss_pred             ecCCceEEEecccccccchhhhhchhhheeeEEECCCccEEEEeecccceeeeeCCCcchhhhhhhccceeEEEEeccCc
Confidence                            0111223455555 79999999999999999999999988 44   367788899999999999


Q ss_pred             CcccccccEEEEecCCC
Q 004969          688 KSEIVKVNLLASTDHCD  704 (721)
Q Consensus       688 ~~~~v~v~lLASgs~~~  704 (721)
                             .+|+|||...
T Consensus       422 -------RLlVS~SkDs  431 (480)
T KOG0271|consen  422 -------RLLVSGSKDS  431 (480)
T ss_pred             -------cEEEEcCCCc
Confidence                   9999999864



>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>smart00446 LRRcap occurring C-terminal to leucine-rich repeats Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query721
4e5z_B436 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 2e-07
4e54_B435 Damaged Dna Induced Uv-Damaged Dna-Binding Protein 2e-07
3ei4_B436 Structure Of The Hsddb1-Hsddb2 Complex Length = 436 2e-07
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 2e-05
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 2e-05
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 3e-05
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 9e-05
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 1e-04
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 1e-04
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 1e-04
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 6e-04
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 7e-04
2gnq_A336 Structure Of Wdr5 Length = 336 7e-04
2g9a_A311 Structural Basis For The Specific Recognition Of Me 7e-04
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 7e-04
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 7e-04
2h9l_A329 Wdr5delta23 Length = 329 7e-04
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 7e-04
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 7e-04
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 8e-04
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 8e-04
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 8e-04
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 8e-04
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 8e-04
2g99_A308 Structural Basis For The Specific Recognition Of Me 8e-04
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 8e-04
>pdb|4E5Z|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 436 Back     alignment and structure

Iteration: 1

Score = 54.3 bits (129), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 59/244 (24%), Positives = 100/244 (40%), Gaps = 20/244 (8%) Query: 421 TRSLCAAKVGSSAWPCLHT-LTVSGNHMGDENRSF--------RPRQFEYHPSISCLMVF 471 R+L K+G ++WP + L S H D R R +HP+ + Sbjct: 78 VRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAV 137 Query: 472 GTLDGXXXXXXXXXXXXXSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHM 531 G+ G ++I GA S+ GL + ++ A S G+ +L D + Sbjct: 138 GSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKG- 196 Query: 532 PPSIRGMHYGAGTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGRRLQVFADM 591 +I + + T+ S+ V++ + + N+ L +++ G+ L M Sbjct: 197 --NILRVFASSDTINI----WFCSLDVSASSRMVVTGDNVGNVILLNMD-GKELWNLR-M 248 Query: 592 HKEHINVVKFSNHSPSIFATSSFDQDVKLWDLRQKPIQPCYTASSSKGNVM--VCFSPDD 649 HK+ + V + AT+S DQ VK+WDLRQ + + S + + CFSPD Sbjct: 249 HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG 308 Query: 650 HYLL 653 LL Sbjct: 309 ARLL 312
>pdb|4E54|B Chain B, Damaged Dna Induced Uv-Damaged Dna-Binding Protein (Uv-Ddb) Dimerization And Its Roles In Chromatinized Dna Repair Length = 435 Back     alignment and structure
>pdb|3EI4|B Chain B, Structure Of The Hsddb1-Hsddb2 Complex Length = 436 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query721
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.98
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.97
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.97
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.97
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.97
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.97
2pm7_B297 Protein transport protein SEC13, protein transport 99.97
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.97
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.97
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.97
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.97
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.97
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.97
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.97
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.97
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.97
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.97
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.96
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.96
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.96
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.96
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.96
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.96
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.96
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.96
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.96
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.96
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.96
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.96
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.96
3jrp_A379 Fusion protein of protein transport protein SEC13 99.96
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.95
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.95
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.95
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.95
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.95
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.95
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.95
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.95
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.95
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.95
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.95
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.95
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.95
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.95
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.95
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.95
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.95
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.95
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.95
2pm7_B297 Protein transport protein SEC13, protein transport 99.95
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.94
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.94
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.94
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.94
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.94
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.94
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.94
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.94
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.94
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.94
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.94
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.94
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.94
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.94
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.94
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.94
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.93
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.93
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.93
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.93
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.93
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.93
3jro_A 753 Fusion protein of protein transport protein SEC13 99.93
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.93
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.93
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.93
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.93
3jrp_A379 Fusion protein of protein transport protein SEC13 99.93
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.93
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.93
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.93
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.93
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.93
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.93
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.93
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.92
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.92
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.92
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.92
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.92
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.92
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.92
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.92
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.92
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.92
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 99.91
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.91
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.91
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.91
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.91
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.91
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.91
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.91
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.9
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.9
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.9
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.9
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.9
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.9
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.9
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.9
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.9
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.9
3jro_A 753 Fusion protein of protein transport protein SEC13 99.89
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.89
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.89
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.89
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.89
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.88
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.88
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.86
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.86
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.85
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.83
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.81
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.78
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.77
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.75
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.75
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.73
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.72
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.71
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.71
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.71
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.7
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.7
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.69
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.69
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.69
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.67
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.66
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.66
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.66
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.66
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.65
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.65
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.64
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.63
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.63
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.62
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.61
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.61
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.6
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.55
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.54
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.53
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.52
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.52
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.52
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.5
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.49
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.48
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.44
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.42
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.41
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.4
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.4
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.37
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.37
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.35
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.32
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.31
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.3
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.3
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.29
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.29
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.28
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.25
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.21
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.21
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.19
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.19
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.18
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.18
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.17
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 99.15
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.13
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.12
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.12
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.11
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.1
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.06
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.05
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.05
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.03
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.03
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.02
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.01
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 98.99
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.98
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 98.94
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 98.92
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.92
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.89
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.87
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.82
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.81
2qe8_A343 Uncharacterized protein; structural genomics, join 98.76
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.72
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 98.71
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.7
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.7
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 98.63
2qe8_A343 Uncharacterized protein; structural genomics, join 98.63
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.62
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.58
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.56
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.56
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.54
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.48
2ece_A462 462AA long hypothetical selenium-binding protein; 98.43
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.43
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 98.42
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.37
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.36
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.32
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.31
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.3
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 98.3
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.28
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.26
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.25
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.25
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.24
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.24
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.24
2ece_A462 462AA long hypothetical selenium-binding protein; 98.16
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.16
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.16
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.14
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.13
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.09
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 98.09
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.09
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.05
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.01
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.99
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 97.98
3v65_B386 Low-density lipoprotein receptor-related protein; 97.97
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.97
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.95
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.93
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 97.92
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 97.91
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.88
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.87
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.87
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.86
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 97.86
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.83
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.82
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.82
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.81
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.79
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.76
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.75
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.74
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.72
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.71
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.71
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 97.7
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.7
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 97.69
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.69
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.68
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 97.68
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.67
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.67
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 97.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.65
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.65
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.64
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.63
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 97.63
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.63
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.62
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.61
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.61
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.61
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.6
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.59
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.57
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.57
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.56
4fmz_A347 Internalin; leucine rich repeat, structural genomi 97.54
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.54
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.54
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.53
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.52
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 97.51
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.5
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 97.5
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 97.5
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.49
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.48
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.48
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.47
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.46
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.45
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.45
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 97.41
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.4
3v65_B386 Low-density lipoprotein receptor-related protein; 97.39
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.38
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.37
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.37
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 97.35
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.34
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 97.34
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 97.34
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.33
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.32
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.32
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.32
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.32
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.31
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 97.31
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.3
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.3
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 97.3
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.28
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.27
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.27
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 97.25
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 97.25
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.25
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.23
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 97.22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.2
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 97.19
4a2l_A 795 BT_4663, two-component system sensor histidine kin 97.19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.16
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.15
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 97.13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.13
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.11
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 97.1
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.09
1o6v_A466 Internalin A; bacterial infection, extracellular r 97.09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 97.07
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.07
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 97.07
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.06
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.04
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 97.04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.01
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 97.01
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.0
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 96.99
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 96.99
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 96.99
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 96.98
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 96.93
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 96.93
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 96.93
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.92
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.89
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 96.87
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 96.86
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 96.85
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 96.84
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 96.84
3kya_A496 Putative phosphatase; structural genomics, joint c 96.83
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 96.83
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 96.82
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 96.82
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 96.81
1o6v_A466 Internalin A; bacterial infection, extracellular r 96.8
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.79
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 96.78
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.78
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 96.77
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.69
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 96.69
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 96.69
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 96.69
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 96.68
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 96.68
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.67
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 96.66
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 96.65
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 96.65
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 96.64
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 96.64
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 96.64
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.61
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 96.6
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 96.59
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 96.57
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.57
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 96.55
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 96.55
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.54
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 96.5
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.5
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.49
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 96.48
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 96.46
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 96.45
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 96.44
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 96.43
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 96.43
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 96.41
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.38
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 96.3
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 96.25
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 96.23
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 96.2
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.2
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.17
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 96.1
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 96.1
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 96.09
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.03
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 95.98
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 95.94
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 95.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 95.87
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 95.74
3kya_A 496 Putative phosphatase; structural genomics, joint c 95.71
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 95.7
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 95.58
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 95.43
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 95.42
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 95.38
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 95.26
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 95.24
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 95.2
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 95.18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 95.15
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 95.12
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 94.94
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 94.88
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 94.87
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 94.73
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 94.63
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 94.61
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 94.39
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 94.15
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 93.75
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 93.52
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 93.36
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 93.28
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 93.24
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 93.15
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 93.04
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 93.02
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 93.01
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 92.98
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 92.88
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 92.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 92.63
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 92.17
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 92.04
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 92.01
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 92.0
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 91.75
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 91.42
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 90.99
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 90.83
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 90.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 90.67
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 90.59
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 89.67
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 89.64
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 89.59
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 89.27
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 88.82
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 87.3
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 87.07
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 86.98
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 86.33
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 84.3
4fdw_A401 Leucine rich hypothetical protein; putative cell s 82.04
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 81.25
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 80.7
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
Probab=100.00  E-value=2.2e-30  Score=273.51  Aligned_cols=227  Identities=19%  Similarity=0.283  Sum_probs=193.8

Q ss_pred             CeEEEEEeCCCCCEEEEEECCCeEEEEECCCCeEEEEeecCCCCCCeEEEEEeeCCCCEEEEEeCCCeEEEEEcCCCCCc
Q 004969          455 RPRQFEYHPSISCLMVFGTLDGEIVVVNHENENIVSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHMPPS  534 (721)
Q Consensus       455 ~V~~lafsP~dg~~LasGs~DG~I~IWdl~tg~~i~~l~~~~H~~~V~sl~fsp~d~~~LaSgs~DGtVrIWDi~~~~~~  534 (721)
                      .|++++|+| ++.++++|+.||+|++||+.++..+..+.  +|..+|.+++|+ +++++|++|+.|++|++||+.+++..
T Consensus        15 ~V~~~~fsp-~~~~l~s~~~dg~v~lWd~~~~~~~~~~~--~~~~~v~~~~~~-~~~~~l~s~s~d~~i~vwd~~~~~~~   90 (304)
T 2ynn_A           15 RVKGIDFHP-TEPWVLTTLYSGRVELWNYETQVEVRSIQ--VTETPVRAGKFI-ARKNWIIVGSDDFRIRVFNYNTGEKV   90 (304)
T ss_dssp             CEEEEEECS-SSSEEEEEETTSEEEEEETTTTEEEEEEE--CCSSCEEEEEEE-GGGTEEEEEETTSEEEEEETTTCCEE
T ss_pred             ceEEEEECC-CCCEEEEEcCCCcEEEEECCCCceeEEee--ccCCcEEEEEEe-CCCCEEEEECCCCEEEEEECCCCcEE
Confidence            599999999 99999999999999999999999998887  788999999998 78899999999999999999986541


Q ss_pred             ccccccCcceeEeccCCCeEEEEEecCCCEEEEEeCCCcEEEEECCCCc-EEEEEccccCCCeEEEEEcCCCCcEEEEEE
Q 004969          535 IRGMHYGAGTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYDINSGR-RLQVFADMHKEHINVVKFSNHSPSIFATSS  613 (721)
Q Consensus       535 ~~~~~~~~~~~~~~~~~~V~sv~~sp~~~~lls~g~Dg~IrlWDl~s~~-~v~~l~~~h~~~V~sI~fsPdg~~lLaSgs  613 (721)
                               .....|...|.+++|+|++..+++++.|++|++||++++. ....+.+ |...|.+++|+|.++.++++|+
T Consensus        91 ---------~~~~~h~~~v~~~~~~~~~~~l~sgs~D~~v~lWd~~~~~~~~~~~~~-h~~~v~~v~~~p~~~~~l~sgs  160 (304)
T 2ynn_A           91 ---------VDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEG-HEHFVMCVAFNPKDPSTFASGC  160 (304)
T ss_dssp             ---------EEEECCSSCEEEEEECSSSSEEEEEETTSCEEEEEGGGTTEEEEEECC-CCSCEEEEEECTTCTTEEEEEE
T ss_pred             ---------EEEeCCCCcEEEEEEcCCCCEEEEECCCCeEEEEECCCCcchhhhhcc-cCCcEEEEEECCCCCCEEEEEe
Confidence                     1122466789999999999999999999999999999874 4566766 9999999999996558999999


Q ss_pred             CCCcEEEEECCCCCceeEEEecCCCCeE-EEEEec--CCCEEEEEeCCCcEEEEEcCCC----cccccccCeEEEEECCC
Q 004969          614 FDQDVKLWDLRQKPIQPCYTASSSKGNV-MVCFSP--DDHYLLGKGSGTSMFVQSLRGD----PFRDFNMSILAAYTRPS  686 (721)
Q Consensus       614 ~DgtIrIWDlrs~~~~~~~~~~~~~~~v-sl~fSp--dg~~Lasgs~Dg~I~VWDl~g~----~l~~~~~~V~~v~fsP~  686 (721)
                      .|++|++||+++........ .++...+ .+.|+|  ++.+|++|+.|+.|++||++..    .+.+|...|..++|+|+
T Consensus       161 ~D~~v~iwd~~~~~~~~~~~-~~~~~~v~~~~~~~~~~~~~l~s~s~D~~i~iWd~~~~~~~~~~~~h~~~v~~~~~~p~  239 (304)
T 2ynn_A          161 LDRTVKVWSLGQSTPNFTLT-TGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPT  239 (304)
T ss_dssp             TTSEEEEEETTCSSCSEEEE-CCCTTCEEEEEECCSTTCCEEEEEETTSEEEEEETTTTEEEEEEECCSSCEEEEEECSS
T ss_pred             CCCeEEEEECCCCCccceec-cCCcCcEEEEEEEEcCCCCEEEEEcCCCeEEEEeCCCCccceeeCCCCCCEEEEEECCC
Confidence            99999999998875433332 3343444 788876  7889999999999999999843    35667789999999999


Q ss_pred             CCcccccccEEEEecCC
Q 004969          687 SKSEIVKVNLLASTDHC  703 (721)
Q Consensus       687 ~~~~~v~v~lLASgs~~  703 (721)
                      +       ++|++|+..
T Consensus       240 ~-------~~l~s~s~D  249 (304)
T 2ynn_A          240 L-------PIIISGSED  249 (304)
T ss_dssp             S-------SEEEEEETT
T ss_pred             C-------CEEEEEcCC
Confidence            9       899999876



>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 721
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 5e-12
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-10
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-05
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 4e-04
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-08
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 9e-07
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-06
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 4e-06
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-05
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 8e-06
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-04
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 2e-04
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 2e-04
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-04
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-04
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 4e-04
d1ri6a_ 333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 7e-04
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 7e-04
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.001
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.002
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Tup1, C-terminal domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 66.0 bits (159), Expect = 5e-12
 Identities = 43/232 (18%), Positives = 83/232 (35%), Gaps = 15/232 (6%)

Query: 407 HKTSYPSGMSQYFYTRSLCAAKVGSSAWPCLHTLTVSGNHMGDENRSFRPRQFEYHPSIS 466
               +   +    Y  S      GS           +G      +           P   
Sbjct: 158 ILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDG 217

Query: 467 CLMVFGTLDGEIVVVNHENENIVSYIPS-----FGAMNSVLGLCWLKKYPSKLIAGSDNG 521
             +  G+LD  + V + E   +V  + S      G  +SV  + + +     +++GS + 
Sbjct: 218 KYIAAGSLDRAVRVWDSETGFLVERLDSENESGTGHKDSVYSVVFTRD-GQSVVSGSLDR 276

Query: 522 SLKLYDIRHMPPSIRGMHYGAGTVTFDEF---DQLTSVHVNSMDELFLASGYSKNIALYD 578
           S+KL+++++           +GT         D + SV     DE  L+    + +  +D
Sbjct: 277 SVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWD 336

Query: 579 INSGRRLQVFADMHKEHINVVKFSNHSP-----SIFATSSFDQDVKLWDLRQ 625
             SG  L +    H+  +  V  +N S      ++FAT S D   ++W  ++
Sbjct: 337 KKSGNPLLMLQG-HRNSVISVAVANGSSLGPEYNVFATGSGDCKARIWKYKK 387


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query721
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.97
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.96
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.96
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.95
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.95
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.94
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.94
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.93
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.93
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.93
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.92
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.91
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.9
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.9
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.9
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.89
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.89
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.88
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.86
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.84
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.83
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.82
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.8
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.78
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.78
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.76
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.73
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.69
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.65
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.64
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.64
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.62
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.59
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.57
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.56
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.56
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.43
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.32
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.23
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.23
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.23
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.17
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.14
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.83
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.81
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.74
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.72
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.67
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.64
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.64
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.59
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.59
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 98.54
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.5
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.5
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.47
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.38
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.31
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.21
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.2
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.14
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.14
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.13
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.03
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.02
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 97.98
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.97
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.86
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.83
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 97.67
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.59
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.53
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.51
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.51
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.51
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.45
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.42
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.39
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.3
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.25
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.23
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.22
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.22
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.12
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.12
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.06
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.96
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 96.96
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 96.86
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 96.43
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 96.38
d1p9ag_266 von Willebrand factor binding domain of glycoprote 96.35
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.16
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 96.08
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.05
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 95.96
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 95.96
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.85
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 95.83
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.75
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 95.74
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 95.68
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.58
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 95.45
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 95.37
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 95.32
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 95.3
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 95.24
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 95.22
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.21
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 95.12
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 94.97
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 94.81
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 94.52
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 94.4
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 94.36
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 94.15
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 94.05
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 93.86
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 93.13
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 92.94
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.59
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 92.41
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 92.21
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 91.76
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 91.46
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 90.89
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 90.56
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 87.27
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 86.89
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 85.11
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 83.01
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 81.0
d1qfma1 430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 80.83
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 80.37
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.97  E-value=1.3e-28  Score=254.64  Aligned_cols=236  Identities=19%  Similarity=0.232  Sum_probs=198.2

Q ss_pred             CeEEEEEeCCCCCEEEEEECCCeEEEEECCCCeEEEEeecCCCCCCeEEEEEeeCCCCEEEEEeCCCeEEEEEcCCCCCc
Q 004969          455 RPRQFEYHPSISCLMVFGTLDGEIVVVNHENENIVSYIPSFGAMNSVLGLCWLKKYPSKLIAGSDNGSLKLYDIRHMPPS  534 (721)
Q Consensus       455 ~V~~lafsP~dg~~LasGs~DG~I~IWdl~tg~~i~~l~~~~H~~~V~sl~fsp~d~~~LaSgs~DGtVrIWDi~~~~~~  534 (721)
                      .|++++|+| ++.+||+|+.||+|+|||+.+++.+..+.  +|..+|.+++|+ +++.++++|+.|+.+++|+.......
T Consensus        57 ~I~~l~~s~-~~~~l~sgs~Dg~v~iWd~~~~~~~~~~~--~~~~~v~~v~~~-~~~~~l~~~~~d~~i~~~~~~~~~~~  132 (340)
T d1tbga_          57 KIYAMHWGT-DSRLLVSASQDGKLIIWDSYTTNKVHAIP--LRSSWVMTCAYA-PSGNYVACGGLDNICSIYNLKTREGN  132 (340)
T ss_dssp             CEEEEEECT-TSSEEEEEETTTEEEEEETTTTEEEEEEE--CSCSCEEEEEEC-TTSSEEEEEETTCCEEEEESSSSCSC
T ss_pred             CEEEEEECC-CCCEEEEEECCCceeeeecccceeEEEEe--cccccEEeeEee-ccceeeeeecccceeecccccccccc
Confidence            599999999 99999999999999999999999999887  789999999998 78999999999999999998764431


Q ss_pred             ccc---cccCc---------------------------------ceeEeccCCCeEEEEEecCCCEEEEEeCCCcEEEEE
Q 004969          535 IRG---MHYGA---------------------------------GTVTFDEFDQLTSVHVNSMDELFLASGYSKNIALYD  578 (721)
Q Consensus       535 ~~~---~~~~~---------------------------------~~~~~~~~~~V~sv~~sp~~~~lls~g~Dg~IrlWD  578 (721)
                      ...   +.++.                                 ......+...+....+.+.+..+++++.|+.|++||
T Consensus       133 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~v~i~d  212 (340)
T d1tbga_         133 VRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWD  212 (340)
T ss_dssp             CCEEEEECCCSSCEEEEEEEETTEEEEEETTTEEEEEETTTTEEEEEEECCSSCEEEEEECTTSSEEEEEETTTEEEEEE
T ss_pred             cccceecccccccccccccccccccccccccccccccccccccccccccccceeEeeeccccccceeEEeecCceEEEEE
Confidence            110   00000                                 011112345578888888899999999999999999


Q ss_pred             CCCCcEEEEEccccCCCeEEEEEcCCCCcEEEEEECCCcEEEEECCCCCceeEEEecCCCCeE-EEEEecCCCEEEEEeC
Q 004969          579 INSGRRLQVFADMHKEHINVVKFSNHSPSIFATSSFDQDVKLWDLRQKPIQPCYTASSSKGNV-MVCFSPDDHYLLGKGS  657 (721)
Q Consensus       579 l~s~~~v~~l~~~h~~~V~sI~fsPdg~~lLaSgs~DgtIrIWDlrs~~~~~~~~~~~~~~~v-sl~fSpdg~~Lasgs~  657 (721)
                      +++++.+..+.+ |...|++++|+|++ .++++|+.||.|++||++.......+....+...+ +++|+|+|++|++|+.
T Consensus       213 ~~~~~~~~~~~~-h~~~i~~v~~~p~~-~~l~s~s~d~~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~s~~~~~l~~g~~  290 (340)
T d1tbga_         213 VREGMCRQTFTG-HESDINAICFFPNG-NAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYD  290 (340)
T ss_dssp             TTTTEEEEEECC-CSSCEEEEEECTTS-SEEEEEETTSCEEEEETTTTEEEEEECCTTCCSCEEEEEECSSSCEEEEEET
T ss_pred             CCCCcEEEEEeC-CCCCeEEEEECCCC-CEEEEEeCCCeEEEEeecccccccccccccccCceEEEEECCCCCEEEEEEC
Confidence            999999999997 99999999999999 79999999999999999987654445445555555 8999999999999999


Q ss_pred             CCcEEEEEcC-CCc---ccccccCeEEEEECCCCCcccccccEEEEecCC
Q 004969          658 GTSMFVQSLR-GDP---FRDFNMSILAAYTRPSSKSEIVKVNLLASTDHC  703 (721)
Q Consensus       658 Dg~I~VWDl~-g~~---l~~~~~~V~~v~fsP~~~~~~v~v~lLASgs~~  703 (721)
                      ||.|++||+. +..   +..|...|.+++|+|++       ++|||||..
T Consensus       291 dg~i~iwd~~~~~~~~~~~~H~~~V~~l~~s~d~-------~~l~s~s~D  333 (340)
T d1tbga_         291 DFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDG-------MAVATGSWD  333 (340)
T ss_dssp             TSCEEEEETTTCCEEEEECCCSSCEEEEEECTTS-------SCEEEEETT
T ss_pred             CCEEEEEECCCCcEEEEEcCCCCCEEEEEEeCCC-------CEEEEEccC
Confidence            9999999987 333   55678899999999999       899999875



>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure