Citrus Sinensis ID: 005265


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-----
MATQRSVKQIVGDLAFLDSSPFAKLLDSCLRSKSVSDTRRVHARIIKSQFASEIFIQNRLIDVYAKCGCLYGARKVFDKMSNKNVFTWNSIITGLLKWGFIDDASRLFASMPERDQCSWNSMVSGFAQHDRFSEALGYFVKMHSENFALSEYSFGSALSACAGSVDFKMGTQVHALLSKSRYSSDVYMGSALIDMYGKCGRVSCARRVFDGMRERNIVSWNSLITCYEQNGPASDALEVFVRMMASGIEPDEVTLASVVSACASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKCGKLNEARCVFDRMPIRNVVSETSMVSGYAKASSVKSARLMFTKMLERNVVSWNALIAGYTQNGENEEALGLFRLLKRESVCPTHYTFGNLLNACANLADLQLGRQAHTHVVKHGLRFLSGEESDIFVGNSLIDMYMKCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALGLFKKMLLCGEKPDHVTMIGVLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLLGRAGCLDEAKTLIEAMPMQPDAVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYVLLSNMYAELGRWGEVVRVRKLMRKRGVVKQPGCSWIEILGHVNVFMVKDKRHPLNKEIYLVLKMLTREMKRVGYVPNASDDEAYEEQNGSNSTSDCQIDFQVETAIA
cccHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccccccEEHHHHHHHHHccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccccccEEEEHHHHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHHHHHHHHcHHcccccccccHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHHHHcccc
cHHHHHHHHHHHcccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccEEEEEccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccc
MATQRSVKQIVGdlafldsspfAKLLDSClrsksvsdTRRVHARIIKSQFASEIFIQNRLIDVYAKCGCLYGARKVFDKMSNKNVFTWNSIITGLLkwgfiddasrlfasmperdqcswnsmvsGFAQHDRFSEALGYFVKMHsenfalseysfgsalsacagsvdfkmGTQVHALLSKSRYSSDVYMGSALIDMYgkcgrvscarrvfdgmrerNIVSWNSLITCyeqngpasdALEVFVRMMasgiepdeVTLASVVSACASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKcgklnearcvfdrmpirnvvsetsmvsgyakasSVKSARLMFTKMLERNVVSWNALIAGYTQNGENEEALGLFRLlkresvcpthytFGNLLNACANLADLQLGRQAHTHVVKHglrflsgeesdifVGNSLIDMYMKCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALGLFKKMllcgekpdhVTMIGVLCACSHAGLVEEGRKYFSSMskehglaplkdhYTCMVDLlgragcldEAKTLIEAMPMQPDAVIWGSLLAACKVHRNIMLGEYVAKKLleiepsnsgpyvLLSNMYAELGRWGEVVRVRKLMRkrgvvkqpgcswieilgHVNVFMvkdkrhplnKEIYLVLKMLTREMKrvgyvpnasddeayeeqngsnstsdcqIDFQVETAIA
matqrsvkqivgdlafldsspFAKLLDSCLrsksvsdtrrVHARiiksqfaseifiQNRLIDVYAKCGCLYGARKVFDKMSNKNVFTWNSIITGLLKWGFIDDASRLFASMPERDQCSWNSMVSGFAQHDRFSEALGYFVKMHSENFALSEYSFGSALSACAGSVDFKMGTQVHALLSKSRYSSDVYMGSALIDMYGKCGRVSCARRVFDGMRERNIVSWNSLITCYEQNGPASDALEVFVRMMASGIEPDEVTLASVVSACASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKCGKLNEARCVFDRMPIRnvvsetsmvsgyakassvKSARLMFTKMLERNVVSWNALIAGYTQNGENEEALGLFRLLKRESVCPTHYTFGNLLNACANLADLQLGRQAHTHVVKHGLRFLSGEESDIFVGNSLIDMYMKCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALGLFKKMLLCGEKPDHVTMIGVLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLLGRAGCLDEAKTLIEAMPMQPDAVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYVLLSNMYAELGRWGEVVRVRKLMrkrgvvkqpgcswieilGHVNVFmvkdkrhplnKEIYLVLKMLTREMKRVGYVPNASDDEAYEeqngsnstsdcqIDFQVETAIA
MATQRSVKQIVGDLAFLDSSPFAKLLDSCLRSKSVSDTRRVHARIIKSQFASEIFIQNRLIDVYAKCGCLYGARKVFDKMSNKNVFTWNSIITGLLKWGFIDDASRLFASMPERDQCSWNSMVSGFAQHDRFSEALGYFVKMHSENFALSEYSFGSALSACAGSVDFKMGTQVHALLSKSRYSSDVYMGSALIDMYGKCGRVSCARRVFDGMRERNIVSWNSLITCYEQNGPASDALEVFVRMMASGIEPDEVTlasvvsacaslaaFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKCGKLNEARCVFDRMPIRNVVSETSMVSGYAKASSVKSARLMFTKMLERNVVSWNALIAGYTQNGENEEALGLFRLLKRESVCPTHYTFGnllnacanladlqlGRQAHTHVVKHGLRFLSGEESDIFVGNSLIDMYMKCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALGLFKKMLLCGEKPDHVTMIGVLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLLGRAGCLDEAKTLIEAMPMQPDAVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYVLLSNMYAELGRWGEVVRVRKLMRKRGVVKQPGCSWIEILGHVNVFMVKDKRHPLNKEIYLVLKMLTREMKRVGYVPNASDDEAYEEQNGSNSTSDCQIDFQVETAIA
********QIVGDLAFLDSSPFAKLLDSCLRSKSVSDTRRVHARIIKSQFASEIFIQNRLIDVYAKCGCLYGARKVFDKMSNKNVFTWNSIITGLLKWGFIDDASRLFASMPERDQCSWNSMVSGFAQHDRFSEALGYFVKMHSENFALSEYSFGSALSACAGSVDFKMGTQVHALLSKSRYSSDVYMGSALIDMYGKCGRVSCARRVFDGMRERNIVSWNSLITCYEQNGPASDALEVFVRMMASGIEPDEVTLASVVSACASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKCGKLNEARCVFDRMPIRNVVSETSMVSGYAKASSVKSARLMFTKMLERNVVSWNALIAGYTQNGENEEALGLFRLLKRESVCPTHYTFGNLLNACANLADLQLGRQAHTHVVKHGLRFLSGEESDIFVGNSLIDMYMKCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALGLFKKMLLCGEKPDHVTMIGVLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLLGRAGCLDEAKTLIEAMPMQPDAVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYVLLSNMYAELGRWGEVVRVRKLMRKRGVVKQPGCSWIEILGHVNVFMVKDKRHPLNKEIYLVLKMLTREMKRVGYV********************************
MATQRSVKQIVGDLAFLDSSPFAKLLDSCLRSKSVSDTRRVHARIIKSQFASEIFIQNRLIDVYAKCGCLYGARKVFDKMSNKNVFTWNSIITGLLKWGFIDDASRLFASMPERDQCSWNSMVSGFAQHDRFSEALGYFVKMHSENFALSEYSFGSALSACAGSVDFKMGTQVHALLSKSRYSSDVYMGSALIDMYGKCGRVSCARRVFDGMRERNIVSWNSLITCYEQNGPASDALEVFVRMMASGIEPDEVTLASVVSACASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKCGKLNEARCVFDRMPIRNVVSETSMVSGYAKASSVKSARLMFTKMLERNVVSWNALIAGYTQNGENEEALGLFRLLKRESVCPTHYTFGNLLNACANLADLQLGRQAHTHVVKHGLRFLSGEESDIFVGNSLIDMYMKCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALGLFKKMLLCGEKPDHVTMIGVLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLLGRAGCLDEAKTLIEAMPMQPDAVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYVLLSNMYAELGRWGEVVRVRKLMRKRGVVKQPGCSWIEILGHVNVFMVKDKRHPLNKEIYLVLKMLTREMKRVGYVPNASDDEAYEEQNGSNSTSDCQIDFQVETAIA
********QIVGDLAFLDSSPFAKLLDSCLRSKSVSDTRRVHARIIKSQFASEIFIQNRLIDVYAKCGCLYGARKVFDKMSNKNVFTWNSIITGLLKWGFIDDASRLFASMPERDQCSWNSMVSGFAQHDRFSEALGYFVKMHSENFALSEYSFGSALSACAGSVDFKMGTQVHALLSKSRYSSDVYMGSALIDMYGKCGRVSCARRVFDGMRERNIVSWNSLITCYEQNGPASDALEVFVRMMASGIEPDEVTLASVVSACASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKCGKLNEARCVFDRMPIRNVVSETSMVSGYAKASSVKSARLMFTKMLERNVVSWNALIAGYTQNGENEEALGLFRLLKRESVCPTHYTFGNLLNACANLADLQLGRQAHTHVVKHGLRFLSGEESDIFVGNSLIDMYMKCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALGLFKKMLLCGEKPDHVTMIGVLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLLGRAGCLDEAKTLIEAMPMQPDAVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYVLLSNMYAELGRWGEVVRVRKLMRKRGVVKQPGCSWIEILGHVNVFMVKDKRHPLNKEIYLVLKMLTREMKRVGYVPNASDD*************DCQIDFQVETAIA
MATQRSVKQIVGDLAFLDSSPFAKLLDSCLRSKSVSDTRRVHARIIKSQFASEIFIQNRLIDVYAKCGCLYGARKVFDKMSNKNVFTWNSIITGLLKWGFIDDASRLFASMPERDQCSWNSMVSGFAQHDRFSEALGYFVKMHSENFALSEYSFGSALSACAGSVDFKMGTQVHALLSKSRYSSDVYMGSALIDMYGKCGRVSCARRVFDGMRERNIVSWNSLITCYEQNGPASDALEVFVRMMASGIEPDEVTLASVVSACASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKCGKLNEARCVFDRMPIRNVVSETSMVSGYAKASSVKSARLMFTKMLERNVVSWNALIAGYTQNGENEEALGLFRLLKRESVCPTHYTFGNLLNACANLADLQLGRQAHTHVVKHGLRFLSGEESDIFVGNSLIDMYMKCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALGLFKKMLLCGEKPDHVTMIGVLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLLGRAGCLDEAKTLIEAMPMQPDAVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYVLLSNMYAELGRWGEVVRVRKLMRKRGVVKQPGCSWIEILGHVNVFMVKDKRHPLNKEIYLVLKMLTREMKRVGYVPNASDDEAYEEQNGSNSTSDCQIDFQVETAIA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATQRSVKQIVGDLAFLDSSPFAKLLDSCLRSKSVSDTRRVHARIIKSQFASEIFIQNRLIDVYAKCGCLYGARKVFDKMSNKNVFTWNSIITGLLKWGFIDDASRLFASMPERDQCSWNSMVSGFAQHDRFSEALGYFVKMHSENFALSEYSFGSALSACAGSVDFKMGTQVHALLSKSRYSSDVYMGSALIDMYGKCGRVSCARRVFDGMRERNIVSWNSLITCYEQNGPASDALEVFVRMMASGIEPDEVTLASVVSACASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKCGKLNEARCVFDRMPIRNVVSETSMVSGYAKASSVKSARLMFTKMLERNVVSWNALIAGYTQNGENEEALGLFRLLKRESVCPTHYTFGNLLNACANLADLQLGRQAHTHVVKHGLRFLSGEESDIFVGNSLIDMYMKCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALGLFKKMLLCGEKPDHVTMIGVLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLLGRAGCLDEAKTLIEAMPMQPDAVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYVLLSNMYAELGRWGEVVRVRKLMRKRGVVKQPGCSWIEILGHVNVFMVKDKRHPLNKEIYLVLKMLTREMKRVGYVPNASDDEAYEEQNGSNSTSDCQIDFQVETAIA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query705 2.2.26 [Sep-21-2011]
Q9SIT7697 Pentatricopeptide repeat- yes no 0.946 0.956 0.698 0.0
Q9FRI5790 Pentatricopeptide repeat- no no 0.907 0.810 0.388 1e-137
Q9SHZ8786 Pentatricopeptide repeat- no no 0.920 0.825 0.376 1e-135
Q9SY02781 Pentatricopeptide repeat- no no 0.885 0.798 0.388 1e-127
Q9FWA6903 Pentatricopeptide repeat- no no 0.856 0.668 0.370 1e-123
O82380738 Pentatricopeptide repeat- no no 0.882 0.842 0.359 1e-122
Q9SVP71064 Pentatricopeptide repeat- no no 0.835 0.553 0.357 1e-121
Q9LUJ2842 Pentatricopeptide repeat- no no 0.875 0.732 0.369 1e-120
Q9LFI1768 Pentatricopeptide repeat- no no 0.824 0.756 0.374 1e-120
P93005727 Pentatricopeptide repeat- no no 0.880 0.854 0.357 1e-119
>sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protein At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=3 SV=1 Back     alignment and function desciption
 Score =  993 bits (2567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/670 (69%), Positives = 558/670 (83%), Gaps = 3/670 (0%)

Query: 1   MATQRSVKQIVGDLA-FLDSSPFAKLLDSCLRSK-SVSDTRRVHARIIKSQFASEIFIQN 58
           MAT +S  ++  DL+ F DSSPFAKLLDSC++SK S    R VHA +IKS F++EIFIQN
Sbjct: 1   MAT-KSFLKLAADLSSFTDSSPFAKLLDSCIKSKLSAIYVRYVHASVIKSGFSNEIFIQN 59

Query: 59  RLIDVYAKCGCLYGARKVFDKMSNKNVFTWNSIITGLLKWGFIDDASRLFASMPERDQCS 118
           RLID Y+KCG L   R+VFDKM  +N++TWNS++TGL K GF+D+A  LF SMPERDQC+
Sbjct: 60  RLIDAYSKCGSLEDGRQVFDKMPQRNIYTWNSVVTGLTKLGFLDEADSLFRSMPERDQCT 119

Query: 119 WNSMVSGFAQHDRFSEALGYFVKMHSENFALSEYSFGSALSACAGSVDFKMGTQVHALLS 178
           WNSMVSGFAQHDR  EAL YF  MH E F L+EYSF S LSAC+G  D   G QVH+L++
Sbjct: 120 WNSMVSGFAQHDRCEEALCYFAMMHKEGFVLNEYSFASVLSACSGLNDMNKGVQVHSLIA 179

Query: 179 KSRYSSDVYMGSALIDMYGKCGRVSCARRVFDGMRERNIVSWNSLITCYEQNGPASDALE 238
           KS + SDVY+GSAL+DMY KCG V+ A+RVFD M +RN+VSWNSLITC+EQNGPA +AL+
Sbjct: 180 KSPFLSDVYIGSALVDMYSKCGNVNDAQRVFDEMGDRNVVSWNSLITCFEQNGPAVEALD 239

Query: 239 VFVRMMASGIEPDEVTLASVVSACASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMY 298
           VF  M+ S +EPDEVTLASV+SACASL+A K G ++H R+++ +KLRND++L NA VDMY
Sbjct: 240 VFQMMLESRVEPDEVTLASVISACASLSAIKVGQEVHGRVVKNDKLRNDIILSNAFVDMY 299

Query: 299 AKCGKLNEARCVFDRMPIRNVVSETSMVSGYAKASSVKSARLMFTKMLERNVVSWNALIA 358
           AKC ++ EAR +FD MPIRNV++ETSM+SGYA A+S K+ARLMFTKM ERNVVSWNALIA
Sbjct: 300 AKCSRIKEARFIFDSMPIRNVIAETSMISGYAMAASTKAARLMFTKMAERNVVSWNALIA 359

Query: 359 GYTQNGENEEALGLFRLLKRESVCPTHYTFGNLLNACANLADLQLGRQAHTHVVKHGLRF 418
           GYTQNGENEEAL LF LLKRESVCPTHY+F N+L ACA+LA+L LG QAH HV+KHG +F
Sbjct: 360 GYTQNGENEEALSLFCLLKRESVCPTHYSFANILKACADLAELHLGMQAHVHVLKHGFKF 419

Query: 419 LSGEESDIFVGNSLIDMYMKCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALG 478
            SGEE DIFVGNSLIDMY+KCG VE+G  +F  M+ERD VSWNAMI+G AQNGYG EAL 
Sbjct: 420 QSGEEDDIFVGNSLIDMYVKCGCVEEGYLVFRKMMERDCVSWNAMIIGFAQNGYGNEALE 479

Query: 479 LFKKMLLCGEKPDHVTMIGVLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLL 538
           LF++ML  GEKPDH+TMIGVL AC HAG VEEGR YFSSM+++ G+APL+DHYTCMVDLL
Sbjct: 480 LFREMLESGEKPDHITMIGVLSACGHAGFVEEGRHYFSSMTRDFGVAPLRDHYTCMVDLL 539

Query: 539 GRAGCLDEAKTLIEAMPMQPDAVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYV 598
           GRAG L+EAK++IE MPMQPD+VIWGSLLAACKVHRNI LG+YVA+KLLE+EPSNSGPYV
Sbjct: 540 GRAGFLEEAKSMIEEMPMQPDSVIWGSLLAACKVHRNITLGKYVAEKLLEVEPSNSGPYV 599

Query: 599 LLSNMYAELGRWGEVVRVRKLMRKRGVVKQPGCSWIEILGHVNVFMVKDKRHPLNKEIYL 658
           LLSNMYAELG+W +V+ VRK MRK GV KQPGCSWI+I GH +VFMVKDK HP  K+I+ 
Sbjct: 600 LLSNMYAELGKWEDVMNVRKSMRKEGVTKQPGCSWIKIQGHDHVFMVKDKSHPRKKQIHS 659

Query: 659 VLKMLTREMK 668
           +L +L  EM+
Sbjct: 660 LLDILIAEMR 669





Arabidopsis thaliana (taxid: 3702)
>sp|Q9FRI5|PPR57_ARATH Pentatricopeptide repeat-containing protein At1g25360 OS=Arabidopsis thaliana GN=PCMP-H74 PE=2 SV=1 Back     alignment and function description
>sp|Q9SHZ8|PP168_ARATH Pentatricopeptide repeat-containing protein At2g22070 OS=Arabidopsis thaliana GN=PCMP-H41 PE=3 SV=1 Back     alignment and function description
>sp|Q9SY02|PP301_ARATH Pentatricopeptide repeat-containing protein At4g02750 OS=Arabidopsis thaliana GN=PCMP-H24 PE=3 SV=1 Back     alignment and function description
>sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protein At3g02330 OS=Arabidopsis thaliana GN=PCMP-E90 PE=2 SV=2 Back     alignment and function description
>sp|O82380|PP175_ARATH Pentatricopeptide repeat-containing protein At2g29760, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H33 PE=2 SV=1 Back     alignment and function description
>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2 Back     alignment and function description
>sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protein At3g22690 OS=Arabidopsis thaliana GN=PCMP-H56 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFI1|PP280_ARATH Pentatricopeptide repeat-containing protein At3g53360, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E86 PE=2 SV=1 Back     alignment and function description
>sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protein At2g33680 OS=Arabidopsis thaliana GN=PCMP-E19 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query705
225425182684 PREDICTED: pentatricopeptide repeat-cont 0.961 0.991 0.782 0.0
357464699705 Pentatricopeptide repeat-containing prot 1.0 1.0 0.739 0.0
356544545705 PREDICTED: pentatricopeptide repeat-cont 1.0 1.0 0.737 0.0
224096022710 predicted protein [Populus trichocarpa] 0.977 0.970 0.725 0.0
296088715654 unnamed protein product [Vitis vinifera] 0.919 0.990 0.748 0.0
449462814687 PREDICTED: pentatricopeptide repeat-cont 0.971 0.997 0.712 0.0
15225445697 pentatricopeptide repeat-containing prot 0.946 0.956 0.698 0.0
297831842697 pentatricopeptide repeat-containing prot 0.937 0.948 0.701 0.0
255553249628 pentatricopeptide repeat-containing prot 0.727 0.816 0.774 0.0
242075862688 hypothetical protein SORBIDRAFT_06g01717 0.920 0.943 0.579 0.0
>gi|225425182|ref|XP_002264325.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1114 bits (2882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/679 (78%), Positives = 597/679 (87%), Gaps = 1/679 (0%)

Query: 10  IVGDLAFLDSSPFAKLLDSCLRSKSVSDTRRVHARIIKSQFASEIFIQNRLIDVYAKCGC 69
           +V DL   +SSPFAKLLDSCLRS+S   TR VHARI+ +QF+ EIFIQNRLIDVY KC C
Sbjct: 6   LVRDLYLPNSSPFAKLLDSCLRSRSARGTRLVHARILMTQFSMEIFIQNRLIDVYGKCDC 65

Query: 70  LYGARKVFDKMSNKNVFTWNSIITGLLKWGFIDDASRLFASMPERDQCSWNSMVSGFAQH 129
           L  ARK+FD+M  +N FTWNS+I+ L K GF+D+A+RLF SMPE DQCSWNSMVSGFAQH
Sbjct: 66  LDDARKLFDRMPQRNTFTWNSLISVLTKSGFLDEAARLFGSMPEPDQCSWNSMVSGFAQH 125

Query: 130 DRFSEALGYFVKMHSENFALSEYSFGSALSACAGSVDFKMGTQVHALLSKSRYSSDVYMG 189
           DRF E+L YFVKMH E+F L+EYSFGSALSACAG +D  MGTQVHAL+SKSRYS+DVYMG
Sbjct: 126 DRFEESLEYFVKMHREDFLLNEYSFGSALSACAGLMDLNMGTQVHALVSKSRYSTDVYMG 185

Query: 190 SALIDMYGKCGRVSCARRVFDGMRERNIVSWNSLITCYEQNGPASDALEVFVRMMASGIE 249
           SALIDMY KCG V+CA  VF GM ERN+V+WNSLITCYEQNGPAS+ALEVFVRMM SG+E
Sbjct: 186 SALIDMYSKCGSVACAEEVFSGMIERNLVTWNSLITCYEQNGPASEALEVFVRMMDSGLE 245

Query: 250 PDEVTLASVVSACASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKCGKLNEARC 309
           PDEVTLASVVSACASL A KEGLQIHAR+++  K R+DLVLGNALVDMYAKC K+NEAR 
Sbjct: 246 PDEVTLASVVSACASLCALKEGLQIHARVVKTNKFRDDLVLGNALVDMYAKCSKVNEARR 305

Query: 310 VFDRMPIRNVVSETSMVSGYAKASSVKSARLMFTKMLERNVVSWNALIAGYTQNGENEEA 369
           VFDRM IRNVVSETSMVSGYA+A+SVK+AR MF+KM +RNVVSWNALIAGYTQNGENEEA
Sbjct: 306 VFDRMSIRNVVSETSMVSGYARAASVKAARFMFSKMTQRNVVSWNALIAGYTQNGENEEA 365

Query: 370 LGLFRLLKRESVCPTHYTFGNLLNACANLADLQLGRQAHTHVVKHGLRFLSGEESDIFVG 429
           L LFRLLKRES+ PTHYTFGNLL+ACANLADL LGRQAHTHV+K G  F SG ESDIFVG
Sbjct: 366 LRLFRLLKRESIWPTHYTFGNLLSACANLADLLLGRQAHTHVLKQGFEFQSGAESDIFVG 425

Query: 430 NSLIDMYMKCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALGLFKKMLLCGEK 489
           NSLIDMYMKCGS+EDG R+FE M ERD VSWNA+IVG AQNGYG EAL +F+KML+CGEK
Sbjct: 426 NSLIDMYMKCGSIEDGSRVFEKMKERDCVSWNAIIVGYAQNGYGAEALQIFRKMLVCGEK 485

Query: 490 PDHVTMIGVLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLLGRAGCLDEAKT 549
           PDHVTMIGVLCACSHAGLVEEGR YF SM +EHGL PLKDHYTCMVDLLGRAGCL+EAK 
Sbjct: 486 PDHVTMIGVLCACSHAGLVEEGRHYFFSM-EEHGLIPLKDHYTCMVDLLGRAGCLNEAKN 544

Query: 550 LIEAMPMQPDAVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYVLLSNMYAELGR 609
           LIEAMP+ PDAV+WGSLLAACKVH NI +G++ A+KLLEI+P NSGPYVLLSNMYAELGR
Sbjct: 545 LIEAMPVNPDAVVWGSLLAACKVHGNIEMGKHAAEKLLEIDPWNSGPYVLLSNMYAELGR 604

Query: 610 WGEVVRVRKLMRKRGVVKQPGCSWIEILGHVNVFMVKDKRHPLNKEIYLVLKMLTREMKR 669
           WG+VVRVRKLMR++GV KQPGCSWIE+   V+VF+VKDK HP  K+IY VLKMLT +MKR
Sbjct: 605 WGDVVRVRKLMRQQGVTKQPGCSWIEVESRVHVFLVKDKSHPHRKQIYSVLKMLTEQMKR 664

Query: 670 VGYVPNASDDEAYEEQNGS 688
           VGY+P+A+D EAY+EQ+ S
Sbjct: 665 VGYIPDANDFEAYDEQSKS 683




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|357464699|ref|XP_003602631.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355491679|gb|AES72882.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|356544545|ref|XP_003540710.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Glycine max] Back     alignment and taxonomy information
>gi|224096022|ref|XP_002310520.1| predicted protein [Populus trichocarpa] gi|222853423|gb|EEE90970.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296088715|emb|CBI38165.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449462814|ref|XP_004149135.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Cucumis sativus] gi|449523485|ref|XP_004168754.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15225445|ref|NP_178983.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75206168|sp|Q9SIT7.1|PP151_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g13600 gi|4558664|gb|AAD22682.1| hypothetical protein [Arabidopsis thaliana] gi|330251150|gb|AEC06244.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297831842|ref|XP_002883803.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297329643|gb|EFH60062.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255553249|ref|XP_002517667.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543299|gb|EEF44831.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|242075862|ref|XP_002447867.1| hypothetical protein SORBIDRAFT_06g017170 [Sorghum bicolor] gi|241939050|gb|EES12195.1| hypothetical protein SORBIDRAFT_06g017170 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query705
TAIR|locus:2054131697 SLO2 "AT2G13600" [Arabidopsis 0.946 0.956 0.668 8.4e-248
TAIR|locus:2078653825 AT3G02010 [Arabidopsis thalian 0.493 0.421 0.411 1.8e-114
TAIR|locus:2141171857 AT4G21300 [Arabidopsis thalian 0.489 0.402 0.369 3.5e-113
TAIR|locus:2202074809 CRR22 "CHLORORESPIRATORY REDUC 0.500 0.436 0.391 1.3e-109
TAIR|locus:505006130970 AT1G18485 [Arabidopsis thalian 0.517 0.376 0.372 7.2e-107
TAIR|locus:2032840937 AT1G16480 "AT1G16480" [Arabido 0.513 0.386 0.362 8.1e-106
TAIR|locus:2083961768 AT3G53360 "AT3G53360" [Arabido 0.441 0.404 0.438 9.4e-105
TAIR|locus:2140235781 AT4G02750 [Arabidopsis thalian 0.866 0.782 0.377 5.3e-104
TAIR|locus:2060640738 OTP81 "ORGANELLE TRANSCRIPT PR 0.821 0.784 0.353 3.7e-103
TAIR|locus:2032955790 AT1G25360 "AT1G25360" [Arabido 0.904 0.807 0.348 3.3e-102
TAIR|locus:2054131 SLO2 "AT2G13600" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2387 (845.3 bits), Expect = 8.4e-248, P = 8.4e-248
 Identities = 448/670 (66%), Positives = 533/670 (79%)

Query:     1 MATQRSVKQIVGDLA-FLDSSPFAKLLDSCLRSK-SVSDTRRVHARIIKSQFASEIFIQN 58
             MAT+  +K +  DL+ F DSSPFAKLLDSC++SK S    R VHA +IKS F++EIFIQN
Sbjct:     1 MATKSFLK-LAADLSSFTDSSPFAKLLDSCIKSKLSAIYVRYVHASVIKSGFSNEIFIQN 59

Query:    59 RLIDVYAKCGCLYGARKVFDKMSNKNVFTWNSIITGLLKWGFIDDASRLFASMPERDQCS 118
             RLID Y+KCG L   R+VFDKM  +N++TWNS++TGL K GF+D+A  LF SMPERDQC+
Sbjct:    60 RLIDAYSKCGSLEDGRQVFDKMPQRNIYTWNSVVTGLTKLGFLDEADSLFRSMPERDQCT 119

Query:   119 WNSMVSGFAQHDRFSEALGYFVKMHSENFALSEYSFGSALSACAGSVDFKMGTQVHALLS 178
             WNSMVSGFAQHDR  EAL YF  MH E F L+EYSF S LSAC+G  D   G QVH+L++
Sbjct:   120 WNSMVSGFAQHDRCEEALCYFAMMHKEGFVLNEYSFASVLSACSGLNDMNKGVQVHSLIA 179

Query:   179 KSRYSSDVYMGSALIDMYGKCGRVSCARRVFDGMRERNIVSWNSLITCYEQNGPASDALE 238
             KS + SDVY+GSAL+DMY KCG V+ A+RVFD M +RN+VSWNSLITC+EQNGPA +AL+
Sbjct:   180 KSPFLSDVYIGSALVDMYSKCGNVNDAQRVFDEMGDRNVVSWNSLITCFEQNGPAVEALD 239

Query:   239 VFVRMMASGIEPDEVTXXXXXXXXXXXXXFKEGLQIHARLMRCEKLRNDLVLGNALVDMY 298
             VF  M+ S +EPDEVT              K G ++H R+++ +KLRND++L NA VDMY
Sbjct:   240 VFQMMLESRVEPDEVTLASVISACASLSAIKVGQEVHGRVVKNDKLRNDIILSNAFVDMY 299

Query:   299 AKCGKLNEARCVFDRMPIRNVVSETSMVSGYAKASSVKSARLMFTKMLERNVVSWNALIA 358
             AKC ++ EAR +FD MPIRNV++ETSM+SGYA A+S K+ARLMFTKM ERNVVSWNALIA
Sbjct:   300 AKCSRIKEARFIFDSMPIRNVIAETSMISGYAMAASTKAARLMFTKMAERNVVSWNALIA 359

Query:   359 GYTQNGENEEALGLFRLLKRESVCPTHYTFGXXXXXXXXXXXXXXGRQAHTHVVKHGLRF 418
             GYTQNGENEEAL LF LLKRESVCPTHY+F               G QAH HV+KHG +F
Sbjct:   360 GYTQNGENEEALSLFCLLKRESVCPTHYSFANILKACADLAELHLGMQAHVHVLKHGFKF 419

Query:   419 LSGEESDIFVGNSLIDMYMKCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALG 478
              SGEE DIFVGNSLIDMY+KCG VE+G  +F  M+ERD VSWNAMI+G AQNGYG EAL 
Sbjct:   420 QSGEEDDIFVGNSLIDMYVKCGCVEEGYLVFRKMMERDCVSWNAMIIGFAQNGYGNEALE 479

Query:   479 LFKKMLLCGEKPDHVTMIGVLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLL 538
             LF++ML  GEKPDH+TMIGVL AC HAG VEEGR YFSSM+++ G+APL+DHYTCMVDLL
Sbjct:   480 LFREMLESGEKPDHITMIGVLSACGHAGFVEEGRHYFSSMTRDFGVAPLRDHYTCMVDLL 539

Query:   539 GRAGCLDEAKTLIEAMPMQPDAVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYV 598
             GRAG L+EAK++IE MPMQPD+VIWGSLLAACKVHRNI LG+YVA+KLLE+EPSNSGPYV
Sbjct:   540 GRAGFLEEAKSMIEEMPMQPDSVIWGSLLAACKVHRNITLGKYVAEKLLEVEPSNSGPYV 599

Query:   599 LLSNMYAELGRWGEVVRVRKLMRKRGVVKQPGCSWIEILGHVNVFMVKDKRHPLNKEIYL 658
             LLSNMYAELG+W +V+ VRK MRK GV KQPGCSWI+I GH +VFMVKDK HP  K+I+ 
Sbjct:   600 LLSNMYAELGKWEDVMNVRKSMRKEGVTKQPGCSWIKIQGHDHVFMVKDKSHPRKKQIHS 659

Query:   659 VLKMLTREMK 668
             +L +L  EM+
Sbjct:   660 LLDILIAEMR 669




GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0010182 "sugar mediated signaling pathway" evidence=IMP
GO:0080156 "mitochondrial mRNA modification" evidence=IMP
TAIR|locus:2078653 AT3G02010 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141171 AT4G21300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202074 CRR22 "CHLORORESPIRATORY REDUCTION22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006130 AT1G18485 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032840 AT1G16480 "AT1G16480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083961 AT3G53360 "AT3G53360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140235 AT4G02750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2060640 OTP81 "ORGANELLE TRANSCRIPT PROCESSING 81" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032955 AT1G25360 "AT1G25360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SIT7PP151_ARATHNo assigned EC number0.69850.94600.9569yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query705
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-157
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-124
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 3e-78
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-67
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-65
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 1e-40
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 2e-17
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 1e-10
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 4e-10
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-09
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 4e-08
pfam1304150 pfam13041, PPR_2, PPR repeat family 7e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 2e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 2e-04
pfam0153531 pfam01535, PPR, PPR repeat 3e-04
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 3e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-04
pfam1285434 pfam12854, PPR_1, PPR repeat 5e-04
pfam0153531 pfam01535, PPR, PPR repeat 7e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.001
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
pfam0153531 pfam01535, PPR, PPR repeat 0.002
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 0.002
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  476 bits (1226), Expect = e-157
 Identities = 235/671 (35%), Positives = 363/671 (54%), Gaps = 73/671 (10%)

Query: 18  DSSPFAKLLDSCLRSKSVSDTRRVHARIIKSQFASEIFIQNRLIDVYAKCGCLYGARKVF 77
           D   F  +L +C     ++  R VHA +++  F  ++ + N LI +Y KCG +  AR VF
Sbjct: 186 DVYTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVF 245

Query: 78  DKMSNKNVFTWNSIITGLLKWGFIDDASRLFASMPERDQCSWNSMVSGFAQHDRFSEALG 137
           D+M                               P RD  SWN+M+SG+ ++    E L 
Sbjct: 246 DRM-------------------------------PRRDCISWNAMISGYFENGECLEGLE 274

Query: 138 YFVKMHSENFALSEYSFGSALSACAGSVDFKMGTQVHALLSKSRYSSDVYMGSALIDMYG 197
            F  M   +      +  S +SAC    D ++G ++H  + K+ ++ DV + ++LI MY 
Sbjct: 275 LFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYL 334

Query: 198 KCGRVSCARRVFDGMRERNIVSWNSLITCYEQNGPASDALEVFVRMMASGIEPDEVTLAS 257
             G    A +VF  M  ++ VSW ++I+ YE+NG    ALE +  M    + PDE+T+AS
Sbjct: 335 SLGSWGEAEKVFSRMETKDAVSWTAMISGYEKNGLPDKALETYALMEQDNVSPDEITIAS 394

Query: 258 VVSACASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKCGKLNEARCVFDRMPIR 317
           V+SACA L     G+++H  L   + L + +V+ NAL++MY+KC  +++A  VF  +P  
Sbjct: 395 VLSACACLGDLDVGVKLH-ELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIP-- 451

Query: 318 NVVSETSMVSGYAKASSVKSARLMFTKMLERNVVSWNALIAGYTQNGENEEALGLFRLLK 377
                                        E++V+SW ++IAG   N    EAL  FR + 
Sbjct: 452 -----------------------------EKDVISWTSIIAGLRLNNRCFEALIFFRQML 482

Query: 378 RESVCPTHYTFGNLLNACANLADLQLGRQAHTHVVKHGLRFLSGEESDIFVGNSLIDMYM 437
             ++ P   T    L+ACA +  L  G++ H HV++ G+ F      D F+ N+L+D+Y+
Sbjct: 483 L-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGIGF------DGFLPNALLDLYV 535

Query: 438 KCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALGLFKKMLLCGEKPDHVTMIG 497
           +CG +      F +  E+D VSWN ++ G   +G G+ A+ LF +M+  G  PD VT I 
Sbjct: 536 RCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFIS 594

Query: 498 VLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLLGRAGCLDEAKTLIEAMPMQ 557
           +LCACS +G+V +G +YF SM +++ + P   HY C+VDLLGRAG L EA   I  MP+ 
Sbjct: 595 LLCACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPIT 654

Query: 558 PDAVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYVLLSNMYAELGRWGEVVRVR 617
           PD  +WG+LL AC++HR++ LGE  A+ + E++P++ G Y+LL N+YA+ G+W EV RVR
Sbjct: 655 PDPAVWGALLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVR 714

Query: 618 KLMRKRGVVKQPGCSWIEILGHVNVFMVKDKRHPLNKEIYLVLKMLTREMKRVGYVPNAS 677
           K MR+ G+   PGCSW+E+ G V+ F+  D+ HP  KEI  VL+    +MK  G     S
Sbjct: 715 KTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASGL--AGS 772

Query: 678 DDEAYEEQNGS 688
           +  + +E   S
Sbjct: 773 ESSSMDEIEVS 783


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205109 pfam12854, PPR_1, PPR repeat Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 705
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077857 Protein ECB2; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.91
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.89
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.88
PRK11788389 tetratricopeptide repeat protein; Provisional 99.85
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.85
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.84
PRK11788389 tetratricopeptide repeat protein; Provisional 99.83
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.83
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.82
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.81
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.81
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.8
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.79
PRK14574 822 hmsH outer membrane protein; Provisional 99.77
PRK14574 822 hmsH outer membrane protein; Provisional 99.77
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.77
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.75
KOG2076895 consensus RNA polymerase III transcription factor 99.71
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.7
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.69
KOG2076895 consensus RNA polymerase III transcription factor 99.69
KOG2003840 consensus TPR repeat-containing protein [General f 99.69
KOG0547606 consensus Translocase of outer mitochondrial membr 99.65
KOG2003840 consensus TPR repeat-containing protein [General f 99.65
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.6
KOG1915677 consensus Cell cycle control protein (crooked neck 99.57
KOG1126638 consensus DNA-binding cell division cycle control 99.57
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.53
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.51
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.51
KOG1126638 consensus DNA-binding cell division cycle control 99.51
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.5
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.49
KOG1915677 consensus Cell cycle control protein (crooked neck 99.49
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.48
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.47
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.44
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.41
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.4
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.4
KOG0547606 consensus Translocase of outer mitochondrial membr 99.4
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.38
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.38
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.32
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.31
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.29
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.29
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.29
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.28
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.28
KOG2376652 consensus Signal recognition particle, subunit Srp 99.28
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.23
PF1304150 PPR_2: PPR repeat family 99.23
PRK12370553 invasion protein regulator; Provisional 99.22
PF1304150 PPR_2: PPR repeat family 99.22
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.21
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.2
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.19
KOG1129478 consensus TPR repeat-containing protein [General f 99.17
KOG3616 1636 consensus Selective LIM binding factor [Transcript 99.17
PRK12370553 invasion protein regulator; Provisional 99.16
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.16
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.15
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.14
KOG2376652 consensus Signal recognition particle, subunit Srp 99.13
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.13
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.13
KOG1129478 consensus TPR repeat-containing protein [General f 99.11
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.1
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.09
PRK11189296 lipoprotein NlpI; Provisional 99.08
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.07
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.04
PRK11189296 lipoprotein NlpI; Provisional 99.03
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.99
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.99
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.99
KOG1125579 consensus TPR repeat-containing protein [General f 98.99
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.9
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.85
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.81
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.81
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.8
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.79
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.74
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.73
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.73
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.72
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.71
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.71
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.7
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.66
PRK04841903 transcriptional regulator MalT; Provisional 98.65
PRK15359144 type III secretion system chaperone protein SscB; 98.65
PRK10370198 formate-dependent nitrite reductase complex subuni 98.64
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.57
PF1285434 PPR_1: PPR repeat 98.57
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.55
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.53
PRK15359144 type III secretion system chaperone protein SscB; 98.53
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.52
PF1285434 PPR_1: PPR repeat 98.48
KOG1125579 consensus TPR repeat-containing protein [General f 98.47
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.45
PRK04841903 transcriptional regulator MalT; Provisional 98.45
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.44
KOG1128777 consensus Uncharacterized conserved protein, conta 98.42
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.41
PRK10370198 formate-dependent nitrite reductase complex subuni 98.39
PLN02789320 farnesyltranstransferase 98.38
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.36
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.35
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.3
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.3
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.26
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.21
PLN02789320 farnesyltranstransferase 98.21
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.19
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.18
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.17
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.12
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.11
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.1
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.06
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.05
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.04
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.03
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.0
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.98
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.97
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.96
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.93
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.93
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.92
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.92
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.91
KOG0553304 consensus TPR repeat-containing protein [General f 97.91
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.9
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.87
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.85
PRK15331165 chaperone protein SicA; Provisional 97.82
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.8
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.73
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.73
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.73
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.72
KOG0553304 consensus TPR repeat-containing protein [General f 97.72
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.71
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.71
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.69
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.66
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.61
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.61
KOG20411189 consensus WD40 repeat protein [General function pr 97.59
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.58
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.57
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.57
PF1337173 TPR_9: Tetratricopeptide repeat 97.52
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.49
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.44
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.44
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.42
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.42
COG4700251 Uncharacterized protein conserved in bacteria cont 97.4
PF1343134 TPR_17: Tetratricopeptide repeat 97.39
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.39
COG3898531 Uncharacterized membrane-bound protein [Function u 97.37
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.33
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.3
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.28
KOG1258577 consensus mRNA processing protein [RNA processing 97.26
PF12688120 TPR_5: Tetratrico peptide repeat 97.24
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.21
PRK10803263 tol-pal system protein YbgF; Provisional 97.2
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.19
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.19
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.17
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.14
KOG15381081 consensus Uncharacterized conserved protein WDR10, 97.13
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.13
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.1
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.1
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.09
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.08
COG4700251 Uncharacterized protein conserved in bacteria cont 97.06
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.06
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.02
PF12688120 TPR_5: Tetratrico peptide repeat 96.96
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.96
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.96
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 96.94
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.94
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.92
PF1342844 TPR_14: Tetratricopeptide repeat 96.88
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.87
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.82
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.8
PRK10803263 tol-pal system protein YbgF; Provisional 96.77
COG3898531 Uncharacterized membrane-bound protein [Function u 96.77
PF1337173 TPR_9: Tetratricopeptide repeat 96.75
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.74
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 96.73
KOG20411189 consensus WD40 repeat protein [General function pr 96.7
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.62
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.47
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.45
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.41
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.41
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.35
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.31
PRK11906458 transcriptional regulator; Provisional 96.26
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.24
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 96.17
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.14
PF13512142 TPR_18: Tetratricopeptide repeat 96.13
KOG4555175 consensus TPR repeat-containing protein [Function 96.05
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.01
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.93
PRK11906458 transcriptional regulator; Provisional 95.88
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.86
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.72
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.64
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.62
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.62
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.6
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.46
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.37
KOG1585308 consensus Protein required for fusion of vesicles 95.34
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.28
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.23
KOG1941 518 consensus Acetylcholine receptor-associated protei 95.08
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.06
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.96
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.95
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.91
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.7
PF13512142 TPR_18: Tetratricopeptide repeat 94.7
KOG3941406 consensus Intermediate in Toll signal transduction 94.67
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.66
PF03704146 BTAD: Bacterial transcriptional activator domain; 94.61
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 94.61
KOG3941406 consensus Intermediate in Toll signal transduction 94.53
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 94.48
smart00299140 CLH Clathrin heavy chain repeat homology. 94.48
COG3118304 Thioredoxin domain-containing protein [Posttransla 94.48
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.22
KOG4234271 consensus TPR repeat-containing protein [General f 94.07
smart00299140 CLH Clathrin heavy chain repeat homology. 94.03
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.92
COG1729262 Uncharacterized protein conserved in bacteria [Fun 93.86
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.7
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.68
KOG1585308 consensus Protein required for fusion of vesicles 93.59
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.51
KOG4555175 consensus TPR repeat-containing protein [Function 93.4
KOG4648 536 consensus Uncharacterized conserved protein, conta 93.37
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 93.28
KOG2610 491 consensus Uncharacterized conserved protein [Funct 92.96
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 92.93
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 92.68
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.61
KOG1941518 consensus Acetylcholine receptor-associated protei 92.45
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.44
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.31
PRK15331165 chaperone protein SicA; Provisional 92.3
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.83
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 91.48
PRK11619 644 lytic murein transglycosylase; Provisional 91.37
KOG3364149 consensus Membrane protein involved in organellar 91.19
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 90.97
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 90.95
KOG1586288 consensus Protein required for fusion of vesicles 90.7
KOG1586288 consensus Protein required for fusion of vesicles 90.63
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 90.57
PRK09687280 putative lyase; Provisional 90.39
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.38
PF1342844 TPR_14: Tetratricopeptide repeat 90.32
COG3629280 DnrI DNA-binding transcriptional activator of the 90.17
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.15
COG3947361 Response regulator containing CheY-like receiver a 89.7
COG1747 711 Uncharacterized N-terminal domain of the transcrip 89.53
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 89.25
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 89.18
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 89.15
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.79
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 88.75
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 88.61
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 88.61
COG3629280 DnrI DNA-binding transcriptional activator of the 88.2
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 87.84
KOG1498 439 consensus 26S proteasome regulatory complex, subun 87.72
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 87.66
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 87.48
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 87.08
COG4649221 Uncharacterized protein conserved in bacteria [Fun 87.06
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 86.97
PRK09687280 putative lyase; Provisional 86.77
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 86.34
PRK10941269 hypothetical protein; Provisional 86.3
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 86.29
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 86.15
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 85.95
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 85.83
PRK11619644 lytic murein transglycosylase; Provisional 85.79
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 85.76
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 85.62
PF06552186 TOM20_plant: Plant specific mitochondrial import r 85.39
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 85.21
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 84.85
PF13170297 DUF4003: Protein of unknown function (DUF4003) 84.69
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 84.12
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 83.71
PF1343134 TPR_17: Tetratricopeptide repeat 83.66
KOG4570418 consensus Uncharacterized conserved protein [Funct 83.57
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 83.37
COG2976207 Uncharacterized protein conserved in bacteria [Fun 83.32
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 83.08
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 82.74
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 82.69
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 82.29
KOG4234271 consensus TPR repeat-containing protein [General f 82.14
KOG1258577 consensus mRNA processing protein [RNA processing 81.71
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 81.44
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 81.14
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 81.13
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 80.44
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 80.2
KOG4648 536 consensus Uncharacterized conserved protein, conta 80.01
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.6e-100  Score=860.27  Aligned_cols=671  Identities=35%  Similarity=0.628  Sum_probs=639.2

Q ss_pred             CCCCchhHHHHHHHHhcCCChhhHHHHHHHHHHcCCCCchhhHHHHHHHHHccCChhhHHHHHhccCC----CChhhHHH
Q 005265           15 AFLDSSPFAKLLDSCLRSKSVSDTRRVHARIIKSQFASEIFIQNRLIDVYAKCGCLYGARKVFDKMSN----KNVFTWNS   90 (705)
Q Consensus        15 ~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~ll~~~~~~g~~~~A~~~~~~~~~----~~~~~~~~   90 (705)
                      -.|+..+++.++.++++.|++++|..+++.|.+.|++|+..+|..++.+|.+.+.++.|..++..+.+    +++..+|+
T Consensus        47 ~~~~~~~~n~~i~~l~~~g~~~~A~~l~~~m~~~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~n~  126 (857)
T PLN03077         47 SSSSTHDSNSQLRALCSHGQLEQALKLLESMQELRVPVDEDAYVALFRLCEWKRAVEEGSRVCSRALSSHPSLGVRLGNA  126 (857)
T ss_pred             cccchhhHHHHHHHHHhCCCHHHHHHHHHHHHhcCCCCChhHHHHHHHHHhhCCCHHHHHHHHHHHHHcCCCCCchHHHH
Confidence            35778889999999999999999999999999999999999999999999999999999999987654    78889999


Q ss_pred             HHHHHHhcCChhHHHHHHhcCCCCCcccHHHHHHHHHhCCChHHHHHHHHHhHhCCCCCChhhHHHHHHHhhCCCCcHHH
Q 005265           91 IITGLLKWGFIDDASRLFASMPERDQCSWNSMVSGFAQHDRFSEALGYFVKMHSENFALSEYSFGSALSACAGSVDFKMG  170 (705)
Q Consensus        91 li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a  170 (705)
                      ||.+|++.|+++.|.++|++|++||+.+||.+|.+|++.|++++|+++|++|...|+.||..||+.++++|+..+++..+
T Consensus       127 li~~~~~~g~~~~A~~~f~~m~~~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~  206 (857)
T PLN03077        127 MLSMFVRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARG  206 (857)
T ss_pred             HHHHHHhCCChHHHHHHHhcCCCCCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHcCCCCChhhHHHHHHHhhcCCChHHHHHHHhccCCCCcchHHHHHHHHHhcCChhHHHHHHHHHHHCCCCC
Q 005265          171 TQVHALLSKSRYSSDVYMGSALIDMYGKCGRVSCARRVFDGMRERNIVSWNSLITCYEQNGPASDALEVFVRMMASGIEP  250 (705)
Q Consensus       171 ~~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p  250 (705)
                      .+++..+.+.|+.||..++|+||.+|+++|+++.|.++|++|++||+++||++|.+|++.|++++|+++|++|...|+.|
T Consensus       207 ~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~~d~~s~n~li~~~~~~g~~~eAl~lf~~M~~~g~~P  286 (857)
T PLN03077        207 REVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENGECLEGLELFFTMRELSVDP  286 (857)
T ss_pred             HHHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcCCCCCcchhHHHHHHHHhCCCHHHHHHHHHHHHHcCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHhHHHHHHHHHHccCChHHHHHHHHHHHHcCCCCCChhHHHHHHHHHHhcCChHHHHHHHhhCCCCCcccHHHHHHHHH
Q 005265          251 DEVTLASVVSACASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKCGKLNEARCVFDRMPIRNVVSETSMVSGYA  330 (705)
Q Consensus       251 ~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~  330 (705)
                      |..||+.++.+|++.|+++.|.+++..+.+.| +.||..+|++|+.+|+++|++++|.++|++|..+|..+|+++|.+|+
T Consensus       287 d~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g-~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~  365 (857)
T PLN03077        287 DLMTITSVISACELLGDERLGREMHGYVVKTG-FAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYE  365 (857)
T ss_pred             ChhHHHHHHHHHHhcCChHHHHHHHHHHHHhC-CccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHH
Confidence            99999999999999999999999999999998 99999999999999999999999999999999888888887777766


Q ss_pred             hcCC----------------------------------------------------------------------HHHHHH
Q 005265          331 KASS----------------------------------------------------------------------VKSARL  340 (705)
Q Consensus       331 ~~~~----------------------------------------------------------------------~~~A~~  340 (705)
                      +.|+                                                                      +++|.+
T Consensus       366 ~~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~  445 (857)
T PLN03077        366 KNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALE  445 (857)
T ss_pred             hCCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHH
Confidence            5554                                                                      445555


Q ss_pred             HHHhcCCCCeehHHHHHHHHHHcCChHHHHHHHHHhhhCCCCcchhhHHHHHHHHhhcccHHHHHHHHHHHHHhCCCCCC
Q 005265          341 MFTKMLERNVVSWNALIAGYTQNGENEEALGLFRLLKRESVCPTHYTFGNLLNACANLADLQLGRQAHTHVVKHGLRFLS  420 (705)
Q Consensus       341 ~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~  420 (705)
                      +|++|.++|.++||.+|.+|++.|+.++|+.+|++|.. +++||..||+.++.+|++.|+++.+.+++..+.+.|+    
T Consensus       446 vf~~m~~~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~-~~~pd~~t~~~lL~a~~~~g~l~~~~~i~~~~~~~g~----  520 (857)
T PLN03077        446 VFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQMLL-TLKPNSVTLIAALSACARIGALMCGKEIHAHVLRTGI----  520 (857)
T ss_pred             HHHhCCCCCeeeHHHHHHHHHHCCCHHHHHHHHHHHHh-CCCCCHhHHHHHHHHHhhhchHHHhHHHHHHHHHhCC----
Confidence            56666667788888888888888888888999999875 5899999999999999999999999999999999999    


Q ss_pred             CCCCcHhHHHHHHHHHHhcCCHHHHHHHHHccCCCChhHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCChhhHHHHHH
Q 005265          421 GEESDIFVGNSLIDMYMKCGSVEDGCRIFETMVERDWVSWNAMIVGCAQNGYGTEALGLFKKMLLCGEKPDHVTMIGVLC  500 (705)
Q Consensus       421 ~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~  500 (705)
                        .++..++++|+++|+++|++++|.++|+.+ .+|..+||+||.+|+++|+.++|+++|++|.+.|+.||..||+.++.
T Consensus       521 --~~~~~~~naLi~~y~k~G~~~~A~~~f~~~-~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~  597 (857)
T PLN03077        521 --GFDGFLPNALLDLYVRCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLC  597 (857)
T ss_pred             --CccceechHHHHHHHHcCCHHHHHHHHHhc-CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHH
Confidence              899999999999999999999999999999 89999999999999999999999999999999999999999999999


Q ss_pred             HHhccCcHHHHHHHHHHhHHhcCCCCChhHHHHHHHHHHhcCChHHHHHHHHhCCCCCCHHHHHHHHHHHHhcCCHHHHH
Q 005265          501 ACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLLGRAGCLDEAKTLIEAMPMQPDAVIWGSLLAACKVHRNIMLGE  580 (705)
Q Consensus       501 ~~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~a~  580 (705)
                      +|++.|++++|.++|+.|.+.+|+.|+..+|++++++|++.|++++|.+++++|+++||..+|++|+.+|..+|+.+.|+
T Consensus       598 a~~~~g~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e  677 (857)
T PLN03077        598 ACSRSGMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGE  677 (857)
T ss_pred             HHhhcChHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHH
Confidence            99999999999999999987889999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhCCCCCchHHHHHHHHHhcCChhHHHHHHHHHHhCCCccCCceeEEEECCEEeEEeeCCcCCCChhHHHHHH
Q 005265          581 YVAKKLLEIEPSNSGPYVLLSNMYAELGRWGEVVRVRKLMRKRGVVKQPGCSWIEILGHVNVFMVKDKRHPLNKEIYLVL  660 (705)
Q Consensus       581 ~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  660 (705)
                      .+.+++++++|++...|..|+++|+..|+|++|.++++.|+++|++|+||+||+++++.+|.|.++|..||+.++|+..|
T Consensus       678 ~~a~~l~~l~p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~ie~~~~~~~f~~~d~~h~~~~~i~~~l  757 (857)
T PLN03077        678 LAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVL  757 (857)
T ss_pred             HHHHHHHhhCCCCcchHHHHHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccEEEECCEEEEEecCCCCCcchHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHcCcccCCC-cccccccccccc-cccchh
Q 005265          661 KMLTREMKRVGYVPNAS-DDEAYEEQNGSN-STSDCQ  695 (705)
Q Consensus       661 ~~l~~~~~~~g~~~~~~-~~~~~~~~~~~~-~~~~~~  695 (705)
                      +.+..+|++.||+|++. ++ +++|++|++ +..|||
T Consensus       758 ~~l~~~~~~~g~~~~~~~~~-~~~~~~k~~~~~~hse  793 (857)
T PLN03077        758 EGFYEKMKASGLAGSESSSM-DEIEVSKDDIFCGHSE  793 (857)
T ss_pred             HHHHHHHHhCCcCCCcchhc-cccHHHHHHHHHhccH
Confidence            99999999999999999 66 557777777 555665



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1498 consensus 26S proteasome regulatory complex, subunit RPN5/PSMD12 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query705
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 2e-11
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-08
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 66.8 bits (161), Expect = 2e-11
 Identities = 24/212 (11%), Positives = 61/212 (28%), Gaps = 7/212 (3%)

Query: 150 SEYSFGSALSACAGSVDFKMGTQVHALLSKSRYSSDVYMGSALIDMYGKCGRVSCARRVF 209
            E      L    G +   +        S+++ S       A         ++  A  + 
Sbjct: 91  WEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLL 150

Query: 210 DGMRER-------NIVSWNSLITCYEQNGPASDALEVFVRMMASGIEPDEVTLASVVSAC 262
                +        +  +N+++  + + G   + + V   +  +G+ PD ++ A+ +   
Sbjct: 151 VVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCM 210

Query: 263 ASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKCGKLNEARCVFDRMPIRNVVSE 322
                    ++     M  E L+   +    L+    +   L     V     +   +  
Sbjct: 211 GRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPP 270

Query: 323 TSMVSGYAKASSVKSARLMFTKMLERNVVSWN 354
               S   +    K  R+ + K+         
Sbjct: 271 PVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQC 302


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query705
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.95
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.91
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.9
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.9
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.88
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.86
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.84
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.84
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.83
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.79
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.79
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.79
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.78
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.78
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.76
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.75
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.75
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.74
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.74
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.73
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.73
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.72
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.71
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.71
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.65
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.64
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.63
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.63
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.62
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.59
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.59
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.58
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.55
3u4t_A272 TPR repeat-containing protein; structural genomics 99.55
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.52
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.52
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.51
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.51
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.49
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.48
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.48
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.48
3u4t_A272 TPR repeat-containing protein; structural genomics 99.48
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.47
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.47
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.47
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.47
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.47
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.46
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.46
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.46
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.44
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.44
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.42
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.42
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.37
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.36
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.34
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.33
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.31
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.31
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.31
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.31
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.28
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.28
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.28
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.27
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.27
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.26
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.22
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.19
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.13
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.12
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.11
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.09
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.07
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.05
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.03
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.03
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.02
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.01
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.01
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.99
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.97
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.96
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.94
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.93
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.93
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.92
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.92
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.91
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.88
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.83
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.81
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.81
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.81
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.79
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.78
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.76
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.74
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.73
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.72
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.72
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.72
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.71
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.71
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.71
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.69
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.67
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.66
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.64
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.62
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.6
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.6
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.59
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.59
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.58
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.58
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.56
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.55
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.54
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.53
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.53
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.53
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.52
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.49
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.49
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.48
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.48
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.47
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.46
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.46
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.45
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.44
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.44
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.44
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.43
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.42
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.39
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.38
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.38
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.38
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.37
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.35
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.29
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.29
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.28
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.28
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.27
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.27
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.26
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.25
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.25
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.23
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.22
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.22
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.22
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.22
3k9i_A117 BH0479 protein; putative protein binding protein, 98.21
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.2
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.15
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.14
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.14
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.11
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.1
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.09
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.09
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.08
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.08
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.04
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.04
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.04
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.02
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.02
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.02
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.0
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.99
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.98
3k9i_A117 BH0479 protein; putative protein binding protein, 97.97
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.97
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.96
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.95
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.92
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.92
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.9
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.86
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.86
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.83
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.78
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.68
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.66
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.6
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.59
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.58
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.53
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.46
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.41
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.4
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.3
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.28
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.19
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 97.13
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.12
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.11
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.95
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.94
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.93
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.92
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.89
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.6
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.52
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.5
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.35
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.23
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.13
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.98
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.9
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 95.83
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.78
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.61
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.41
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.18
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.1
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 94.67
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.25
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.88
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 93.85
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 93.64
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 92.9
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.32
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 91.26
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 90.27
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 89.5
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 89.04
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 88.96
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 88.63
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 88.08
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 87.54
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 87.09
2p58_C116 Putative type III secretion protein YSCG; type III 86.23
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 85.88
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 85.44
2uwj_G115 Type III export protein PSCG; virulence, chaperone 85.17
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 84.56
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 83.49
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 83.47
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 83.02
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 82.65
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 82.39
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 81.58
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 81.15
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=2e-40  Score=364.57  Aligned_cols=480  Identities=8%  Similarity=-0.078  Sum_probs=314.0

Q ss_pred             HHhcCChhHHHHHHhcCCCCCcccHHHHHHHHHhCCChHHHHHHHHHhHhCCCCCChhhHHHHHHHhhCCCCcHHHHHHH
Q 005265           95 LLKWGFIDDASRLFASMPERDQCSWNSMVSGFAQHDRFSEALGYFVKMHSENFALSEYSFGSALSACAGSVDFKMGTQVH  174 (705)
Q Consensus        95 ~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~~~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~  174 (705)
                      +.+.|.+..+...+..++.+++..|+.++..+.+.|++++|+.+|++|..  ..|+..++..++.+|...|+++.|..++
T Consensus        63 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~  140 (597)
T 2xpi_A           63 TSTDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLL  140 (597)
T ss_dssp             -------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             ccccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHH
Confidence            45567777777888888878888899999999999999999999999885  4578888888999999999999999999


Q ss_pred             HHHHHcCCCCChhhHHHHHHHhhcCCChHHHHHHHhccCCC-------------------CcchHHHHHHHHHhcCChhH
Q 005265          175 ALLSKSRYSSDVYMGSALIDMYGKCGRVSCARRVFDGMRER-------------------NIVSWNSLITCYEQNGPASD  235 (705)
Q Consensus       175 ~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~-------------------~~~~~~~li~~~~~~g~~~~  235 (705)
                      +.+...  +++..+++.++.+|.+.|++++|.++|+++...                   ++.+|+.++.+|.+.|++++
T Consensus       141 ~~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~  218 (597)
T 2xpi_A          141 TKEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDR  218 (597)
T ss_dssp             HHTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHH
T ss_pred             HHHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHH
Confidence            887644  678889999999999999999999999965433                   36778888888888888888


Q ss_pred             HHHHHHHHHHCCCCCCH-hHHHHHHHHHHccCChHHH--HHH-HHHHHHcCCCCCChhHHHHHHHHHHhcCChHHHHHHH
Q 005265          236 ALEVFVRMMASGIEPDE-VTLASVVSACASLAAFKEG--LQI-HARLMRCEKLRNDLVLGNALVDMYAKCGKLNEARCVF  311 (705)
Q Consensus       236 A~~~~~~m~~~g~~p~~-~t~~~ll~~~~~~~~~~~a--~~~-~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~  311 (705)
                      |+++|++|.+.+  |+. ..+..+...+...+..+.+  ..+ +..+...+ ..+...+++.++..|.+.|++++|.   
T Consensus       219 A~~~~~~~~~~~--p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~-~~~~~~~~~~~~~~~~~~g~~~~A~---  292 (597)
T 2xpi_A          219 AKECYKEALMVD--AKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKED-AAFLRSLYMLKLNKTSHEDELRRAE---  292 (597)
T ss_dssp             HHHHHHHHHHHC--TTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGG-HHHHHHHHHTTSCTTTTHHHHHHHH---
T ss_pred             HHHHHHHHHHhC--chhhHHHHHHHHhhcccchhHHHHHHhcCCcccccch-HHHHHHHHHHHHHHHcCcchHHHHH---
Confidence            888888887743  433 3333333322222111111  011 22222222 2223334444455555555556565   


Q ss_pred             hhCCCCCcccHHHHHHHHHhcCCHHHHHHHHHhcCC--CCeehHHHHHHHHHHcCChHHHHHHHHHhhhCCCCcchhhHH
Q 005265          312 DRMPIRNVVSETSMVSGYAKASSVKSARLMFTKMLE--RNVVSWNALIAGYTQNGENEEALGLFRLLKRESVCPTHYTFG  389 (705)
Q Consensus       312 ~~~~~~~~~~~~~li~~~~~~~~~~~A~~~~~~~~~--~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~  389 (705)
                                                  ++|+++.+  ++..+|+.++.+|.+.|++++|+.+|+++.+.+ +.+..++.
T Consensus       293 ----------------------------~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~  343 (597)
T 2xpi_A          293 ----------------------------DYLSSINGLEKSSDLLLCKADTLFVRSRFIDVLAITTKILEID-PYNLDVYP  343 (597)
T ss_dssp             ----------------------------HHHHTSTTGGGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-TTCCTTHH
T ss_pred             ----------------------------HHHHHhhcCCchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC-cccHHHHH
Confidence                                        55555544  566666667777777777777777777666544 23555666


Q ss_pred             HHHHHHhhcccHHHHHHHHHHHHHhCCCCCCCCCCcHhHHHHHHHHHHhcCCHHHHHHHHHccC---CCChhHHHHHHHH
Q 005265          390 NLLNACANLADLQLGRQAHTHVVKHGLRFLSGEESDIFVGNSLIDMYMKCGSVEDGCRIFETMV---ERDWVSWNAMIVG  466 (705)
Q Consensus       390 ~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~---~~~~~~~~~li~~  466 (705)
                      .++.++.+.|++++|..++..+.+..       +.+..+++.++.+|.+.|++++|.++|+++.   ..+..+|+.++.+
T Consensus       344 ~l~~~~~~~g~~~~A~~~~~~~~~~~-------~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~  416 (597)
T 2xpi_A          344 LHLASLHESGEKNKLYLISNDLVDRH-------PEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHS  416 (597)
T ss_dssp             HHHHHHHHHTCHHHHHHHHHHHHHHC-------TTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHH
T ss_pred             HHHHHHHHhCCHHHHHHHHHHHHhhC-------cccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHH
Confidence            66667777777777777776666554       3566677777777777777777777777654   2356677777777


Q ss_pred             HHHcCChHHHHHHHHHHHHCCCCCChhhHHHHHHHHhccCcHHHHHHHHHHhHHhcCCCCChhHHHHHHHHHHhcCChHH
Q 005265          467 CAQNGYGTEALGLFKKMLLCGEKPDHVTMIGVLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLLGRAGCLDE  546 (705)
Q Consensus       467 ~~~~g~~~~A~~~~~~m~~~g~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~  546 (705)
                      |.+.|++++|+++|+++.+.+ +++..++..++.+|.+.|++++|.++|+.+.+.  .+.+..+|+.++.+|.+.|++++
T Consensus       417 ~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~~l~~~~~~~g~~~~  493 (597)
T 2xpi_A          417 FAIEGEHDQAISAYTTAARLF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYAL--FQYDPLLLNELGVVAFNKSDMQT  493 (597)
T ss_dssp             HHHHTCHHHHHHHHHHHHHTT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHH--CCCCHHHHHHHHHHHHHTTCHHH
T ss_pred             HHHcCCHHHHHHHHHHHHHhC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--CCCChHHHHHHHHHHHHhCCHHH
Confidence            777777777777777776631 224556777777777777777777777776543  12346667777777777777777


Q ss_pred             HHHHHHhC-------CCCCC--HHHHHHHHHHHHhcCCHHHHHHHHHHHHhhCCCCCchHHHHHHHHHhcCChhHHHHHH
Q 005265          547 AKTLIEAM-------PMQPD--AVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYVLLSNMYAELGRWGEVVRVR  617 (705)
Q Consensus       547 A~~~~~~~-------~~~p~--~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~  617 (705)
                      |.++|+++       +..|+  ..+|..++.+|.+.|++++|.+.++++++.+|+++.+|..++.+|.+.|++++|.+.+
T Consensus       494 A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~  573 (597)
T 2xpi_A          494 AINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHL  573 (597)
T ss_dssp             HHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             HHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHH
Confidence            77777666       33565  5677777777777777777777777777777777777777777777777777777777


Q ss_pred             HHHHhC
Q 005265          618 KLMRKR  623 (705)
Q Consensus       618 ~~~~~~  623 (705)
                      +++.+.
T Consensus       574 ~~~l~~  579 (597)
T 2xpi_A          574 HESLAI  579 (597)
T ss_dssp             HHHHHH
T ss_pred             HHHHhc
Confidence            777654



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 705
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-04
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 45.4 bits (106), Expect = 1e-05
 Identities = 29/225 (12%), Positives = 76/225 (33%), Gaps = 10/225 (4%)

Query: 390 NLLNACANLADLQLGRQAHTHVVKHGLRFLSGEESDIFVGNSLIDMYMKCGSVEDGCRIF 449
           N   A +NL  +   +      + H  + ++ + + +    +L ++  +    +     +
Sbjct: 167 NFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAY 226

Query: 450 ETMVERDWV---SWNAMIVGCAQNGYGTEALGLFKKMLLCGEKPDHVTMIGVL-CACSHA 505
              +            +     + G    A+  +++ +    +P        L  A    
Sbjct: 227 LRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAI--ELQPHFPDAYCNLANALKEK 284

Query: 506 GLVEEGRKYFSSMSKEHGLAPLKDHYTCMVDLLGRAGCLDEAKTLIE-AMPMQPD-AVIW 563
           G V E    +++  +        D    + ++    G ++EA  L   A+ + P+ A   
Sbjct: 285 GSVAEAEDCYNTALRLC--PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAH 342

Query: 564 GSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYVLLSNMYAELG 608
            +L +  +    +       K+ + I P+ +  Y  + N   E+ 
Sbjct: 343 SNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query705
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.9
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.89
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.6
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.55
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.12
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.05
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.01
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.0
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.98
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.98
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.97
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.96
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.9
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.81
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.72
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.59
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.59
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.58
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.54
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.49
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.47
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.45
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.45
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.41
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.39
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.37
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.36
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.32
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.28
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.22
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.22
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.2
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.14
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.12
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.12
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.12
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.02
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.97
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.85
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.83
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.78
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.77
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.77
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.74
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.72
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.59
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.53
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.51
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.48
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.31
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.18
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.05
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.96
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.21
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.19
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 95.54
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.26
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.19
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.89
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 91.41
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 91.34
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 88.44
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 82.8
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90  E-value=1.5e-20  Score=191.10  Aligned_cols=369  Identities=13%  Similarity=0.089  Sum_probs=263.7

Q ss_pred             HHHHhcCChhHHHHHHHHHHHCCCCC-CHhHHHHHHHHHHccCChHHHHHHHHHHHHcCCCCCChhHHHHHHHHHHhcCC
Q 005265          225 TCYEQNGPASDALEVFVRMMASGIEP-DEVTLASVVSACASLAAFKEGLQIHARLMRCEKLRNDLVLGNALVDMYAKCGK  303 (705)
Q Consensus       225 ~~~~~~g~~~~A~~~~~~m~~~g~~p-~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~  303 (705)
                      ..+.+.|++++|++.|+++.+.  .| +...+..+...+...|++++|...++.+++..  +.+..++..+...|.+.|+
T Consensus         7 ~~~~~~G~~~~A~~~~~~~l~~--~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~--p~~~~a~~~l~~~~~~~g~   82 (388)
T d1w3ba_           7 HREYQAGDFEAAERHCMQLWRQ--EPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN--PLLAEAYSNLGNVYKERGQ   82 (388)
T ss_dssp             HHHHHHTCHHHHHHHHHHHHHH--CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC--TTCHHHHHHHHHHHHHHTC
T ss_pred             HHHHHcCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC--CCCHHHHHHHHHHhhhhcc
Confidence            3344555566666666555543  23 23444455555555566666666666655542  3344555556666666666


Q ss_pred             hHHHHHHHhhCCCC---CcccHHHHHHHHHhcCCHHHHHHHHHhc---CCCCeehHHHHHHHHHHcCChHHHHHHHHHhh
Q 005265          304 LNEARCVFDRMPIR---NVVSETSMVSGYAKASSVKSARLMFTKM---LERNVVSWNALIAGYTQNGENEEALGLFRLLK  377 (705)
Q Consensus       304 ~~~A~~~~~~~~~~---~~~~~~~li~~~~~~~~~~~A~~~~~~~---~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~  377 (705)
                      +++|...+......   +...+..........+....+.......   ..................+....+...+....
T Consensus        83 ~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (388)
T d1w3ba_          83 LQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAI  162 (388)
T ss_dssp             HHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHH
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHhh
Confidence            66666555554321   1122222222222222222222222222   23344455556666777788888888877776


Q ss_pred             hCCCCcchhhHHHHHHHHhhcccHHHHHHHHHHHHHhCCCCCCCCCCcHhHHHHHHHHHHhcCCHHHHHHHHHccC---C
Q 005265          378 RESVCPTHYTFGNLLNACANLADLQLGRQAHTHVVKHGLRFLSGEESDIFVGNSLIDMYMKCGSVEDGCRIFETMV---E  454 (705)
Q Consensus       378 ~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~---~  454 (705)
                      ... +-+...+..+...+...++++.|...+....+..       +.+..++..+...+...|++++|...+++..   .
T Consensus       163 ~~~-~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-------p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~  234 (388)
T d1w3ba_         163 ETQ-PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLD-------PNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSP  234 (388)
T ss_dssp             HHC-TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHC-------TTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHCT
T ss_pred             ccC-cchhHHHHhhcccccccCcHHHHHHHHHHHHHhC-------cccHHHHHHHhhhhhccccHHHHHHHHHHhHHHhh
Confidence            543 2344566677778888899999999999888876       4677888999999999999999999998765   3


Q ss_pred             CChhHHHHHHHHHHHcCChHHHHHHHHHHHHCCCCCCh-hhHHHHHHHHhccCcHHHHHHHHHHhHHhcCCCCChhHHHH
Q 005265          455 RDWVSWNAMIVGCAQNGYGTEALGLFKKMLLCGEKPDH-VTMIGVLCACSHAGLVEEGRKYFSSMSKEHGLAPLKDHYTC  533 (705)
Q Consensus       455 ~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~-~~~~~ll~~~~~~g~~~~a~~~~~~~~~~~~~~p~~~~~~~  533 (705)
                      .+...|..+...+.+.|++++|+..|++.++  +.|+. .++..+..++...|++++|.+.++.....  .+.+...+..
T Consensus       235 ~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~--~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~--~~~~~~~~~~  310 (388)
T d1w3ba_         235 NHAVVHGNLACVYYEQGLIDLAIDTYRRAIE--LQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRL--CPTHADSLNN  310 (388)
T ss_dssp             TCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--TCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH--CTTCHHHHHH
T ss_pred             hHHHHHHHHHHHHHHCCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhcc--CCccchhhhH
Confidence            4677888899999999999999999999998  56765 57888899999999999999999988654  3445788899


Q ss_pred             HHHHHHhcCChHHHHHHHHhC-CCCC-CHHHHHHHHHHHHhcCCHHHHHHHHHHHHhhCCCCCchHHHHHHHHHhcCC
Q 005265          534 MVDLLGRAGCLDEAKTLIEAM-PMQP-DAVIWGSLLAACKVHRNIMLGEYVAKKLLEIEPSNSGPYVLLSNMYAELGR  609 (705)
Q Consensus       534 l~~~~~~~g~~~~A~~~~~~~-~~~p-~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~  609 (705)
                      +..++.+.|++++|++.|++. ...| +..+|..+...+...|++++|...|+++++++|+++.+|..|+.+|.+.|+
T Consensus       311 l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         311 LANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            999999999999999999986 5566 466888899999999999999999999999999999999999999999886



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure