Citrus Sinensis ID: 005601

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------69

MEGAAAKRKAEEYVSDNKRLKGIGICSPDGPLSLDDFRSLQRSNTELRKQLESQVLEIDKLRNENRVVVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRVDRENAEADLKAAVQKSQLETQEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREELESEKAAREVAWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTLEDEENYENTSVDIDLCVPDGENSRTIVGEKLPNGHHSNSAAKADSSGEASTTEKHDCDIRSQEEGQNTQEAEFTSGDRTCKGGFGSDIDGVGTGPILEGDPIGTEQVHETESPGIDGEQNIDLNKPETLAGETMQLEDEAHGHEIDEQIPPTCQETVNHSQLNNPLSQKTMEDTIRTADLLASEVAGSWACSTAPSVHGENESPRSRDNNEEGPLGPHDFSAQAAESQNLPSSKAAPTKWSHDRQALCEMIGIVTPELKVQFGGAVDNDLHQGTGKSGSISSSDTECCGDSDDNDGADTKCSGADNDGSNPADEDQNNKDDAMDEDDEATQEDSVG

ccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHccccccccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccHHHHccccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccc

ccccHHHHHHHHHHHHccHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEcccccHHHHHHcccccccccccccHHHccccccccccccHHcccccccccHHHHHHHccccccccccHHcccccccHHHcccHHcccccHHccccccHHHHHHHHHHHHHHHHHHHccHHHcccccccccccccccccccccccccccccccEEEcccccccHHHHHHHcccHHHHHHHHHHcccHHHHHHcccccccccccccccccccccccccccccccccccccccEccccccccccccHHccccccccccccccccccccc

MEGAAAKRKAEEYVsdnkrlkgigicspdgplslddfRSLQRSNTELRKQLESQVLEIDKLRNENRVVVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRVDRENAEADLKAAVQKSQLETQEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREELESEKAAREVAWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTLEdeenyentsvdidlcvpdgensrtivgeklpnghhsnsaakadssgeasttekhdcdirsqeegqntqeaeftsgdrtckggfgsdidgvgtgpilegdpigteqvhetespgidgeqnidlnkpetlagetmqledeahgheideqipptcqetvnhsqlnnplsqktmEDTIRTADLLASEVAgswacstapsvhgenesprsrdnneegplgphdfsaqaaesqnlpsskaaptkwshDRQALCEMIgivtpelkvqfggavdndlhqgtgksgsisssdteccgdsddndgadtkcsgadndgsnpadedqnnkddamdeddeatqedsvg

megaaakrkaeeyvsdnkrlkgigicspdgplSLDDFRSLQRSNTELRKQLesqvleidklrnenrvvVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANeimksqkvtidelktqldeernlrrvdRENAEADLKAavqksqletqeKLKRLSDAASRRELEQQEVINKlqiaekqsslqveslklkldetrerlvtsdnkvrlletqvckeqnvsaswkkRVEELENEIKKLREELESEKAAREVAWakvsgleldilaatrdldfERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTledeenyentsvdidlcvPDGENSRTIVgeklpnghhsnsaakadssgeastTEKHDCdirsqeegqntqeaeftsgdrtcKGGFGSDIDGVGTGPILEGDPIGTEQVHETespgidgeqnidLNKPETLAGETMQLEDEAHGHEIDEQIPPTCQETVNHSQLNNPLSQKTMEDTIRTADLLASEVAGSWACSTApsvhgenesprSRDNNEEGPLGPHDFSAQAAESQNLPSSKAAPTKWSHDRQALCEMIGIVTPELKVQFGGAVDNDLHQGtgksgsisssdtECCGDSDDNDGADTKcsgadndgsnpadedqnnkdDAMDEDDEatqedsvg

MEGAAAKRKAEEYVSDNKRLKGIGICSPDGPLSLDDFRSLQRSNTELRKQLESQVLEIDKLRNENrvvverhekemkemkesvsISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRVDRENAEADLKAAVQKSQLETQEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREELESEKAAREVAWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTLEDEENYENTSVDIDLCVPDGENSRTIVGEKLPNGHHSNSAAKADSSGEASTTEKHDCDIRSQEEGQNTQEAEFTSGDRTCKGGFGSDIDGVGTGPILEGDPIGTEQVHETESPGIDGEQNIDLNKPETLAGETMQLEDEAHGHEIDEQIPPTCQETVNHSQLNNPLSQKTMEDTIRTADLLASEVAGSWACSTAPSVHGENESPRSRDNNEEGPLGPHDFSAQAAESQNLPSSKAAPTKWSHDRQALCEMIGIVTPELKVQFGGAVDNDLHQGTGKSGSISSSDTECCGDSDDNDGADTKCSGADNDGSNPADEDQNNKDDAMDEDDEATQEDSVG

************************I***********************************************************ISYLHQLKVLRDM**********************************************************************************************************************************************VRLLETQVC**********************************EVAWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFAR**********************VDIDLCV******************************************************************************************************************************************************************LLASEVAGSWAC****************************************************RQALCEMIGIVTPELKVQFGGAVD*********************************************************************

*******************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************EVAGSWA**************************************************SHDRQALCEMIGIVTPELKVQFG*************************************************************************

*************VSDNKRLKGIGICSPDGPLSLDDFRSLQRSNTELRKQLESQVLEIDKLRNENRVVVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRVDRENAEADLKAAVQKSQLETQEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREELESEKAAREVAWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTLEDEENYENTSVDIDLCVPDGENSRTIVGEKLPNG***************************************TSGDRTCKGGFGSDIDGVGTGPILEGDPIGTEQVHETESPGIDGEQNIDLNKPETLAGETMQLEDEAHGHEIDEQIPPTCQETVNHSQLNNPLSQKTMEDTIRTADLLASEVAGSWACS*********************PLGPHDFSAQ*******************DRQALCEMIGIVTPELKVQFGGAVDNDLHQG*******************DNDGADTKCSGAD*******************************

*******************LKGIGICSPDGPLSLDDFRSLQRSNTELRKQLESQVLEIDKLRNENRVVVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRVDRENAEADLKAAVQKSQLETQEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREELESEKAAREVAWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTLEDEENYENTSVDIDLCVPDGENSRTIVGEKL************************************************************************************************************************************NPLSQKTMEDTIRTADLLASEVAGSWACSTAPS*****************************E**NLPSSKAAPTKWSHDRQALCEMIGIVTPELKVQFG*************************************************************************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEGAAAKRKAEEYVSDNKRLKGIGICSPDGPLSLDDFRSLQRSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVSISYLHQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSASMQSCTEANEIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQxxxxxxxxxxxxxxxxxxxxxxxxxxxxVCKEQNVxxxxxxxxxxxxxxxxxxxxxxxxxxxxREVAWAKVSGLELDxxxxxxxxxxxxxxxxxxxxxIMLRETQLRAFYSTTEEISVLxxxxxxxxxxxxxxxxxxxxxENTSVDIDLCVPDGENSRTIVGEKLPNGHHSNSAAKADSSGEASTTEKHDCDIRSQEEGQNTQEAEFTSGDRTCKGGFGSDIDGVGTGPILEGDPIGTEQVHETESPGIDGEQNIDLNKPETLAGETMQLEDEAHGHEIDEQIPPTCQETVNHSQLNNPLSQKTMEDTIRTADLLASEVAGSWACSTAPSVHGENESPRSRDNNEEGPLGPHDFSAQAAESQNLPSSKAAPTKWSHDRQALCEMIGIVTPELKVQFGGAVDNDLHQGTGKSGSISSSDTECCGDSDDNDGADTKCSGADNDGSNPxxxxxxxxxxxxxxxxxxxxxDSVG

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		688
359489534		910	PREDICTED: uncharacterized protein LOC10	0.989	0.748	0.633	0.0
255541346		900	conserved hypothetical protein [Ricinus	0.965	0.737	0.638	0.0
356566838		881	PREDICTED: uncharacterized protein LOC10	0.947	0.740	0.594	0.0
296089166		815	unnamed protein product [Vitis vinifera]	0.850	0.717	0.587	0.0
449522151		868	PREDICTED: uncharacterized LOC101216456,	0.917	0.726	0.566	0.0
449433117		893	PREDICTED: uncharacterized protein LOC10	0.917	0.706	0.563	0.0
334184923		902	SMAD/FHA domain-containing protein [Arab	0.946	0.721	0.515	1e-170
30690030		915	SMAD/FHA domain-containing protein [Arab	0.946	0.711	0.506	1e-169
334184921		916	SMAD/FHA domain-containing protein [Arab	0.946	0.710	0.506	1e-167
297828263		916	forkhead-associated domain-containing pr	0.946	0.710	0.514	1e-163

>gi\|359489534\|ref\|XP_002273779.2\| PREDICTED: uncharacterized protein LOC100260735 [Vitis vinifera]	Back alignment and taxonomy information

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/712 (63%), Positives = 538/712 (75%), Gaps = 31/712 (4%)

Query: 4   AAAKRKAEEYVSDNKRLKGIGICSPDGPLSLDDFRSLQRSNTELRKQLESQVLEIDKLRN 63
           A  KRKAEE   +NKR+KGIGI +P+GP+SLDDFRSLQRSNTELRKQLE+QVL ID L+N
Sbjct: 203 AVPKRKAEELRIENKRIKGIGIGAPEGPISLDDFRSLQRSNTELRKQLENQVLTIDTLQN 262

Query: 64  ENRVVVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLN 123
           ENR  +ERHE EMKE+KE VS  Y+ QL+ L  +L+ KQKEL E++RI AEQKH M DLN
Sbjct: 263 ENRAAIERHENEMKELKELVSKPYVDQLQELHHLLEVKQKELVEVNRILAEQKHAMSDLN 322

Query: 124 DRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRVDRENAEADLKAAVQKSQLET 183
           +RLSASMQSC EANEIM SQK +I +L+ +LDEE++ R  +RE A ADLKAA+ ++Q E 
Sbjct: 323 ERLSASMQSCAEANEIMTSQKASISKLEARLDEEQDQRMEEREKATADLKAAIHRAQSEA 382

Query: 184 QEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLL 243
           QE++KRLS+ A RRE E QEVIN+LQ +EK+  L VE+L+ KL++TR++LV SDNKVR L
Sbjct: 383 QEEIKRLSEVALRRERELQEVINRLQESEKERCLLVETLRSKLEDTRQKLVISDNKVRQL 442

Query: 244 ETQVCKEQNVSASWKKRVEELENEIKKLREELESEK-AAREVAWAKVSGLELDILAATRD 302
           ETQVC+EQ  SA  +KR EEL++E+ +LR+ELESEK AARE AWAKVS LEL+I AA RD
Sbjct: 443 ETQVCEEQLASADGRKRAEELQHEMTRLRKELESEKQAAREEAWAKVSMLELEINAAMRD 502

Query: 303 LDFERRRLKAARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTLEDEENYENTS 362
           LDFERRRLK ARERIMLRETQLRAFYSTTEEIS LFA+QQEQLKAMQ+TLEDE+NYENTS
Sbjct: 503 LDFERRRLKGARERIMLRETQLRAFYSTTEEISNLFAKQQEQLKAMQRTLEDEDNYENTS 562

Query: 363 VDIDLCVPDGENSRTIVGEKLPNGHHSNSAAKA---------------DSSGEASTTEKH 407
           VDIDL   +G  + T++ EK   G  S+SAAK                 SS EAS TEKH
Sbjct: 563 VDIDLNPTNGFINGTVIREKEAIGFRSSSAAKTGSATSAQRFGRNLAETSSNEASVTEKH 622

Query: 408 DCDIRSQEEGQNTQEAEFTSGDRTCKGGFGSDIDGVGTGPILEGDPIGTEQVHETESPGI 467
           DCDIR+QE   NTQEAEFTS D   KGGFGSDIDGVGT P LEGDPI TE+V ETESPGI
Sbjct: 623 DCDIRTQE---NTQEAEFTSADCLVKGGFGSDIDGVGTAPALEGDPIETERVMETESPGI 679

Query: 468 DGEQNIDLNKPETLAGETMQLEDEAHGHEIDEQIPPTCQETVNHSQLNNPLSQ-KTMED- 525
           +GE+NIDLNK   LAG+TMQ++DEAH  E +E       E  +HSQ N+     K+MED 
Sbjct: 680 NGEKNIDLNKCIDLAGDTMQIDDEAHIRETEEPGRINRGEGSHHSQSNSGFENLKSMEDT 739

Query: 526 ----TIRTADLLASEVAGSWACSTAPSVHGENESPRSRDNNEEGPLGPHDFSAQAAESQN 581
               TIRTADLLASEVAGSWACSTAPSVHGENESP+SRD+++  P+  HD + Q AESQ 
Sbjct: 740 EAGGTIRTADLLASEVAGSWACSTAPSVHGENESPKSRDHDQNHPVALHDANGQVAESQT 799

Query: 582 LPSSKAAPTKWSHDRQALCEMIGIVTPELKVQFGGAVDNDLHQGTGKSGSISSSDTECCG 641
            PSS+ A  + S + QAL EMIGIV P+LK QFGGA D+D   G  K G  S+SDTE C 
Sbjct: 800 NPSSEVAANRLSREPQALSEMIGIVAPDLKEQFGGAGDDDYDGGREKGGCTSNSDTENCT 859

Query: 642 DSDDND-----GADTKCSGADNDGSNPADEDQNNKDDAMDEDDEATQEDSVG 688
           DS D+D       D   S A+ +G + ADED+ N+++AM+EDDEATQE S+G
Sbjct: 860 DSSDDDYVRVHAKDGSISDAETEGGDQADEDE-NRNEAMEEDDEATQEGSLG 910

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|255541346\|ref\|XP_002511737.1\| conserved hypothetical protein [Ricinus communis] gi\|223548917\|gb\|EEF50406.1\| conserved hypothetical protein [Ricinus communis]	Back alignment and taxonomy information

>gi\|356566838\|ref\|XP_003551633.1\| PREDICTED: uncharacterized protein LOC100807844 [Glycine max]	Back alignment and taxonomy information

>gi\|296089166\|emb\|CBI38869.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449522151\|ref\|XP_004168091.1\| PREDICTED: uncharacterized LOC101216456, partial [Cucumis sativus]	Back alignment and taxonomy information

>gi\|449433117\|ref\|XP_004134344.1\| PREDICTED: uncharacterized protein LOC101216456 [Cucumis sativus]	Back alignment and taxonomy information

>gi\|334184923\|ref\|NP_001189751.1\| SMAD/FHA domain-containing protein [Arabidopsis thaliana] gi\|330255464\|gb\|AEC10558.1\| SMAD/FHA domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|30690030\|ref\|NP_850437.1\| SMAD/FHA domain-containing protein [Arabidopsis thaliana] gi\|330255462\|gb\|AEC10556.1\| SMAD/FHA domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|334184921\|ref\|NP_001189750.1\| SMAD/FHA domain-containing protein [Arabidopsis thaliana] gi\|330255463\|gb\|AEC10557.1\| SMAD/FHA domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297828263\|ref\|XP_002882014.1\| forkhead-associated domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi\|297327853\|gb\|EFH58273.1\| forkhead-associated domain-containing protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		688
UNIPROTKB\|F1PJ01		1972	MYH11 "Uncharacterized protein	0.597	0.208	0.238	3.3e-11
UNIPROTKB\|F1MYM9		1973	MYH11 "Uncharacterized protein	0.593	0.206	0.243	4.3e-11
UNIPROTKB\|F1MQ37		1964	MYH9 "Uncharacterized protein"	0.720	0.252	0.217	5.4e-11
MGI\|MGI:102643		1972	Myh11 "myosin, heavy polypepti	0.600	0.209	0.242	8.9e-11
ZFIN\|ZDB-GENE-030131-5870		1964	myh9a "myosin, heavy polypepti	0.454	0.159	0.243	1.1e-10
ZFIN\|ZDB-GENE-030616-583		1376	acin1a "apoptotic chromatin co	0.459	0.229	0.250	1.6e-10
RGD\|1307994		1941	Myh7b "myosin, heavy chain 7B,	0.452	0.160	0.269	2.4e-10
UNIPROTKB\|P35579		1960	MYH9 "Myosin-9" [Homo sapiens	0.606	0.212	0.231	2.4e-10
UNIPROTKB\|P35748		1972	MYH11 "Myosin-11" [Oryctolagus	0.595	0.207	0.242	3.1e-10
ZFIN\|ZDB-GENE-050531-1		1974	myh11a "myosin, heavy polypept	0.664	0.231	0.233	4e-10

UNIPROTKB\|F1PJ01 MYH11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

 Score = 195 (73.7 bits), Expect = 3.3e-11, P = 3.3e-11
 Identities = 113/473 (23%), Positives = 222/473 (46%)

Query:    90 QLKVLRDMLDAKQ--KELAEISRISAEQK-HEMEDLNDRLSASMQSCTEANEIMKSQKVT 146
             Q+  L + L+ ++  ++  ++ +++AE K  ++ED  D L    Q+    N++ K +K+ 
Sbjct:   951 QMLDLEEQLEEEEAARQKLQLEKVTAEAKIKKLED--DILVMDDQN----NKLSKERKLL 1004

Query:   147 ---IDELKTQLDEE----RNLRRVDR--ENAEADLKAAVQKSQLETQEKLKRLSDAASRR 197
                I +L T L EE    +NL ++    E+  ++L+  ++K +   QE L++L     +R
Sbjct:  1005 EERISDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQE-LEKL-----KR 1058

Query:   198 ELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASW 257
             +LE +      QIA+ Q+  Q+  LK++L +  E L  +  +   L+ ++ ++ N     
Sbjct:  1059 KLEGEASDFHEQIADLQA--QIAELKMQLAKKEEELQAALGR---LDDEIAQKNNAL--- 1110

Query:   258 KKRVEELENEIKKLREELESEKAAREVAWAKVSGL--ELDILAA----TRDLDFERRRLK 311
              K++ ELE  I  L+E+L+SE+AAR  A  +   L  EL+ L      T D    ++ L+
Sbjct:  1111 -KKIRELEGHISDLQEDLDSERAARNKAEKQKRDLGEELEALKTELEDTLDSTATQQELR 1169

Query:   312 AARERIMLRETQLRAFYSTTEEISVLFARQQEQLKAMQKTLEDEENYENTSVDIDLCVPD 371
             A RE+ +    +     + + E  V   RQ+   +A+++  E  E ++    ++D     
Sbjct:  1170 AKREQEVTVLKKALDEETRSHEAQVQEMRQKHT-QAVEELTEQLEQFKRAKANLD----- 1223

Query:   372 GENSRTIVGEKLPNGHHSNSAAKADSSGEASTTEKHDCDIRSQEEGQNTQEAEFTSGDRT 431
              +N +T+  EK  N   +      + + +    +K   +++ QE      + E    +  
Sbjct:  1224 -KNKQTL--EK-ENADLAGELRVLNQAKQEVEHKKKKLEVQLQELQSKCSDGERARAELN 1279

Query:   432 CK-GGFGSDIDGVGTGPILEGDPIGTEQVHETESPGIDGEQNIDLNKPET-----LAGET 485
              K     ++++ V TG + E +    +   +  S G   +   +L + ET     ++ + 
Sbjct:  1280 DKVHKLQNEVESV-TGMLNEAEGKAIKLAKDVASLGSQLQDTQELLQEETRQKLNVSTKL 1338

Query:   486 MQLEDEAHG--HEIDEQIPPTCQETVNH-SQLNNPLS--QKTMEDTIRTADLL 533
              QLEDE +    ++DE++    Q    H S LN  LS  +K ++D   T + L
Sbjct:  1339 RQLEDERNSLQDQLDEEMEAK-QNLERHISTLNIQLSDSKKKLQDFASTVEAL 1390

GO:0048739 "cardiac muscle fiber development" evidence=IEA

GO:0048251 "elastic fiber assembly" evidence=IEA

GO:0030485 "smooth muscle contractile fiber" evidence=IEA

GO:0008307 "structural constituent of muscle" evidence=IEA

GO:0006939 "smooth muscle contraction" evidence=IEA

GO:0005859 "muscle myosin complex" evidence=IEA

GO:0003774 "motor activity" evidence=IEA

GO:0001725 "stress fiber" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0003779 "actin binding" evidence=IEA

UNIPROTKB\|F1MYM9 MYH11 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MQ37 MYH9 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

MGI\|MGI:102643 Myh11 "myosin, heavy polypeptide 11, smooth muscle" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-5870 myh9a "myosin, heavy polypeptide 9a, non-muscle" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030616-583 acin1a "apoptotic chromatin condensation inducer 1a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

RGD\|1307994 Myh7b "myosin, heavy chain 7B, cardiac muscle, beta" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|P35579 MYH9 "Myosin-9" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|P35748 MYH11 "Myosin-11" [Oryctolagus cuniculus (taxid:9986)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-050531-1 myh11a "myosin, heavy polypeptide 11, smooth muscle a" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00026367001	SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (878 aa)
		(Vitis vinifera)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		688
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	4e-12
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	7e-11
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	7e-11
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	1e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	3e-09
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-08
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-07
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	7e-07
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	9e-07
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	2e-06
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	3e-06
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	4e-06
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	1e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	4e-05
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	6e-05
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	1e-04
pfam02463		1162	pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	1e-04
pfam01576		859	pfam01576, Myosin_tail_1, Myosin tail	1e-04
PRK12704		520	PRK12704, PRK12704, phosphodiesterase; Provisional	3e-04
PRK11281		1113	PRK11281, PRK11281, hypothetical protein; Provisio	4e-04
pfam09730		711	pfam09730, BicD, Microtubule-associated protein Bi	5e-04
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	0.001
PRK03918		880	PRK03918, PRK03918, chromosome segregation protein	0.001
COG3264		835	COG3264, COG3264, Small-conductance mechanosensiti	0.001
TIGR01843		423	TIGR01843, type_I_hlyD, type I secretion membrane	0.001
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.002
COG4942		420	COG4942, COG4942, Membrane-bound metallopeptidase	0.002
COG5022		1463	COG5022, COG5022, Myosin heavy chain [Cytoskeleton	0.003
PRK12705		508	PRK12705, PRK12705, hypothetical protein; Provisio	0.004

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

 Score = 69.7 bits (171), Expect = 4e-12
 Identities = 69/324 (21%), Positives = 138/324 (42%), Gaps = 35/324 (10%)

Query: 7   KRKAEEYVSDNKRLKGIGICSPDGPLSLDDFRSLQRSNTELRKQLESQVLEIDKL---RN 63
             KAE Y      L+ +     +  L L   + L++   EL ++L     E+++L     
Sbjct: 209 AEKAERYQELKAELREL-----ELALLLAKLKELRKELEELEEELSRLEEELEELQEELE 263

Query: 64  ENRVVVERHEKEMKEMKESVSISYLHQLKVLRDMLDAKQKELAEISRISAEQKHEMEDLN 123
           E    +E  + E++E++E                L+  Q+EL E+     E + E+  L 
Sbjct: 264 EAEKEIEELKSELEELREE---------------LEELQEELLELKEEIEELEGEISLLR 308

Query: 124 DRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRRVDRENAEADLKAAVQKSQLET 183
           +RL        E  E ++  K  I+ LK +L+E   L   + E   A+L+ A +    E 
Sbjct: 309 ERLEELENELEELEERLEELKEKIEALKEELEERETLLE-ELEQLLAELEEAKE----EL 363

Query: 184 QEKLKRLSDAASRRELEQQEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLL 243
           +EKL  L +         +E + +L+    +   ++E LK +++   ERL     ++  L
Sbjct: 364 EEKLSALLEELEELFEALREELAELEAELAEIRNELEELKREIESLEERLERLSERLEDL 423

Query: 244 ETQVCKEQNVSASWKKRVEELENEIKKLREELESEKAAREVAWAKVSGLELDILAATRDL 303
           + ++ + +      +  +EEL  E+++L E+LE  +   +    +++ L+ ++       
Sbjct: 424 KEELKELEAELEELQTELEELNEELEELEEQLEELRDRLKELERELAELQEELQRL---- 479

Query: 304 DFERRRLKAARERIMLRETQLRAF 327
               + L +   R+   E + RA 
Sbjct: 480 ---EKELSSLEARLDRLEAEQRAS 500

Length = 1163

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain	Back alignment and domain information

>gnl\|CDD\|144972 pfam01576, Myosin_tail_1, Myosin tail	Back alignment and domain information

>gnl\|CDD\|237177 PRK12704, PRK12704, phosphodiesterase; Provisional	Back alignment and domain information

>gnl\|CDD\|236892 PRK11281, PRK11281, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|220368 pfam09730, BicD, Microtubule-associated protein Bicaudal-D	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|225803 COG3264, COG3264, Small-conductance mechanosensitive channel [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>gnl\|CDD\|130902 TIGR01843, type_I_hlyD, type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|227278 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton]	Back alignment and domain information

>gnl\|CDD\|237178 PRK12705, PRK12705, hypothetical protein; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		688
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	100.0
PF00038		312	Filament: Intermediate filament protein; InterPro:	100.0
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	99.1
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	99.09
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.05
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	98.99
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	98.96
PRK02224		880	chromosome segregation protein; Provisional	98.95
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.92
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	98.86
PRK02224		880	chromosome segregation protein; Provisional	98.83
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	98.71
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	98.67
PF00038		312	Filament: Intermediate filament protein; InterPro:	98.66
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	98.65
PRK03918		880	chromosome segregation protein; Provisional	98.62
PHA02562		562	46 endonuclease subunit; Provisional	98.61
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	98.58
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	98.52
PRK03918		880	chromosome segregation protein; Provisional	98.5
PRK11637		428	AmiB activator; Provisional	98.46
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.46
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	98.41
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	98.4
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	98.38
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.37
KOG0964		1200	consensus Structural maintenance of chromosome pro	98.35
KOG0996		1293	consensus Structural maintenance of chromosome pro	98.33
PRK11637		428	AmiB activator; Provisional	98.31
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.3
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	98.25
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	98.24
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	98.23
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	98.22
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	98.2
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	98.09
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	98.09
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	98.08
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	97.99
KOG0996		1293	consensus Structural maintenance of chromosome pro	97.96
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	97.94
PRK01156		895	chromosome segregation protein; Provisional	97.92
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	97.91
COG4942		420	Membrane-bound metallopeptidase [Cell division and	97.91
KOG0971		1243	consensus Microtubule-associated protein dynactin	97.88
PRK01156		895	chromosome segregation protein; Provisional	97.86
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	97.86
PHA02562		562	46 endonuclease subunit; Provisional	97.85
KOG4673		961	consensus Transcription factor TMF, TATA element m	97.84
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	97.83
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	97.82
KOG0933		1174	consensus Structural maintenance of chromosome pro	97.82
PRK04863		1486	mukB cell division protein MukB; Provisional	97.82
PRK04863		1486	mukB cell division protein MukB; Provisional	97.81
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	97.81
PRK09039		343	hypothetical protein; Validated	97.81
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	97.76
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	97.73
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	97.72
COG4942		420	Membrane-bound metallopeptidase [Cell division and	97.7
KOG0963		629	consensus Transcription factor/CCAAT displacement	97.65
PF13514		1111	AAA_27: AAA domain	97.65
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	97.64
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	97.63
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	97.62
COG4372		499	Uncharacterized protein conserved in bacteria with	97.61
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	97.57
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	97.57
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	97.56
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	97.55
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	97.53
PRK04778		569	septation ring formation regulator EzrA; Provision	97.51
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	97.51
KOG0933		1174	consensus Structural maintenance of chromosome pro	97.51
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	97.5
KOG4673		961	consensus Transcription factor TMF, TATA element m	97.49
PRK09039		343	hypothetical protein; Validated	97.49
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	97.47
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	97.47
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	97.44
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	97.44
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	97.43
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	97.38
PF14662		193	CCDC155: Coiled-coil region of CCDC155	97.34
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	97.31
PF06705		247	SF-assemblin: SF-assemblin/beta giardin	97.29
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	97.29
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	97.29
PRK04778		569	septation ring formation regulator EzrA; Provision	97.29
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	97.25
PRK11281		1113	hypothetical protein; Provisional	97.19
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	97.18
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	97.17
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	97.14
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	97.14
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	97.14
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	97.04
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	97.03
KOG0018		1141	consensus Structural maintenance of chromosome pro	97.01
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	96.96
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	96.94
KOG0963		629	consensus Transcription factor/CCAAT displacement	96.92
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	96.91
KOG0971		1243	consensus Microtubule-associated protein dynactin	96.84
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	96.81
KOG1003		205	consensus Actin filament-coating protein tropomyos	96.77
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	96.74
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	96.74
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	96.67
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	96.66
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	96.62
PRK10929		1109	putative mechanosensitive channel protein; Provisi	96.61
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	96.56
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	96.56
COG5185		622	HEC1 Protein involved in chromosome segregation, i	96.55
PF12718		143	Tropomyosin_1: Tropomyosin like; InterPro: IPR0005	96.55
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	96.54
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	96.53
PF14662		193	CCDC155: Coiled-coil region of CCDC155	96.51
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	96.46
PF13514		1111	AAA_27: AAA domain	96.45
PF07926		132	TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro:	96.45
PRK10929		1109	putative mechanosensitive channel protein; Provisi	96.43
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	96.41
PF09731		582	Mitofilin: Mitochondrial inner membrane protein; I	96.4
PF10186		302	Atg14: UV radiation resistance protein and autopha	96.4
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	96.38
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	96.37
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	96.3
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	96.29
KOG0982		502	consensus Centrosomal protein Nuf [Cell cycle cont	96.28
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	96.27
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	96.26
PF03148		384	Tektin: Tektin family; InterPro: IPR000435 Tektin	96.26
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	96.26
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	96.22
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	96.21
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	96.2
KOG0018		1141	consensus Structural maintenance of chromosome pro	96.19
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	96.19
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	96.18
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	96.01
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	95.93
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	95.93
KOG0249		916	consensus LAR-interacting protein and related prot	95.81
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	95.79
COG3206		458	GumC Uncharacterized protein involved in exopolysa	95.77
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	95.75
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	95.68
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	95.61
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	95.59
TIGR03017		444	EpsF chain length determinant protein EpsF. Sequen	95.43
COG3206		458	GumC Uncharacterized protein involved in exopolysa	95.39
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	95.36
PF14988		206	DUF4515: Domain of unknown function (DUF4515)	95.36
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	95.35
PF12795		240	MscS_porin: Mechanosensitive ion channel porin dom	95.33
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	95.27
PF15294		278	Leu_zip: Leucine zipper	95.15
KOG2129		552	consensus Uncharacterized conserved protein H4 [Fu	95.14
PF04912		388	Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamit	95.14
TIGR01010		362	BexC_CtrB_KpsE polysaccharide export inner-membran	95.13
PF09731		582	Mitofilin: Mitochondrial inner membrane protein; I	95.11
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	95.11
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	95.07
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	95.06
KOG0249		916	consensus LAR-interacting protein and related prot	94.95
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	94.77
PF04156		191	IncA: IncA protein; InterPro: IPR007285 Chlamydia	94.77
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	94.75
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	94.63
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	94.63
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	94.63
PF10186		302	Atg14: UV radiation resistance protein and autopha	94.56
KOG4677		554	consensus Golgi integral membrane protein [Intrace	94.46
PRK11281		1113	hypothetical protein; Provisional	94.37
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	94.36
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	94.34
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	94.33
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	94.32
PRK10698		222	phage shock protein PspA; Provisional	94.29
PF09787		511	Golgin_A5: Golgin subfamily A member 5; InterPro:	94.22
PF07798		177	DUF1640: Protein of unknown function (DUF1640); In	94.16
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	94.14
COG4477		570	EzrA Negative regulator of septation ring formatio	94.12
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	94.08
COG5185		622	HEC1 Protein involved in chromosome segregation, i	94.06
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	94.04
PF04012		221	PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T	94.03
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	94.0
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	93.97
PRK12704		520	phosphodiesterase; Provisional	93.92
KOG0979		1072	consensus Structural maintenance of chromosome pro	93.89
PRK00106		535	hypothetical protein; Provisional	93.7
PF11559		151	ADIP: Afadin- and alpha -actinin-Binding; InterPro	93.68
KOG0243		1041	consensus Kinesin-like protein [Cytoskeleton]	93.63
TIGR00618		1042	sbcc exonuclease SbcC. This family is based on the	93.6
PRK10246		1047	exonuclease subunit SbcC; Provisional	93.51
PF10168		717	Nup88: Nuclear pore component; InterPro: IPR019321	93.34
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	93.16
KOG0979		1072	consensus Structural maintenance of chromosome pro	93.13
COG4372		499	Uncharacterized protein conserved in bacteria with	93.03
TIGR02971		327	heterocyst_DevB ABC exporter membrane fusion prote	93.0
PF04871		136	Uso1_p115_C: Uso1 / p115 like vesicle tethering pr	93.0
PF10212		518	TTKRSYEDQ: Predicted coiled-coil domain-containing	92.93
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	92.78
PF04156		191	IncA: IncA protein; InterPro: IPR007285 Chlamydia	92.75
PRK10869		553	recombination and repair protein; Provisional	92.72
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	92.72
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	92.64
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	92.45
PRK04406		75	hypothetical protein; Provisional	92.44
PRK12704		520	phosphodiesterase; Provisional	92.39
TIGR00998		334	8a0101 efflux pump membrane protein (multidrug res	92.38
PF04102		69	SlyX: SlyX; InterPro: IPR007236 The SlyX protein h	92.36
PF14073		178	Cep57_CLD: Centrosome localisation domain of Cep57	92.29
PLN03188		1320	kinesin-12 family protein; Provisional	92.17
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	92.16
PRK10361		475	DNA recombination protein RmuC; Provisional	92.12
PRK10476		346	multidrug resistance protein MdtN; Provisional	92.1
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	92.02
KOG2685		421	consensus Cystoskeletal protein Tektin [Cytoskelet	92.01
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	91.96
PRK10246		1047	exonuclease subunit SbcC; Provisional	91.8
KOG4302		660	consensus Microtubule-associated protein essential	91.75
COG4717		984	Uncharacterized conserved protein [Function unknow	91.72
PRK10884		206	SH3 domain-containing protein; Provisional	91.71
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	91.67
PF05276		239	SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int	91.61
PRK11519		719	tyrosine kinase; Provisional	91.58
KOG1265		1189	consensus Phospholipase C [Lipid transport and met	91.52
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	91.33
PRK10869		553	recombination and repair protein; Provisional	91.3
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	91.26
TIGR03319		514	YmdA_YtgF conserved hypothetical protein YmdA/YtgF	91.26
PRK02119		73	hypothetical protein; Provisional	91.17
TIGR01000		457	bacteriocin_acc bacteriocin secretion accessory pr	91.13
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	91.12
KOG4807		593	consensus F-actin binding protein, regulates actin	91.08
TIGR03794		421	NHPM_micro_HlyD NHPM bacteriocin system secretion	91.04
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	91.02
PRK10884		206	SH3 domain-containing protein; Provisional	90.99
PF10212		518	TTKRSYEDQ: Predicted coiled-coil domain-containing	90.82
PF10234		267	Cluap1: Clusterin-associated protein-1; InterPro:	90.78
PRK00295		68	hypothetical protein; Provisional	90.75
KOG3595		1395	consensus Dyneins, heavy chain [Cytoskeleton]	90.67
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	90.58
COG1842		225	PspA Phage shock protein A (IM30), suppresses sigm	90.57
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	90.5
PRK02793		72	phi X174 lysis protein; Provisional	90.4
PF08826		61	DMPK_coil: DMPK coiled coil domain like; InterPro:	90.32
KOG1103		561	consensus Predicted coiled-coil protein [Function	90.21
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	90.21
PRK00736		68	hypothetical protein; Provisional	90.11
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	89.96
COG4026		290	Uncharacterized protein containing TOPRIM domain,	89.96
PF06717		308	DUF1202: Protein of unknown function (DUF1202); In	89.92
PF08581		79	Tup_N: Tup N-terminal; InterPro: IPR013890 The N-t	89.87
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	89.81
PRK04325		74	hypothetical protein; Provisional	89.72
COG2433		652	Uncharacterized conserved protein [Function unknow	89.7
PLN02939		977	transferase, transferring glycosyl groups	89.69
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	89.68
PF05769		181	DUF837: Protein of unknown function (DUF837); Inte	89.64
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	89.61
PF14197		69	Cep57_CLD_2: Centrosome localisation domain of PPC	89.56
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	89.5
PRK10361		475	DNA recombination protein RmuC; Provisional	89.27
COG1842		225	PspA Phage shock protein A (IM30), suppresses sigm	89.13
PF15294		278	Leu_zip: Leucine zipper	89.03
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	88.94
PRK00409		782	recombination and DNA strand exchange inhibitor pr	88.81
PF02050		123	FliJ: Flagellar FliJ protein; InterPro: IPR012823	88.77
PF13166		712	AAA_13: AAA domain	88.73
PRK15178		434	Vi polysaccharide export inner membrane protein Ve	88.6
PRK00106		535	hypothetical protein; Provisional	88.56
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	88.49
KOG1937		521	consensus Uncharacterized conserved protein [Funct	88.03
TIGR01010		362	BexC_CtrB_KpsE polysaccharide export inner-membran	88.02
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	87.93
PF05384		159	DegS: Sensor protein DegS; InterPro: IPR008595 Thi	87.75
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	87.41
TIGR02977		219	phageshock_pspA phage shock protein A. Members of	87.21
KOG0239		670	consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	87.17
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	87.14
TIGR03752		472	conj_TIGR03752 integrating conjugative element pro	87.09
PF06548		488	Kinesin-related: Kinesin-related; InterPro: IPR010	86.85
PF10234		267	Cluap1: Clusterin-associated protein-1; InterPro:	86.82
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	86.76
COG4026		290	Uncharacterized protein containing TOPRIM domain,	86.52
COG3096		1480	MukB Uncharacterized protein involved in chromosom	86.4
COG2433		652	Uncharacterized conserved protein [Function unknow	86.35
TIGR01541		332	tape_meas_lam_C phage tail tape measure protein, l	86.1
PF10211		189	Ax_dynein_light: Axonemal dynein light chain; Inte	86.05
COG3524		372	KpsE Capsule polysaccharide export protein [Cell e	86.04
KOG1003		205	consensus Actin filament-coating protein tropomyos	86.0
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	85.65
PF06785		401	UPF0242: Uncharacterised protein family (UPF0242);	85.62
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	85.59
PF12795		240	MscS_porin: Mechanosensitive ion channel porin dom	85.59
PRK00846		77	hypothetical protein; Provisional	85.28
KOG0517		2473	consensus Beta-spectrin [Cytoskeleton]	85.25
PF15372		129	DUF4600: Domain of unknown function (DUF4600)	85.23
PF13166		712	AAA_13: AAA domain	84.97
PLN03188		1320	kinesin-12 family protein; Provisional	84.91
KOG0964		1200	consensus Structural maintenance of chromosome pro	84.82
KOG4572		1424	consensus Predicted DNA-binding transcription fact	84.79
PF01486		100	K-box: K-box region; InterPro: IPR002487 MADS gene	84.4
COG4913		1104	Uncharacterized protein conserved in bacteria [Fun	84.29
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	84.26
PF02994		370	Transposase_22: L1 transposable element; InterPro:	84.03
PF07798		177	DUF1640: Protein of unknown function (DUF1640); In	84.03
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	83.95
KOG0288		459	consensus WD40 repeat protein TipD [General functi	83.9
KOG0163		1259	consensus Myosin class VI heavy chain [Cytoskeleto	83.82
PF15272		196	BBP1_C: Spindle pole body component BBP1, C-termin	83.57
KOG1655		218	consensus Protein involved in vacuolar protein sor	83.45
PRK09841		726	cryptic autophosphorylating protein tyrosine kinas	83.33
PF11932		251	DUF3450: Protein of unknown function (DUF3450); In	83.32
KOG4809		654	consensus Rab6 GTPase-interacting protein involved	83.27
PRK03598		331	putative efflux pump membrane fusion protein; Prov	83.22
KOG4657		246	consensus Uncharacterized conserved protein [Funct	83.15
PF04065		233	Not3: Not1 N-terminal domain, CCR4-Not complex com	83.1
PF07106		169	TBPIP: Tat binding protein 1(TBP-1)-interacting pr	82.98
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	82.97
CHL00118		156	atpG ATP synthase CF0 B' subunit; Validated	82.8
PF05276		239	SH3BP5: SH3 domain-binding protein 5 (SH3BP5); Int	82.61
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	82.58
TIGR02231		525	conserved hypothetical protein. This family consis	82.26
PF13949		296	ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HI	82.19
KOG4302		660	consensus Microtubule-associated protein essential	81.99
PF05615		139	THOC7: Tho complex subunit 7; InterPro: IPR008501	81.69
KOG1854		657	consensus Mitochondrial inner membrane protein (mi	81.66
TIGR03794		421	NHPM_micro_HlyD NHPM bacteriocin system secretion	81.51
PF01442		202	Apolipoprotein: Apolipoprotein A1/A4/E domain; Int	81.43
PRK10698		222	phage shock protein PspA; Provisional	81.33
KOG1899		861	consensus LAR transmembrane tyrosine phosphatase-i	81.23
TIGR02894		161	DNA_bind_RsfA transcription factor, RsfA family. I	81.08
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	81.05
PF04582		326	Reo_sigmaC: Reovirus sigma C capsid protein; Inter	80.82
PF05266		190	DUF724: Protein of unknown function (DUF724); Inte	80.8
PRK03947		140	prefoldin subunit alpha; Reviewed	80.75
KOG2751		447	consensus Beclin-like protein [Signal transduction	80.38
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	80.28
COG4717		984	Uncharacterized conserved protein [Function unknow	80.27

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

Probab=100.00  E-value=6e-46  Score=401.96  Aligned_cols=262  Identities=19%  Similarity=0.240  Sum_probs=255.5

Q ss_pred             hhhhhhhhhhhhHHHHHhhhhhhhhhccchhhHHHHHhhHHHHHHHHHHH-------------HHHHHHHHHHHHHHHHH
Q 005601           34 LDDFRSLQRSNTELRKQLESQVLEIDKLRNENRVVVERHEKEMKEMKESV-------------SISYLHQLKVLRDMLDA  100 (688)
Q Consensus        34 lDRVR~LE~ENsrLr~QIe~~eeti~tltrEvs~IK~~YEsEL~DARklL-------------~kk~~~EleELk~~L~k  100 (688)
                      .||||+||++|.+|..+|...+.++   .+++++||.+||.||..||++|             ++++|+|+++|++++.+
T Consensus        55 IekVR~LEaqN~~L~~di~~lr~~~---~~~ts~ik~~ye~El~~ar~~l~e~~~~ra~~e~ei~kl~~e~~elr~~~~~  131 (546)
T KOG0977|consen   55 IEKVRFLEAQNRKLEHDINLLRGVV---GRETSGIKAKYEAELATARKLLDETARERAKLEIEITKLREELKELRKKLEK  131 (546)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhc---cCCCcchhHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHH
Confidence            5899999999999999999999999   9999999999999999999999             89999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHhHHHHHHHHhhHHHHHhhhh------hhhhch------
Q 005601          101 KQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEERNLRR------VDRENA------  168 (688)
Q Consensus       101 KeKEL~~ae~~~~~~Es~indLearLsaa~sdrk~aeeelkelkaei~eLe~qLee~RkqLE------VDlEN~------  168 (688)
                      +++.+..+...+.++.+.++.|+++++.+++.++.++++++.+++++.+|..+|..+|++|.      +|++|+      
T Consensus       132 ~~k~~~~~re~~~~~~~~l~~leAe~~~~krr~~~le~e~~~Lk~en~rl~~~l~~~r~~ld~Etllr~d~~n~~q~Lle  211 (546)
T KOG0977|consen  132 AEKERRGAREKLDDYLSRLSELEAEINTLKRRIKALEDELKRLKAENSRLREELARARKQLDDETLLRVDLQNRVQTLLE  211 (546)
T ss_pred             HHHHHhhhHHHHHHHhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHhHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999988      788887      


Q ss_pred             --------------------------------HHHHHHHHHHHHHHHHHHhhhhhHHHHHHhHHH---------------
Q 005601          169 --------------------------------EADLKAAVQKSQLETQEKLKRLSDAASRRELEQ---------------  201 (688)
Q Consensus       169 --------------------------------EakLqqALqeLR~Qa~ee~kr~~Daq~r~nReE---------------  201 (688)
                                                      .++|++||++||+|        ||+++++||++               
T Consensus       212 el~f~~~~h~~eI~e~~~~~~rd~t~~~r~~F~~eL~~Ai~eiRaq--------ye~~~~~nR~diE~~Y~~kI~~i~~~  283 (546)
T KOG0977|consen  212 ELAFLKRIHKQEIEEERRKARRDTTADNREYFKNELALAIREIRAQ--------YEAISRQNRKDIESWYKRKIQEIRTS  283 (546)
T ss_pred             HHHHHHhccHHHHHHHHHHHhhcccccchHHHHHHHHHHHHHHHHH--------HHHHHHHhHHHHHHHHHHHHHHHHhh
Confidence                                            89999999999999        99999999997               


Q ss_pred             ----HHHHHHHHHHHHHHhHHHHHHHHhHHHHHHHhhhhHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHH
Q 005601          202 ----QEVINKLQIAEKQSSLQVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREELES  277 (688)
Q Consensus       202 ----~~~a~kaqEElke~R~RVEsL~sKL~dLe~~n~ale~RIReLE~qL~~Er~~s~~~~k~l~~lE~Ei~rLR~EMe~  277 (688)
                          ...+++++||++.+|++|.+|++||++|+.+|.+|+++|++|+.||..++..|   ...|+.++.+|++||++|++
T Consensus       284 ~~~~~~~~~~~rEEl~~~R~~i~~Lr~klselE~~n~~L~~~I~dL~~ql~e~~r~~---e~~L~~kd~~i~~mReec~~  360 (546)
T KOG0977|consen  284 AERANVEQNYAREELRRIRSRISGLRAKLSELESRNSALEKRIEDLEYQLDEDQRSF---EQALNDKDAEIAKMREECQQ  360 (546)
T ss_pred             hccccchhHHHHHHHHHHHhcccchhhhhccccccChhHHHHHHHHHhhhhhhhhhh---hhhhhhHHHHHHHHHHHHHH
Confidence                45566788999999999999999999999999999999999999999999999   99999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhhHhHHHHHhhhHHHHHH
Q 005601          278 EKAAREVAWAKVSGLELDILAATRDLDFERRR  309 (688)
Q Consensus       278 QL~EYQdLmDiKvaLDlEIaAYrKLLEgEE~R  309 (688)
                      ++.|||.|||+|++||+||++|||||+|||.|
T Consensus       361 l~~Elq~LlD~ki~Ld~EI~~YRkLLegee~r  392 (546)
T KOG0977|consen  361 LSVELQKLLDTKISLDAEIAAYRKLLEGEEER  392 (546)
T ss_pred             HHHHHHHhhchHhHHHhHHHHHHHHhccccCC
Confidence            99999999999999999999999999999998

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF06705 SF-assemblin: SF-assemblin/beta giardin	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT)	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules []	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>TIGR03017 EpsF chain length determinant protein EpsF	Back alignment and domain information

>COG3206 GumC Uncharacterized protein involved in exopolysaccharide biosynthesis [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>PF14988 DUF4515: Domain of unknown function (DUF4515)	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>PF12795 MscS_porin: Mechanosensitive ion channel porin domain	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>PF15294 Leu_zip: Leucine zipper	Back alignment and domain information

>KOG2129 consensus Uncharacterized conserved protein H4 [Function unknown]	Back alignment and domain information

>PF04912 Dynamitin: Dynamitin ; InterPro: IPR006996 Dynamitin is a subunit of the microtubule-dependent motor complex, it is also implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) []	Back alignment and domain information

>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family	Back alignment and domain information

>PF09731 Mitofilin: Mitochondrial inner membrane protein; InterPro: IPR019133 Mitofilin controls mitochondrial cristae morphology	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>KOG0249 consensus LAR-interacting protein and related proteins [General function prediction only]	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking	Back alignment and domain information

>KOG4677 consensus Golgi integral membrane protein [Intracellular trafficking, secretion, and vesicular transport; General function prediction only]	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>PF09787 Golgin_A5: Golgin subfamily A member 5; InterPro: IPR019177 This entry represents a family of proteins involved in maintaining Golgi structure	Back alignment and domain information

>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch	Back alignment and domain information

>KOG0243 consensus Kinesin-like protein [Cytoskeleton]	Back alignment and domain information

>TIGR00618 sbcc exonuclease SbcC	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>TIGR02971 heterocyst_DevB ABC exporter membrane fusion protein, DevB family	Back alignment and domain information

>PF04871 Uso1_p115_C: Uso1 / p115 like vesicle tethering protein, C terminal region; InterPro: IPR006955 This domain identifies a group of proteins, which are described as: General vesicular transport factor, Transcytosis associate protein (TAP) and Vesicle docking protein	Back alignment and domain information

>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>PRK04406 hypothetical protein; Provisional	Back alignment and domain information

>PRK12704 phosphodiesterase; Provisional	Back alignment and domain information

>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A)	Back alignment and domain information

>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function	Back alignment and domain information

>PF14073 Cep57_CLD: Centrosome localisation domain of Cep57	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>PRK10361 DNA recombination protein RmuC; Provisional	Back alignment and domain information

>PRK10476 multidrug resistance protein MdtN; Provisional	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>KOG2685 consensus Cystoskeletal protein Tektin [Cytoskeleton]	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>COG4717 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells	Back alignment and domain information

>PRK11519 tyrosine kinase; Provisional	Back alignment and domain information

>KOG1265 consensus Phospholipase C [Lipid transport and metabolism]	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF	Back alignment and domain information

>PRK02119 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton]	Back alignment and domain information

>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>PF10212 TTKRSYEDQ: Predicted coiled-coil domain-containing protein; InterPro: IPR019348 This entry represents a C-terminal 500 residue region, which contains a conserved TTKRSYEDQ motif	Back alignment and domain information

>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin	Back alignment and domain information

>PRK00295 hypothetical protein; Provisional	Back alignment and domain information

>KOG3595 consensus Dyneins, heavy chain [Cytoskeleton]	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>PRK02793 phi X174 lysis protein; Provisional	Back alignment and domain information

>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure	Back alignment and domain information

>KOG1103 consensus Predicted coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>PRK00736 hypothetical protein; Provisional	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PF06717 DUF1202: Protein of unknown function (DUF1202); InterPro: IPR009592 This family consists of several hypothetical bacterial proteins of around 335 residues in length	Back alignment and domain information

>PF08581 Tup_N: Tup N-terminal; InterPro: IPR013890 The N-terminal region of the Tup protein has been shown to interact with the Ssn6 transcriptional co-repressor []	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PRK04325 hypothetical protein; Provisional	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PLN02939 transferase, transferring glycosyl groups	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>PF05769 DUF837: Protein of unknown function (DUF837); InterPro: IPR008555 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PRK10361 DNA recombination protein RmuC; Provisional	Back alignment and domain information

>COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PF15294 Leu_zip: Leucine zipper	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>PF02050 FliJ: Flagellar FliJ protein; InterPro: IPR012823 Many flagellar proteins are exported by a flagellum-specific export pathway	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>PRK15178 Vi polysaccharide export inner membrane protein VexD; Provisional	Back alignment and domain information

>PRK00106 hypothetical protein; Provisional	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR01010 BexC_CtrB_KpsE polysaccharide export inner-membrane protein, BexC/CtrB/KpsE family	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>TIGR02977 phageshock_pspA phage shock protein A	Back alignment and domain information

>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton]	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family	Back alignment and domain information

>PF06548 Kinesin-related: Kinesin-related; InterPro: IPR010544 This entry represents a domain within kinesin-related proteins from higher plants	Back alignment and domain information

>PF10234 Cluap1: Clusterin-associated protein-1; InterPro: IPR019366 This protein of 413 amino acids contains a central coiled-coil domain, possibly the region that binds to clusterin	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>COG3096 MukB Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning]	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR01541 tape_meas_lam_C phage tail tape measure protein, lambda family	Back alignment and domain information

>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility	Back alignment and domain information

>COG3524 KpsE Capsule polysaccharide export protein [Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>PF12795 MscS_porin: Mechanosensitive ion channel porin domain	Back alignment and domain information

>PRK00846 hypothetical protein; Provisional	Back alignment and domain information

>KOG0517 consensus Beta-spectrin [Cytoskeleton]	Back alignment and domain information

>PF15372 DUF4600: Domain of unknown function (DUF4600)	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>PLN03188 kinesin-12 family protein; Provisional	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4572 consensus Predicted DNA-binding transcription factor, interacts with stathmin [Transcription; General function prediction only; Signal transduction mechanisms]	Back alignment and domain information

>PF01486 K-box: K-box region; InterPro: IPR002487 MADS genes in plants encode key developmental regulators of vegetative and reproductive development	Back alignment and domain information

>COG4913 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>PF02994 Transposase_22: L1 transposable element; InterPro: IPR004244 Many human L1 elements are capable of retrotransposition	Back alignment and domain information

>PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>KOG0288 consensus WD40 repeat protein TipD [General function prediction only]	Back alignment and domain information

>KOG0163 consensus Myosin class VI heavy chain [Cytoskeleton]	Back alignment and domain information

>PF15272 BBP1_C: Spindle pole body component BBP1, C-terminal	Back alignment and domain information

>KOG1655 consensus Protein involved in vacuolar protein sorting [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional	Back alignment and domain information

>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function	Back alignment and domain information

>KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK03598 putative efflux pump membrane fusion protein; Provisional	Back alignment and domain information

>KOG4657 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF04065 Not3: Not1 N-terminal domain, CCR4-Not complex component ; InterPro: IPR007207 The Ccr4-Not complex (Not1, Not2, Not3, Not4 and Not5) is a global regulator of transcription that affects genes positively and negatively and is thought to regulate transcription factor TFIID []	Back alignment and domain information

>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>CHL00118 atpG ATP synthase CF0 B' subunit; Validated	Back alignment and domain information

>PF05276 SH3BP5: SH3 domain-binding protein 5 (SH3BP5); InterPro: IPR007940 The SH3 domain-binding protein inhibits the auto and transphophorylation of BTK and acts as a negative regulator of BTK-related signalling in B cells	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>TIGR02231 conserved hypothetical protein	Back alignment and domain information

>PF13949 ALIX_LYPXL_bnd: ALIX V-shaped domain binding to HIV ; PDB: 2XS1_A 2XS8_A 2R03_A 2R02_A 2OEX_B 2OEV_A 2OJQ_A 2R05_A	Back alignment and domain information

>KOG4302 consensus Microtubule-associated protein essential for anaphase spindle elongation [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>PF05615 THOC7: Tho complex subunit 7; InterPro: IPR008501 The Tho complex (THOC) is involved in transcription elongation and mRNA export from the nucleus []	Back alignment and domain information

>KOG1854 consensus Mitochondrial inner membrane protein (mitofilin) [Cell wall/membrane/envelope biogenesis]	Back alignment and domain information

>TIGR03794 NHPM_micro_HlyD NHPM bacteriocin system secretion protein	Back alignment and domain information

>PF01442 Apolipoprotein: Apolipoprotein A1/A4/E domain; InterPro: IPR000074 Exchangeable apolipoproteins (apoA, apoC and apoE) have the same genomic structure and are members of a multi-gene family that probably evolved from a common ancestral gene	Back alignment and domain information

>PRK10698 phage shock protein PspA; Provisional	Back alignment and domain information

>KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only]	Back alignment and domain information

>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer	Back alignment and domain information

>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana	Back alignment and domain information

>PRK03947 prefoldin subunit alpha; Reviewed	Back alignment and domain information

>KOG2751 consensus Beclin-like protein [Signal transduction mechanisms]	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>COG4717 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		688
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	1e-17
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-17
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	5e-14
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	3e-12
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	5e-14
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	2e-11
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	3e-11
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	6e-11
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	1e-06
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	9e-08
1f5n_A		592	Interferon-induced guanylate-binding protein 1; GB	3e-06
2zuo_A		861	MVP, major vault protein; repeat domains, protein-	3e-05
2xs1_A		704	Programmed cell death 6-interacting protein; prote	9e-05

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

 Score = 86.8 bits (215), Expect = 1e-17
 Identities = 55/287 (19%), Positives = 121/287 (42%), Gaps = 10/287 (3%)

Query: 38   RSLQRSNTELRKQLESQVLEIDKLRNENRVVVERHEKEMKEMKESVSISYLHQLKVLRDM 97
              L     E+R +L ++  E++++ +E    +E  E+  ++++         Q+  L + 
Sbjct: 905  TELYAEAEEMRVRLAAKKQELEEILHEMEARIEEEEERSQQLQAEKK-KMQQQMLDLEEQ 963

Query: 98   LDAKQKELAEISRISAEQKHEMEDLNDRLSASMQSCTEANEIMKSQKVTIDELKTQLDEE 157
            L+ ++    ++         +++ + D +        +  +  K  +  + +L T L EE
Sbjct: 964  LEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQNNKLTKERKLLEERVSDLTTNLAEE 1023

Query: 158  RNLRRVDRENAEADLKAAVQKSQLETQEKLKRLSDAASRRELEQQEVINKLQIAEKQSSL 217
                  ++      LK   +    E + +LK+     SR+ELE+     KL+        
Sbjct: 1024 E-----EKAKNLTKLKNKHESMISELEVRLKKEE--KSRQELEKI--KRKLEGESSDLHE 1074

Query: 218  QVESLKLKLDETRERLVTSDNKVRLLETQVCKEQNVSASWKKRVEELENEIKKLREELES 277
            Q+  L+ ++ E + +L   + +++    ++  E +   +  K++ ELE+ I  L+E+LES
Sbjct: 1075 QIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIRELESHISDLQEDLES 1134

Query: 278  EKAAREVAWAKVSGLELDILAATRDLDFERRRLKAARERIMLRETQL 324
            EKAAR  A  +   L  ++ A   +L+         +E         
Sbjct: 1135 EKAARNKAEKQKRDLSEELEALKTELEDTLDTTATQQELRGSDYKDD 1181

PyMOL of 1i84

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245	Back alignment and structure

>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592	Back alignment and structure

>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861	Back alignment and structure

>2xs1_A Programmed cell death 6-interacting protein; protein transport-viral protein complex, cell cycle; 2.30A {Homo sapiens} PDB: 2xs8_A 2oev_A 2r05_A 2r02_A 2r03_A 2oex_A 2ojq_A Length = 704	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

No hit with probability above 80.00