Citrus Sinensis ID: 005620

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------
MGGELATRMTTTSTSTATKKKKKKGRPSLLDLQKRSIKQQNQFQNKNPNSILKSNRPPARRQNPNFNSNRDDDDDDDDDGDERQQKKHKLLHGLDNFSALHSVYDGRRKIPTGSDQMEEKVLKATDTLHGLPVESAGPTTTLPDRKLLLFVLDRLQKKDTYGVFSEPVDPAELPDYHEIIAHPMDFATVRKKLDAGAYSYLEEFEQDVFLICSNAMQYNAPDTIYFRQARSILDLAKKDFENLRQDSDDSEPQPRVKVVRRGRPPKSLKKSLDSSPSDRIASEFSSDATLANGGDNVSWASAHNLRKGPITSVRFRPADSVNRASHGSHVHGSHAGETYTSWLSEWENEFPASVVKAVLKYGKKQFTVDVNRRDTYHDSMASRHEPSVLTTFEGELKQLTVVGLNTEHGYARSLARFASDLGPVVWNIASKKIESVLPLGVKFSPGWVGENKATERQQYSYPEKQKLSNNYISGDHSSRLVSPATSDSNFILENRYSLQSGEEMETIKEVNPQSDSNLQNSTLGGIRHAPGSQIQSRPIIHSNINGFSRSGGFGFNYLPHVGSVGLARALGNSRSGNSAFGTVPNNHHAVSLMPASGYDSNTVKLADCSSRVQSDSCSSVLVSGGGSHAAVDPGLMGDTSWRGLSTLHKQEFHTFAPDLNVRFLAPGSPISNLQIGSPQQPDLALQL
ccccccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccHcccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccHHHHccccccEccccccccccccccccccccHHHcccHHHHHEEHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccEEcc
mggelatrmtttststatkkkkkkgrpsllDLQKRSIKQQNQfqnknpnsilksnrpparrqnpnfnsnrdddddddddgdeRQQKKHKLLHgldnfsalhsvydgrrkiptgsdqMEEKVLKATdtlhglpvesagptttlpdrKLLLFVLDRLqkkdtygvfsepvdpaelpdyheiiahpmDFATVRKKLDAGAYSYLEEFEQDVFLICSNamqynapdtiyFRQARSILDLAKKDFEnlrqdsddsepqprvkvvrrgrppkslkksldsspsdriasefssdatlanggdnvswasahnlrkgpitsvrfrpadsvnrashgshvhgshageTYTSWLSEWENEFPASVVKAVLKYGkkqftvdvnrrdtyhdsmasrhepsvlTTFEGELKQLTVVGLNTEHGYARSLARFASDLGPVVWNIASKkiesvlplgvkfspgwvgenkaterqqysypekqklsnnyisgdhssrlvspatsdsnfilenryslqsgeemetikevnpqsdsnlqnstlggirhapgsqiqsrpiihsningfsrsggfgfnylphvgSVGLARalgnsrsgnsafgtvpnnhhavslmpasgydsntvkladcssrvqsdscssvlvsgggshaavdpglmgdtswrglstlhkqefhtfapdlnvrflapgspisnlqigspqqpdlalql
mggelatrmtttststatkkkkkkgrpslldlQKRSIKqqnqfqnknpnsilksnrpparrqnpnfnsnrdddddddDDGDERQQKkhkllhgldnfsalhsvYDGRRKIPTGSDQMEEKVLKAtdtlhglpvesagptttlpdrKLLLFVLDRLQKKDtygvfsepvdpaeLPDYHEIIAHPMDFATVRKKLDAGAYSYLEEFEQDVFLICSNAMQYNAPDTIYFRQARSILDLAKKDFEnlrqdsddsepqprvkvvrrgrppkslkksldsspsdrIASEFSSDATLANGGDNVSWASAHNLRKGPITSVRFRPADSVNRashgshvhgsHAGETYTSWLSEWENEFPASVVKAVLKygkkqftvdvnrrdtyhdsmasrhepsvlTTFEGELKQLTVVGLNTEHGYARSLARFASDLGPVVWNIASKKIESVLPLGVKFSPGWVGENKaterqqysypekQKLSNNYISGDHSSRlvspatsdsnfILENRYSLQSGEEMETIKEVNPQSDSNLQNSTLGGIRHAPGSQIQSRPIIHSNINGFSRSGGFGFNYLPHVGSVGLARALGNSRSGNSAFGTVPNNHHAVSLMPASGYDSNTVKLADCSSRVQSDSCSSVLVSGGGSHAAVDPGLMGDTSWRGLSTLHKQEFHTFAPDLNVRFLAPGSPIsnlqigspqQPDLALQL
MGGELATRMtttststatkkkkkkGRPSLLDLQKRSIkqqnqfqnknpnSILKSNRPPARRQNPNFNSNRdddddddddgdERQQKKHKLLHGLDNFSALHSVYDGRRKIPTGSDQMEEKVLKATDTLHGLPVESAGPTTTLPDRKLLLFVLDRLQKKDTYGVFSEPVDPAELPDYHEIIAHPMDFATVRKKLDAGAYSYLEEFEQDVFLICSNAMQYNAPDTIYFRQARSILDLAKKDFENLRQDSDDSEpqprvkvvrrgrppkslkksldsspsdRIASEFSSDATLANGGDNVSWASAHNLRKGPITSVRFRPADSVNRashgshvhgshagETYTSWLSEWENEFPASVVKAVLKYGKKQFTVDVNRRDTYHDSMASRHEPSVLTTFEGELKQLTVVGLNTEHGYARSLARFASDLGPVVWNIASKKIESVLPLGVKFSPGWVGENKATERQQYSYPEKQKLSNNYISGDHSSRLVSPATSDSNFILENRYSLQSGEEMETIKEVNPQSDSNLQNSTLGGIRHAPGSQIQSRPIIHsningfsrsggfgfnYLPHVGSVGLARALGNSRSGNSAFGTVPNNHHAVSLMPASGYDSNTVKLAdcssrvqsdscssvlvsgggsHAAVDPGLMGDTSWRGLSTLHKQEFHTFAPDLNVRFLAPGSPISNLQIGSPQQPDLALQL
********************************************************************************************GLDNFSALHSVY***********************************TTLPDRKLLLFVLDRLQKKDTYGVFSEPVDPAELPDYHEIIAHPMDFATVRKKLDAGAYSYLEEFEQDVFLIC***********IYFRQARSILDL***************************************************************************************************AGETYTSWLSEWENEFPASVVKAVLKYGKKQFTVDVNRRDTYH*********SVLTTFEGELKQLTVVGLNTEHGYARSLARFASDLGPVVWNIASKKIESVLPLGVKFSPGWVG*****************************************************************************************IIHSNINGFSRSGGFGFNYLPHVGSVGLARAL***********************************************************AVDPGLMGDTSWRGLSTLHKQEFHTFAPDLNVRFLA**********************
*************************************************************************************************************************************************KLLLFVLDRLQKKDTYGVFSEPVDPAELPDYHEIIAHPMDFATVRKKLDAGAYSYLEEFEQDVFLICSNAMQYNAPDTIYFRQARSILDLAKKD*********************************************************************************************************************************************************************NT*HGYARSLARFASDLGPVVWNIASKKIESVLPLGVK***********************************************************************************************************************************************************************************************************************************************DLALQL
***************************SLLDLQKRSIKQQNQFQNKNPNSILKSNRPPARRQNPNFNSNR****************KHKLLHGLDNFSALHSVYDGRRKIPTGSDQMEEKVLKATDTLHGLPVESAGPTTTLPDRKLLLFVLDRLQKKDTYGVFSEPVDPAELPDYHEIIAHPMDFATVRKKLDAGAYSYLEEFEQDVFLICSNAMQYNAPDTIYFRQARSILDLAKKDFENL*************************************ASEFSSDATLANGGDNVSWASAHNLRKGPITSVRFRPADSVN************AGETYTSWLSEWENEFPASVVKAVLKYGKKQFTVDVNRRDTYHDSMASRHEPSVLTTFEGELKQLTVVGLNTEHGYARSLARFASDLGPVVWNIASKKIESVLPLGVKFSPGWVGENKATERQQYSYPEKQKLSNNYISGDHSSRLVSPATSDSNFILENRYSLQSGEEMETIKEVNPQSDSNLQNSTLGGIRHAPGSQIQSRPIIHSNINGFSRSGGFGFNYLPHVGSVGLARALGNSRSGNSAFGTVPNNHHAVSLMPASGYDSNTVKLAD********************HAAVDPGLMGDTSWRGLSTLHKQEFHTFAPDLNVRFLAPGSPISNLQIGS**********
*******************************************************************************************************************************************TTLPDRKLLLFVLDRLQKKDTYGVFSEPVDPAELPDYHEIIAHPMDFATVRKKLDAGAYSYLEEFEQDVFLICSNAMQYNAPDTIYFRQARSILDLAKKDFENLR************************************************************************************************************SVVKAVLKYGKKQFTVDVNRRDTYHDSMASRHEPSVLTTFEGELKQLTVVGLNTEHGYARSLARFASDLGPVVWNIASKKIESVLPLGVKFSPGWVGEN********************************************************************************SQIQSRPIIHSNINGFSRSGGFGFNYLPHVGSVGLARALGNSRSGNSAFGTVPNNHHAVSLMPASGYDS*****************************************************TFAPDL*V******************QPD*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGELATRMTTTSTSTATKKKKKKGRPSLLDLQKRSIKQQNQFQNKNPNSILKSNRPPARRQNPNFNSNRDDDDDDDDDGDERQQKKHKLLHGLDNFSALHSVYDGRRKIPTGSDQMEEKVLKATDTLHGLPVESAGPTTTLPDRKLLLFVLDRLQKKDTYGVFSEPVDPAELPDYHEIIAHPMDFATVRKKLDAGAYSYLEEFEQDVFLICSNAMQYNAPDTIYFRQARSILDLAKKDFENLRQDSDDSEPQPRVKVVRRGRPPKSLKKSLDSSPSDRIASEFSSDATLANGGDNVSWASAHNLRKGPITSVRFRPADSVNRASHGSHVHGSHAGETYTSWLSEWENEFPASVVKAVLKYGKKQFTVDVNRRDTYHDSMASRHEPSVLTTFEGELKQLTVVGLNTEHGYARSLARFASDLGPVVWNIASKKIESVLPLGVKFSPGWVGENKATERQQYSYPEKQKLSNNYISGDHSSRLVSPATSDSNFILENRYSLQSGEEMETIKEVNPQSDSNLQNSTLGGIRHAPGSQIQSRPIIHSNINGFSRSGGFGFNYLPHVGSVGLARALGNSRSGNSAFGTVPNNHHAVSLMPASGYDSNTVKLADCSSRVQSDSCSSVLVSGGGSHAAVDPGLMGDTSWRGLSTLHKQEFHTFAPDLNVRFLAPGSPISNLQIGSPQQPDLALQL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query687 2.2.26 [Sep-21-2011]
Q9ULD41205 Bromodomain and PHD finge yes no 0.289 0.165 0.327 2e-22
O956961058 Bromodomain-containing pr no no 0.235 0.153 0.338 3e-20
Q3UQU0596 Bromodomain-containing pr no no 0.132 0.152 0.472 8e-18
Q9H8M2597 Bromodomain-containing pr no no 0.132 0.152 0.472 1e-17
Q7ZUF2631 Bromodomain-containing pr no no 0.132 0.144 0.450 4e-17
P552011214 Peregrin OS=Homo sapiens no no 0.229 0.130 0.329 6e-17
Q6NVM8596 Bromodomain-containing pr no no 0.132 0.152 0.417 3e-15
Q6GLP7527 Bromodomain-containing pr N/A no 0.132 0.172 0.417 4e-15
O88665651 Bromodomain-containing pr no no 0.154 0.162 0.369 2e-14
Q5R8B0651 Bromodomain-containing pr no no 0.154 0.162 0.369 2e-14
>sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 Back     alignment and function desciption
 Score =  108 bits (269), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 115/223 (51%), Gaps = 24/223 (10%)

Query: 36  SIKQQNQFQNKNPNSIL-----KSNRPPARRQNPNFNSNRDDDDDDDDDG----DERQQK 86
           S +++NQF  +  N  L     ++  P  RR + +  S R+ +  + D+      E  + 
Sbjct: 492 SFQRKNQFMQRLHNYWLLKRQARNGVPLIRRLHSHLQSQRNAEQREQDEKTSAVKEELKY 551

Query: 87  KHKLLHGLDNFSALHSVYDGRRKIPTGSDQMEEKVLKATDTLHGLPVESAGPTTTLPDRK 146
             KL H L+    L  +   R K+     + + KV +A   L  +P              
Sbjct: 552 WQKLRHDLERARLLIELIRKREKL----KREQVKVQQAAMELELMPFNV----------- 596

Query: 147 LLLFVLDRLQKKDTYGVFSEPVDPAELPDYHEIIAHPMDFATVRKKLDAGAYSYLEEFEQ 206
           LL   LD LQ+KD   +F+EPV+ +E+PDY E I+ PMDF+T+R+KL++  Y  LEEFE+
Sbjct: 597 LLRTTLDLLQEKDPAHIFAEPVNLSEVPDYLEFISKPMDFSTMRRKLESHLYRTLEEFEE 656

Query: 207 DVFLICSNAMQYNAPDTIYFRQARSILDLAKKDFENLRQDSDD 249
           D  LI +N M+YNA DTI+ R A  + DL      + R+ +++
Sbjct: 657 DFNLIVTNCMKYNAKDTIFHRAAVRLRDLGGAILRHARRQAEN 699
Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity.
Homo sapiens (taxid: 9606)
>sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 Back     alignment and function description
>sp|Q3UQU0|BRD9_MOUSE Bromodomain-containing protein 9 OS=Mus musculus GN=Brd9 PE=2 SV=1 Back     alignment and function description
>sp|Q9H8M2|BRD9_HUMAN Bromodomain-containing protein 9 OS=Homo sapiens GN=BRD9 PE=1 SV=2 Back     alignment and function description
>sp|Q7ZUF2|BRD9_DANRE Bromodomain-containing protein 9 OS=Danio rerio GN=brd9 PE=2 SV=1 Back     alignment and function description
>sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 Back     alignment and function description
>sp|Q6NVM8|BRD9_XENTR Bromodomain-containing protein 9 OS=Xenopus tropicalis GN=brd9 PE=2 SV=1 Back     alignment and function description
>sp|Q6GLP7|BRD9_XENLA Bromodomain-containing protein 9 OS=Xenopus laevis GN=brd9 PE=2 SV=1 Back     alignment and function description
>sp|O88665|BRD7_MOUSE Bromodomain-containing protein 7 OS=Mus musculus GN=Brd7 PE=1 SV=1 Back     alignment and function description
>sp|Q5R8B0|BRD7_PONAB Bromodomain-containing protein 7 OS=Pongo abelii GN=BRD7 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query687
255539242675 bromodomain-containing protein [Ricinus 0.963 0.980 0.554 0.0
224061867632 bromodomain protein [Populus trichocarpa 0.841 0.914 0.514 1e-166
224086052617 bromodomain protein [Populus trichocarpa 0.848 0.944 0.508 1e-159
147814821688 hypothetical protein VITISV_012026 [Viti 0.914 0.912 0.499 1e-154
359491912691 PREDICTED: uncharacterized protein LOC10 0.915 0.910 0.496 1e-151
297745559634 unnamed protein product [Vitis vinifera] 0.756 0.820 0.526 1e-141
297850490641 DNA-binding bromodomain-containing prote 0.850 0.911 0.452 1e-140
356517927665 PREDICTED: uncharacterized protein LOC10 0.935 0.966 0.467 1e-137
356509582652 PREDICTED: uncharacterized protein LOC10 0.915 0.964 0.475 1e-136
225428300750 PREDICTED: uncharacterized protein LOC10 0.938 0.86 0.433 1e-131
>gi|255539242|ref|XP_002510686.1| bromodomain-containing protein [Ricinus communis] gi|223551387|gb|EEF52873.1| bromodomain-containing protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/692 (55%), Positives = 474/692 (68%), Gaps = 30/692 (4%)

Query: 9   MTTTSTSTATKKKKKKGRPSLLDLQKRSIKQQNQFQN----KNPNSILKSNRPPARRQNP 64
           M      T TKKKKKKGRPSLLDLQKRS+KQQ Q Q     KNPNS+  S      R++ 
Sbjct: 1   MGEIEAGTMTKKKKKKGRPSLLDLQKRSLKQQQQQQQTPNLKNPNSLNVSYPSSHHRRSN 60

Query: 65  NFNSNRDDDDDDDDDGDERQQKKHKLLHGLDNFSALHSVYDGRRKIPTGSDQMEEKVLKA 124
           + N N    D  +D+ DER QKKHKLL GL+N      V   RRKI  GSDQ+ EK LKA
Sbjct: 61  HRNPNSSVPDLINDEDDERTQKKHKLLLGLNN----SEVALKRRKITPGSDQLGEKALKA 116

Query: 125 TDTLHGLPVESAGPTTTLPDRKLLLFVLDRLQKKDTYGVFSEPVDPAELPDYHEIIAHPM 184
           TDTL   PVE  GPTT LPD+KLL+F+LDRLQKKDTYGVFS+PVDP ELPDYH+I+ HPM
Sbjct: 117 TDTLQESPVE-PGPTTPLPDKKLLVFILDRLQKKDTYGVFSDPVDPEELPDYHDIVEHPM 175

Query: 185 DFATVRKKLDAGAYSYLEEFEQDVFLICSNAMQYNAPDTIYFRQARSILDLAKKDFENLR 244
           DF+TVRKKLD GAY  LE+FE+DVFLICSNAMQYN  DTIY+RQARSI +LAKKDFENLR
Sbjct: 176 DFSTVRKKLDRGAYFNLEQFEKDVFLICSNAMQYNPSDTIYYRQARSIQELAKKDFENLR 235

Query: 245 QDSDDSEPQPRVKVVRRGRPPKSLKKSLDSSPSDRIASEFSSDATLANGGDNVSWASAHN 304
           QDSDD EPQP   V RRGRPP  LKKSL+ SP DR++ + SSDAT A GGDN +  + +N
Sbjct: 236 QDSDDGEPQP--NVARRGRPPGKLKKSLERSPLDRVSPDCSSDATHAFGGDNTNETNGYN 293

Query: 305 LRKGPITSVRFRPADSVNRASHGSHVHGSHAGETYTSWLSEWENEFPASVVKAVLKYGKK 364
           LR+    S ++RPAD + R S     HGSH+ ETY +W+SEWENEFPASV+KAVLKYGKK
Sbjct: 294 LRR--TNSYKYRPADVLVRTS-----HGSHSSETYAAWMSEWENEFPASVLKAVLKYGKK 346

Query: 365 QFTVDVNRRDTYHDSMASRHEPSVLTTFEGELKQLTVVGLNTEHGYARSLARFASDLGPV 424
            + VD NRRDTY   +AS  EPS L  FEGELKQL  VGLN+E+GYARSLARFA+DLGPV
Sbjct: 347 PYAVDENRRDTYKQPLASTPEPSSLNFFEGELKQLVAVGLNSEYGYARSLARFAADLGPV 406

Query: 425 VWNIASKKIESVLPLGVKFSPGWVGENKATERQQ-YSYPEKQKLSNNYISGDHSSRLVSP 483
           VW IASKKIES LP G++F PGWVGE+K  + QQ + + ++ K+SN+ I  DH SR   P
Sbjct: 407 VWKIASKKIESALPTGLEFGPGWVGEDKVVDGQQKFQFSDRPKVSNSSIFNDHFSR-PQP 465

Query: 484 ATSDSNFILENRYSLQSGEE-METIKEVNPQSDSNLQNSTLGGIRHAPGSQIQSRPIIHS 542
             + +N  + +R S ++ E+ ME + +++ QS+    NS+ GGI +     +Q +PIIHS
Sbjct: 466 TATGTNSAVTSRCSARTREDWMENVGKISSQSELISTNSSTGGINYMSSVLVQQKPIIHS 525

Query: 543 NINGFSRSGGFGFNYL-PHVGSVGLARALGNSRSGNSA-----FGTVPNNHHAVSLMPAS 596
           +ING   SGG  +N   PH G+  +    G + + ++A     FG V  +   +  MP +
Sbjct: 526 DINGL--SGGLRYNNCSPHTGTGRVGIPTGKASTEHAAVPSQVFGMVSTSTSTLCPMPGN 583

Query: 597 GYDSNTVKLADCSSRVQSDSCSSVLVSGGGSHAAVDPGLMGDTSW-RGLSTLHKQEFHTF 655
               N  KL++  + +     SS L S   S   ++ G+ G  SW R  S+ H+++F  F
Sbjct: 584 DCSLNKAKLSETWNGLLQSGDSSALGSNLDSQTFLNAGVDGKPSWHRVSSSYHQEQFFQF 643

Query: 656 APDLNVRFLAPGSPISNLQIGSPQQPDLALQL 687
            PDLNV FLAP SP S++ IGSPQQPDLALQL
Sbjct: 644 PPDLNVGFLAPNSPSSSVPIGSPQQPDLALQL 675

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224061867|ref|XP_002300638.1| bromodomain protein [Populus trichocarpa] gi|222842364|gb|EEE79911.1| bromodomain protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224086052|ref|XP_002307796.1| bromodomain protein [Populus trichocarpa] gi|222857245|gb|EEE94792.1| bromodomain protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147814821|emb|CAN74748.1| hypothetical protein VITISV_012026 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359491912|ref|XP_002272566.2| PREDICTED: uncharacterized protein LOC100244510 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297745559|emb|CBI40724.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297850490|ref|XP_002893126.1| DNA-binding bromodomain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297338968|gb|EFH69385.1| DNA-binding bromodomain-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356517927|ref|XP_003527637.1| PREDICTED: uncharacterized protein LOC100783010 [Glycine max] Back     alignment and taxonomy information
>gi|356509582|ref|XP_003523526.1| PREDICTED: uncharacterized protein LOC100811115 [Glycine max] Back     alignment and taxonomy information
>gi|225428300|ref|XP_002279830.1| PREDICTED: uncharacterized protein LOC100245230 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query687
TAIR|locus:2030422652 AT1G20670 "AT1G20670" [Arabido 0.588 0.619 0.529 9.8e-128
TAIR|locus:2014594580 AT1G76380 "AT1G76380" [Arabido 0.717 0.85 0.449 2.3e-112
TAIR|locus:2151948 916 AT5G55040 "AT5G55040" [Arabido 0.461 0.346 0.421 4e-64
ZFIN|ZDB-GENE-041008-1681142 brd1a "bromodomain containing 0.257 0.154 0.343 1e-17
UNIPROTKB|E1BSE71186 E1BSE7 "Uncharacterized protei 0.154 0.089 0.471 3.9e-17
UNIPROTKB|E9PSF3821 BRPF3 "Bromodomain and PHD fin 0.157 0.131 0.453 1e-16
UNIPROTKB|B7ZLN5871 BRPF3 "Bromodomain and PHD fin 0.157 0.123 0.453 1.1e-16
UNIPROTKB|Q17RB6935 BRPF3 "BRPF3 protein" [Homo sa 0.157 0.115 0.453 1.2e-16
UNIPROTKB|J9P1E61012 BRD1 "Uncharacterized protein" 0.148 0.100 0.470 1.4e-16
UNIPROTKB|E9PI601106 BRPF3 "Bromodomain and PHD fin 0.157 0.097 0.453 1.6e-16
TAIR|locus:2030422 AT1G20670 "AT1G20670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1032 (368.3 bits), Expect = 9.8e-128, Sum P(4) = 9.8e-128
 Identities = 227/429 (52%), Positives = 281/429 (65%)

Query:   112 TGSD-QMEEKVLKATDTLHGLPVESAGPTTTLPDRKLLLFVLDRLQKKDTYGVFSEPVDP 170
             +GSD    EK  KATD L G PVES GPTT LPD+KLLLF+LDRLQKKDTYGV+S+PVDP
Sbjct:   144 SGSDYHTGEKASKATDILQGSPVES-GPTTPLPDKKLLLFILDRLQKKDTYGVYSDPVDP 202

Query:   171 AELPDYHEIIAHPMDFATVRKKLDAGAYSYLEEFEQDVFLICSNAMQYNAPDTIYFRQAR 230
              ELPDY EII +PMDF+T+R KLD+GAYS LE+FE+DVFLIC+NAM+YN+ DT+Y+RQAR
Sbjct:   203 EELPDYFEIIKNPMDFSTLRNKLDSGAYSTLEQFERDVFLICTNAMEYNSADTVYYRQAR 262

Query:   231 SILDLAKKDFENLRQDSDDSEXXXXXXXXXXXXXXXXXXXXXXX---XXXXRIASEFSSD 287
             +I +LAKKDFENLRQDSDD E                              R ASE S+D
Sbjct:   263 AIQELAKKDFENLRQDSDDEEPQSQQQQQQQPKVARRGRPPKKHPEPSSIDRTASEISAD 322

Query:   288 ATLANGGDNVSWASAHNLRKGPITSVRFRPADSVNRXXXXXXXXXXXXXETYTSWLSEWE 347
             A +     N  ++ A+NLRK P  S +FR A+S  R             ET + W  +WE
Sbjct:   323 ALIPGDSSN-KFSGAYNLRKAP-PSYKFRQAESSVRINHNS--------ETQSGWSVDWE 372

Query:   348 NEFPASVVKAVLKYGKKQFTVDVNRRDTYHDSMASRHEPSVLTTFEGELKQLTVVGLNTE 407
             +EFP+SVVKAV KYG K F VD NRRDTY+    S  EPSVLTT E ELKQL  VGLN E
Sbjct:   373 SEFPSSVVKAVNKYGMKHFNVDDNRRDTYNHLSTSTQEPSVLTTLEDELKQLIPVGLNME 432

Query:   408 HGYARSLARFASDLGPVVWNIASKKIESVLPLGVKFSPGWVGENKATERQQYSYPE---- 463
             +GYA+SLAR+A++LGPV W IAS++IE+VLP G+KF  GWVGEN A   +  S  +    
Sbjct:   433 YGYAKSLARYAANLGPVAWKIASRRIETVLPSGIKFGQGWVGENPAGPEEDDSQKQNILM 492

Query:   464 ---KQKLSNNYISGDHSSRLVSPATSDSNFILENRY-SLQSGEEMET--IKEVNPQSDSN 517
                KQK SN+  S DHS+R++SP  S S+  + NR+ S Q+ EE      + +NP+ D  
Sbjct:   493 SSGKQKCSNDLASDDHSNRILSPTASVSSAFIGNRHASSQAIEETTPPPARVLNPEIDHP 552

Query:   518 LQNSTLGGI 526
               +S   G+
Sbjct:   553 SSSSHQAGL 561
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2014594 AT1G76380 "AT1G76380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151948 AT5G55040 "AT5G55040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041008-168 brd1a "bromodomain containing 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSE7 E1BSE7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSF3 BRPF3 "Bromodomain and PHD finger-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B7ZLN5 BRPF3 "Bromodomain and PHD finger-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q17RB6 BRPF3 "BRPF3 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P1E6 BRD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PI60 BRPF3 "Bromodomain and PHD finger-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
BRD901
bromodomain protein (633 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query687
cd0436999 cd04369, Bromodomain, Bromodomain 1e-30
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 3e-30
smart00297107 smart00297, BROMO, bromo domain 7e-29
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 9e-27
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 2e-26
pfam0043984 pfam00439, Bromodomain, Bromodomain 2e-24
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 5e-23
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 5e-21
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 1e-20
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 6e-19
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 7e-17
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 7e-17
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 1e-15
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 1e-15
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 7e-15
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 7e-15
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 1e-14
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 3e-13
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 1e-12
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 1e-12
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 3e-12
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 4e-12
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 5e-12
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 4e-11
COG5076371 COG5076, COG5076, Transcription factor involved in 5e-11
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 2e-10
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 1e-09
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 2e-09
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 2e-09
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 3e-07
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 6e-07
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 1e-06
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 5e-06
cd05492109 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like 3e-05
cd05525106 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa 4e-05
cd05526110 cd05526, Bromo_polybromo_VI, Bromodomain, polybrom 6e-04
cd05494114 cd05494, Bromodomain_1, Bromodomain; uncharacteriz 0.002
cd05501102 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li 0.004
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information 
 Score =  115 bits (289), Expect = 1e-30
 Identities = 46/99 (46%), Positives = 61/99 (61%), Gaps = 2/99 (2%)

Query: 144 DRKLLLFVLDRLQKK--DTYGVFSEPVDPAELPDYHEIIAHPMDFATVRKKLDAGAYSYL 201
            +K L  +LD L+K   D    F EPVDP E PDY+E+I +PMD +T++KKL  G Y  L
Sbjct: 1   LKKKLRSLLDALKKLKRDLSEPFLEPVDPKEAPDYYEVIKNPMDLSTIKKKLKNGEYKSL 60

Query: 202 EEFEQDVFLICSNAMQYNAPDTIYFRQARSILDLAKKDF 240
           EEFE DV LI SNA  YN P +  ++ A+ +  L +K  
Sbjct: 61  EEFEADVRLIFSNAKTYNGPGSPIYKDAKKLEKLFEKLL 99

Bromodomains are found in many chromatin-associated proteins and in nuclear histone acetyltransferases. They interact specifically with acetylated lysine. Length = 99
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99924 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family Back     alignment and domain information
>gnl|CDD|99956 cd05526, Bromo_polybromo_VI, Bromodomain, polybromo repeat VI Back     alignment and domain information
>gnl|CDD|99926 cd05494, Bromodomain_1, Bromodomain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 687
KOG09551051 consensus PHD finger protein BR140/LIN-49 [General 99.95
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.92
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 99.92
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.92
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.92
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.92
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.92
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.91
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.91
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.91
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.91
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.91
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.91
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.9
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.9
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.89
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.89
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.89
KOG1474640 consensus Transcription initiation factor TFIID, s 99.89
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.89
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.89
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.89
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.88
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.88
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.87
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.87
smart00297107 BROMO bromo domain. 99.86
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.86
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.86
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.86
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.86
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.86
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.84
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.83
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.83
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.82
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.81
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.73
COG5076371 Transcription factor involved in chromatin remodel 99.69
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 99.62
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 99.45
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 99.17
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 99.09
KOG00081563 consensus Transcription initiation factor TFIID, s 98.97
KOG1827629 consensus Chromatin remodeling complex RSC, subuni 98.93
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 98.86
KOG00081563 consensus Transcription initiation factor TFIID, s 98.66
KOG1474 640 consensus Transcription initiation factor TFIID, s 98.56
KOG1472720 consensus Histone acetyltransferase SAGA/ADA, cata 98.54
KOG1828418 consensus IRF-2-binding protein CELTIX-1, contains 98.28
KOG1828418 consensus IRF-2-binding protein CELTIX-1, contains 98.18
COG5076371 Transcription factor involved in chromatin remodel 96.64
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 95.17
KOG06441113 consensus Uncharacterized conserved protein, conta 88.99
KOG07321080 consensus AAA+-type ATPase containing the bromodom 83.13
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information 
Probab=99.95  E-value=1.8e-27  Score=279.41  Aligned_cols=340  Identities=29%  Similarity=0.315  Sum_probs=241.4

Q ss_pred             CCChHHHHHHHHHHHHHHccCCCCCCCCCCCCCCCCchhhccCCccCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHhccc
Q 005620          139 TTTLPDRKLLLFVLDRLQKKDTYGVFSEPVDPAELPDYHEIIAHPMDFATVRKKLDAGAYSYLEEFEQDVFLICSNAMQY  218 (687)
Q Consensus       139 ~~p~p~kk~L~~IL~~L~k~d~s~pF~ePVD~~elPDYyeIIK~PMDLsTIkkKLk~g~Y~S~~EF~~DV~LIfsNA~~Y  218 (687)
                      ....+++++|+.+++.|++.+..++|..|||+.++|||+++|++||||.+|+.++..+.|.++++|++|+.||+.||+.|
T Consensus       561 ~~l~p~~kLl~~~l~~lq~kD~~gif~~pvd~~e~pdy~~iik~pmd~~t~~~kl~s~~y~tle~ieed~~l~~~nc~~y  640 (1051)
T KOG0955|consen  561 LGLNPFKKLLQKSLDKLQKKDSYGIFAEPVDPSELPDYIDIIKKPMDFFTMRLKLESGAYSTLEPIEEDVNLIVSNCMEY  640 (1051)
T ss_pred             ccCchHHHHHHHHHHHhhcccccCceeeccChhhcccHHHHhcCccchhhhhhhccccchhhhhHHHHhHhHhHhHHHHh
Confidence            46778999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHhhhcCCCCCC-CC------cccccccCCCCCC-CcCcCCCCCCCCCCCCCCCCcccc
Q 005620          219 NAPDTIYFRQARSILDLAKKDFENLRQDSDDSE-PQ------PRVKVVRRGRPPK-SLKKSLDSSPSDRIASEFSSDATL  290 (687)
Q Consensus       219 N~pdS~V~k~A~~Le~~fek~~ekl~~e~~~eE-p~------~~pK~~r~gRp~k-~~Kksl~~pp~~~~~s~~Ssdatl  290 (687)
                      |..++.+|++|..+++...+.|.+.+.+.+... ..      ......+..++.. ..................+..+.+
T Consensus       641 n~~dtv~~r~av~~~e~~~~~~~~arke~e~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~e~~~v~~e~~~~~~~e~~~  720 (1051)
T KOG0955|consen  641 NAKDTVYYRAAVRLRELIKKDFRNARKEPESEGLLDRESLSHHDHLVKKLERPYRPNLWAPEEPQVDLETFINLSKEHDL  720 (1051)
T ss_pred             hccCeehHhhhHHHHhhhhhHHHhcccchhhhcccchhhhcccchhhhhhccCCccccccccccccccccccccChhhhh
Confidence            999999999999999999999999888776443 11      1111222222221 111111111122222233333221


Q ss_pred             --cCCCCCCCcccccccccCCCCCCCCCCCC---cccccCCCCCCCCCCCCCCcccccccccccchHHHhHHHHhhCCcc
Q 005620          291 --ANGGDNVSWASAHNLRKGPITSVRFRPAD---SVNRASHGSHVHGSHAGETYTSWLSEWENEFPASVVKAVLKYGKKQ  365 (687)
Q Consensus       291 --A~~~d~~~~~~~~~iRR~s~t~~~~RPkr---s~~R~~h~~~~~~~~~d~~ys~kk~~~el~F~~eVlkeL~K~G~k~  365 (687)
                        ..+.+........+++|..    +.+-.+   +..|-.+..           .+.. .....+...+.++..|+|.+.
T Consensus       721 ~~~~~~~~~~~a~~~~~~~~~----~~~~~~~~~s~~r~~~~~-----------~~e~-~~~~~~p~~~~~~~~~~~~~~  784 (1051)
T KOG0955|consen  721 KIPLDKNEKKKATKLSIPRNR----DSRIIRKEKSRLRKCGIV-----------DTET-SGSPSIPSGGEKTVKKDGLNS  784 (1051)
T ss_pred             ccccccchhhhhhhccccccc----ccccchhhHHHHhhccCc-----------Cccc-cCCCCCCCccccchhcccccc
Confidence              1111111111122222221    000000   000111100           0001 011244444466667777665


Q ss_pred             cccccCcccccCCCCcCCCCCCceeeecCceeeEEEecccCcchhHHHHHHHHhhhChhHHHHHHHhhhhcCCCCCCCCC
Q 005620          366 FTVDVNRRDTYHDSMASRHEPSVLTTFEGELKQLTVVGLNTEHGYARSLARFASDLGPVVWNIASKKIESVLPLGVKFSP  445 (687)
Q Consensus       366 ~~~de~rR~Ty~~~~~~~~~~~~~~~~~~e~K~lv~vg~~~~~~YarSlarFaa~lGp~~w~ia~~ki~~~lp~~~~fg~  445 (687)
                          .+++.+|.+-.++..+++++++++++.|++.|+++..+.+|+||+++.+++++++||.+|+.+++..++.+..||.
T Consensus       785 ----~~~~~~~~~~~s~p~~~~~~sp~~~~~~~~~p~~l~~~s~~~~sn~~l~~n~t~~~~~~~~~~~~~~~~~~~~~g~  860 (1051)
T KOG0955|consen  785 ----KNLKMSSDQALSSPPSEPLGSPYNDSVKGVKPSVLLEKSGLLRSNANLSQNPTASANNLASTSCSVTKATFTGNGV  860 (1051)
T ss_pred             ----cccccccchhhcCCCCCCCCCCccccccccCchhhHhhccccccccccccCCCcccccccccccccccCCccCCCC
Confidence                8999999998777788899999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccCCCCcc---cc--ccCCccccccCCCCCCCC-CCCCCCCCCcccchhhcccccC
Q 005620          446 GWVGENKATER---QQ--YSYPEKQKLSNNYISGDH-SSRLVSPATSDSNFILENRYSL  498 (687)
Q Consensus       446 gWvge~~~~~~---~~--~~~~~~~~~~~~~~~~~h-~~~~~~~~~~~~~~~~~~~~~~  498 (687)
                      ||+++....+.   ++  ..++....++..++...| +++...++++.+++.++|..+.
T Consensus       861 g~~~~tP~~~~e~~~~~ss~~p~~~s~~~~p~~~~~~~s~~r~~ta~~~sa~~~~~~~g  919 (1051)
T KOG0955|consen  861 GGDVKTPKRPSEPSSIISSLSPSSKSTSICPKHGVCKPSGERMPTASVTSADISNINGG  919 (1051)
T ss_pred             CccccCCCCcCCccccccccCCcCCccccCCccccCCcccccCCccccccccccccccc
Confidence            99888866663   33  234434444444455555 5888888999999888886655

>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] Back     alignment and domain information
>KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] Back     alignment and domain information
>KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query687
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 8e-20
3hme_A123 Crystal Structure Of Human Bromodomain Containing 9 2e-18
2d9e_A121 Solution Structure Of The Bromodomain Of Peregrin L 7e-17
2i7k_A117 Solution Structure Of The Bromodomain Of Human Brd7 2e-14
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 3e-12
3dai_A130 Crystal Structure Of The Bromodomain Of The Human A 6e-12
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 2e-11
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 1e-06
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 2e-11
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 1e-06
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 2e-11
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 1e-06
2e7n_A117 Solution Structure Of The Second Bromodomain From H 9e-11
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 9e-11
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 1e-10
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 4e-10
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 5e-10
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 5e-10
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 6e-10
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 6e-10
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 6e-10
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 3e-09
2dkw_A131 Solution Structure Of The Bromodomain Of Human Prot 3e-09
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 4e-09
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 4e-09
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 4e-09
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 5e-09
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 5e-09
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 6e-09
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 6e-09
2lsp_B128 Solution Structures Of Brd4 Second Bromodomain With 6e-09
2ouo_A130 Crystal Structure Of The Bromo Domain 2 In Human Br 7e-09
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 8e-09
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 9e-09
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 2e-08
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 4e-08
2r10_A361 Structure Of An Acetylated Rsc4 Tandem Bromodomain 5e-08
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 6e-08
2r0v_A346 Structure Of The Rsc4 Tandem Bromodomain Acetylated 8e-08
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 8e-08
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 1e-07
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 2e-07
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 2e-07
2dww_A114 Crystal Structure Of Bromodomain-Containing Protein 2e-07
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 3e-07
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 3e-07
2grc_A129 1.5 A Structure Of Bromodomain From Human Brg1 Prot 5e-07
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 6e-07
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 8e-07
3uvd_A124 Crystal Structure Of The Bromodomain Of Human Trans 8e-07
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 8e-07
2h60_A128 Solution Structure Of Human Brg1 Bromodomain Length 9e-07
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 9e-07
2r0s_A285 Crystal Structure Of The Rsc4 Tandem Bromodomain Le 1e-06
2r0y_A311 Structure Of The Rsc4 Tandem Bromodomain In Complex 1e-06
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 1e-06
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 2e-06
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 2e-06
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 2e-06
2dat_A123 Solution Structure Of The Bromodomain Of Human SwiS 2e-06
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 2e-06
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 3e-06
3fkm_X166 Plasmodium Falciparum Bromodomain-Containing Protei 3e-06
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 3e-06
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 3e-06
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 4e-06
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 4e-06
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 4e-06
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 7e-06
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 7e-06
3g0j_A124 Crystal Structure Of The Fifth Bromodomain Of Human 3e-05
2yqd_A120 Solution Structure Of The Fifth Bromodomain From Mo 3e-05
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 4e-05
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 5e-05
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 5e-05
3iu5_A116 Crystal Structure Of The First Bromodomain Of Human 4e-04
3k2j_A130 Crystal Structure Of The 3rd Bromodomain Of Human P 8e-04
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure 
Iteration: 1

 Score = 95.5 bits (236), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 49/106 (46%), Positives = 66/106 (62%)
Query: 143 PDRKLLLFVLDRLQKKDTYGVFSEPVDPAELPDYHEIIAHPMDFATVRKKLDAGAYSYLE 202
           P   LL  VLD+LQ KD   +F++PV   E+PDY + I HPMDFAT+RK+L+A  Y  L 
Sbjct: 13  PLTVLLRSVLDQLQDKDPARIFAQPVSLKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLH 72
Query: 203 EFEQDVFLICSNAMQYNAPDTIYFRQARSILDLAKKDFENLRQDSD 248
           EFE+D  LI  N M+YNA DT+++R A  + D         R++ D
Sbjct: 73  EFEEDFDLIIDNCMKYNARDTVFYRAAVRLRDQGGVVLRQARREVD 118
>pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 Back     alignment and structure
>pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 Back     alignment and structure
>pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 Back     alignment and structure
>pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|2GRC|A Chain A, 1.5 A Structure Of Bromodomain From Human Brg1 Protein, A Central Atpase Of SwiSNF REMODELING COMPLEX Length = 129 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|3UVD|A Chain A, Crystal Structure Of The Bromodomain Of Human Transcription Activator Brg1 (Smarca4) In Complex With N-Methyl-2-Pyrrolidone Length = 124 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|2H60|A Chain A, Solution Structure Of Human Brg1 Bromodomain Length = 128 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|2R0S|A Chain A, Crystal Structure Of The Rsc4 Tandem Bromodomain Length = 285 Back     alignment and structure
>pdb|2R0Y|A Chain A, Structure Of The Rsc4 Tandem Bromodomain In Complex With An Acetylated H3 Peptide Length = 311 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|2DAT|A Chain A, Solution Structure Of The Bromodomain Of Human SwiSNF Related Matrix Associated Actin Dependent Regulator Of Cromatin Subfamily A Member 2 Length = 123 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 Back     alignment and structure
>pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query687
2d9e_A121 Peregrin; four-helix bundle, transcription activat 2e-48
3rcw_A135 Bromodomain-containing protein 1; transcription, s 4e-47
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 4e-46
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 2e-45
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 2e-40
3dai_A130 ATPase family AAA domain-containing protein 2; anc 8e-40
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 2e-39
3uv4_A158 Second bromodomain of human transcription initiat 9e-38
2grc_A129 Probable global transcription activator SNF2L4; br 4e-37
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 3e-36
3p1f_A119 CREB-binding protein; structural genomics consorti 7e-36
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 5e-35
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 8e-35
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 4e-34
3d7c_A112 General control of amino acid synthesis protein 5; 8e-34
3aad_A292 Transcription initiation factor TFIID subunit 1; p 1e-33
3aad_A292 Transcription initiation factor TFIID subunit 1; p 9e-28
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 2e-33
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 2e-28
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 6e-33
2dat_A123 Possible global transcription activator SNF2L2; br 8e-33
3nxb_A116 CAT eye syndrome critical region protein 2; struct 2e-32
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 3e-32
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 3e-31
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 9e-31
3fkm_X166 Signaling protein; bromodomain, malaria, structura 1e-30
4alg_A154 Bromodomain-containing protein 2; signaling protei 2e-30
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 3e-30
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 3e-30
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 2e-29
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-28
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 1e-27
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 2e-27
2r0y_A311 Chromatin structure-remodeling complex protein RSC 7e-27
2r0y_A311 Chromatin structure-remodeling complex protein RSC 2e-23
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 5e-26
2r10_A361 Chromatin structure-remodeling complex protein RSC 8e-26
2r10_A361 Chromatin structure-remodeling complex protein RSC 3e-20
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 1e-24
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 6e-19
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 2e-12
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 6e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
 Score =  164 bits (418), Expect = 2e-48
 Identities = 44/118 (37%), Positives = 69/118 (58%)

Query: 137 GPTTTLPDRKLLLFVLDRLQKKDTYGVFSEPVDPAELPDYHEIIAHPMDFATVRKKLDAG 196
           G + +     LL   L++LQ+KDT  +FSEPV  +E+PDY + I  PMDF T+++ L+A 
Sbjct: 1   GSSGSSGFLILLRKTLEQLQEKDTGNIFSEPVPLSEVPDYLDHIKKPMDFFTMKQNLEAY 60

Query: 197 AYSYLEEFEQDVFLICSNAMQYNAPDTIYFRQARSILDLAKKDFENLRQDSDDSEPQP 254
            Y   ++FE+D  LI SN ++YNA DTI++R A  + +         R+ ++     P
Sbjct: 61  RYLNFDDFEEDFNLIVSNCLKYNAKDTIFYRAAVRLREQGGAVLRQARRQAEKMGSGP 118
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query687
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.93
3d7c_A112 General control of amino acid synthesis protein 5; 99.93
2d9e_A121 Peregrin; four-helix bundle, transcription activat 99.93
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.93
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 99.93
2dat_A123 Possible global transcription activator SNF2L2; br 99.93
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.93
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.93
2grc_A129 Probable global transcription activator SNF2L4; br 99.92
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.92
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.92
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.92
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.92
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.92
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.92
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.92
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.92
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.92
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.91
3p1f_A119 CREB-binding protein; structural genomics consorti 99.91
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.91
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.91
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.91
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.91
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 99.9
3uv4_A158 Second bromodomain of human transcription initiat 99.9
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.89
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.89
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.88
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.86
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.86
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.86
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.86
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.85
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.84
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.83
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.81
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.8
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.77
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.76
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.71
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 99.4
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
Probab=99.93  E-value=2.6e-26  Score=219.31  Aligned_cols=113  Identities=27%  Similarity=0.395  Sum_probs=105.7

Q ss_pred             CCChHHHHHHHHHHHHHHccCCCCCCCCCCCCC--CCCchhhccCCccCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHhc
Q 005620          139 TTTLPDRKLLLFVLDRLQKKDTYGVFSEPVDPA--ELPDYHEIIAHPMDFATVRKKLDAGAYSYLEEFEQDVFLICSNAM  216 (687)
Q Consensus       139 ~~p~p~kk~L~~IL~~L~k~d~s~pF~ePVD~~--elPDYyeIIK~PMDLsTIkkKLk~g~Y~S~~EF~~DV~LIfsNA~  216 (687)
                      .....++.+|..||+.|.+++.+++|.+|||+.  .+||||++|++||||+||++||+++.|.++++|++||+|||.||+
T Consensus        28 r~t~~l~~~~~~il~~l~~~~~a~~F~~PVd~~~~~~PdY~~iIk~PMDL~tI~~kl~~~~Y~s~~ef~~Dv~Lif~Na~  107 (154)
T 4alg_A           28 RVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCY  107 (154)
T ss_dssp             CCBHHHHHHHHTHHHHHHTSTTCGGGSSCCCTTTTTCTTHHHHCSSCCCHHHHHHHHHTTCCSSHHHHHHHHHHHHHHHH
T ss_pred             cchHHHHHHHHHHHHHHHhCcCchhhcCCCChhhccCCCHHHHcCCCCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHH
Confidence            345678899999999999999999999999988  699999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCHHHHHHHHHHHHHHHHHHhhhcCCCCCC
Q 005620          217 QYNAPDTIYFRQARSILDLAKKDFENLRQDSDDSE  251 (687)
Q Consensus       217 ~YN~pdS~V~k~A~~Le~~fek~~ekl~~e~~~eE  251 (687)
                      +||++++.||.+|..|++.|++.|++++.++.+.+
T Consensus       108 ~YN~~~s~i~~~A~~L~~~f~~~~~~l~~~~~e~~  142 (154)
T 4alg_A          108 IYNKPTDDIVLMAQTLEKIFLQKVASMPQEEQELV  142 (154)
T ss_dssp             HHSCTTSHHHHHHHHHHHHHHHHHTTSCSSCCBCC
T ss_pred             HHCCCCCHHHHHHHHHHHHHHHHHHHCCchhcccc
Confidence            99999999999999999999999999987765433
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 687
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 7e-30
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 3e-29
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 8e-29
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 9e-29
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 2e-25
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 1e-24
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: CREB-binding protein, CBP
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  111 bits (279), Expect = 7e-30
 Identities = 31/105 (29%), Positives = 62/105 (59%), Gaps = 3/105 (2%)

Query: 145 RKLLLFVLDRLQKKDTYGV-FSEPVDP--AELPDYHEIIAHPMDFATVRKKLDAGAYSYL 201
           R+ L+  L+ L ++D   + F +PVDP    +PDY +I+ +PMD +T+++KLD G Y   
Sbjct: 8   RQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEP 67

Query: 202 EEFEQDVFLICSNAMQYNAPDTIYFRQARSILDLAKKDFENLRQD 246
            ++  DV+L+ +NA  YN   +  ++    + ++ +++ + + Q 
Sbjct: 68  WQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQS 112
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query687
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.93
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.92
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.91
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.91
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.9
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.93  E-value=3e-26  Score=205.32  Aligned_cols=104  Identities=28%  Similarity=0.512  Sum_probs=100.5

Q ss_pred             HHHHHHHHHHHHHHccCCCCCCCCCCCCCCCCchhhccCCccCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHhcccCCCC
Q 005620          143 PDRKLLLFVLDRLQKKDTYGVFSEPVDPAELPDYHEIIAHPMDFATVRKKLDAGAYSYLEEFEQDVFLICSNAMQYNAPD  222 (687)
Q Consensus       143 p~kk~L~~IL~~L~k~d~s~pF~ePVD~~elPDYyeIIK~PMDLsTIkkKLk~g~Y~S~~EF~~DV~LIfsNA~~YN~pd  222 (687)
                      |+.+.|..||+.|++++.+++|+.|||+..+|+||++|++||||+||++||+++.|.++++|..||+|||.||+.||+++
T Consensus         3 p~~~~l~~il~~l~~~~~a~pF~~pvd~~~~pdY~~vI~~PmdL~tI~~kl~~~~Y~s~~~f~~Dv~li~~Na~~yN~~~   82 (111)
T d1e6ia_           3 PHDAAIQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMEDFIYDARLVFNNCRMYNGEN   82 (111)
T ss_dssp             TTHHHHHHHHHHHHHSTTCGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCSSHHHHHHHHHHHHHHHHHHSCTT
T ss_pred             hHHHHHHHHHHHHHhCCCChhhcCCCCchhCcCHHHHcCCchhHHHHHHHHHccccchHHHHHHHHHHHHHHHHHHCCCC
Confidence            45799999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHHHHHhhhcC
Q 005620          223 TIYFRQARSILDLAKKDFENLRQD  246 (687)
Q Consensus       223 S~V~k~A~~Le~~fek~~ekl~~e  246 (687)
                      |.++.+|..|++.|++.|++++..
T Consensus        83 s~i~~~A~~l~~~f~~~~~~ipe~  106 (111)
T d1e6ia_          83 TSYYKYANRLEKFFNNKVKEIPEY  106 (111)
T ss_dssp             SHHHHHHHHHHHHHHHHHHTSGGG
T ss_pred             CHHHHHHHHHHHHHHHHHHHhhcc
Confidence            999999999999999999998654
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure