Citrus Sinensis ID: 005668
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 684 | ||||||
| 255544738 | 674 | DNA binding protein, putative [Ricinus c | 0.919 | 0.933 | 0.544 | 1e-168 | |
| 449448952 | 673 | PREDICTED: uncharacterized protein LOC10 | 0.783 | 0.796 | 0.464 | 1e-112 | |
| 225450325 | 686 | PREDICTED: uncharacterized protein LOC10 | 0.852 | 0.849 | 0.394 | 4e-90 | |
| 224073218 | 385 | bromodomain protein [Populus trichocarpa | 0.470 | 0.836 | 0.531 | 7e-85 | |
| 449436657 | 703 | PREDICTED: uncharacterized protein LOC10 | 0.884 | 0.860 | 0.368 | 2e-71 | |
| 449519334 | 688 | PREDICTED: uncharacterized protein LOC10 | 0.871 | 0.866 | 0.363 | 4e-71 | |
| 297820594 | 629 | predicted protein [Arabidopsis lyrata su | 0.742 | 0.807 | 0.362 | 3e-65 | |
| 356555278 | 746 | PREDICTED: uncharacterized protein LOC10 | 0.757 | 0.694 | 0.360 | 1e-64 | |
| 356528554 | 747 | PREDICTED: uncharacterized protein LOC10 | 0.752 | 0.689 | 0.352 | 4e-64 | |
| 224053014 | 251 | hypothetical protein POPTRDRAFT_547688 [ | 0.321 | 0.876 | 0.575 | 7e-64 |
| >gi|255544738|ref|XP_002513430.1| DNA binding protein, putative [Ricinus communis] gi|223547338|gb|EEF48833.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 599 bits (1544), Expect = e-168, Method: Compositional matrix adjust.
Identities = 392/720 (54%), Positives = 491/720 (68%), Gaps = 91/720 (12%)
Query: 1 MARERHGTTSQQQQQWGTLEELLLACAVNRHGTRSWDSIAMEVQNRSSALSSLTPQSCRD 60
MAR+ H + Q WGTLEELLLACAVNRHGT+SWDSIAMEVQNR+S L SLT Q+C+D
Sbjct: 10 MARQHHHQETSVQP-WGTLEELLLACAVNRHGTKSWDSIAMEVQNRTSTLPSLTSQNCKD 68
Query: 61 KFNEIRRRFTVKNGAESTSLVPLVDQLRQIRVQELRAEVQRRDVSIVSLELKVKRLEEER 120
K+N+++RRF +N S ++DQLR+IRV+ELR EVQRRDVSIVSLELKVKRLEEER
Sbjct: 69 KYNDLKRRFMSQNDTSS-----IIDQLRKIRVEELRREVQRRDVSIVSLELKVKRLEEER 123
Query: 121 EKSMKPEADLESDRKAMPEIEAAVDGDGDS-----NRSFNESNST-TQKAETTN-KKQND 173
E+S K EADL S+RK + GD DS +RSFNESNST QKAETT ++QND
Sbjct: 124 ERSFKEEADLISERKFSIAGNSTAGGD-DSVDERDSRSFNESNSTGQQKAETTMVRQQND 182
Query: 174 DAEGEEEKEQKMKPEP-DVENDPVQNRTESGPDREDRDWSSNGKLNENGNGTGNVKEETD 232
D + ++QK+K +P D EN Q+ SG D G ++NGN
Sbjct: 183 DVD----RQQKIKVKPNDSENKNEQDPVPSGSD--------PGGSHKNGN---------- 220
Query: 233 EDNDKTASEGKVESVKNKTSAVGGLSESNELWD---ESKRE-------GKQSSDVQSSAS 282
D A K +K + G ESNE+ + ESKRE + +SDVQSS S
Sbjct: 221 -DKKPLAMVKKESEIKTSQTTGGFGGESNEVGESVGESKREERDKEKEKQNNSDVQSSIS 279
Query: 283 LSRNKRRR-------------SGEEPYD-EEVSPATKKVLAVKSEPLVRFLGMIRSHRLS 328
LS+NK++R SGEEP +EVSPA VKSEPLV+ LG+IRSHRL
Sbjct: 280 LSQNKKKRRGSSGGGDRVGSSSGEEPEGGDEVSPA------VKSEPLVKLLGIIRSHRLG 333
Query: 329 SHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVIFFR 388
S FERRLRSQESERYK L+RQHIDL+TIQSRLD+G+YS+C QKFFRDLLLLFNN +IFFR
Sbjct: 334 STFERRLRSQESERYKNLIRQHIDLQTIQSRLDKGVYSSCIQKFFRDLLLLFNNAIIFFR 393
Query: 389 KSSQEYAAAQELRTLVIKEMTDMLRKQQPIAVTKPKPKPKPEHHRQQPQPPPASLSKPNR 448
K+S E AA ELR +V KEMT+ LRK + VT KPE P+ S SKPN+
Sbjct: 394 KNSPENLAACELRAVVQKEMTEKLRKLKTEPVT-----AKPE-----PKQTAVSFSKPNK 443
Query: 449 -GSTMVVCGKRSSIKAISKNAYGKKGDRKDREVEEKPKVNEKKVDSSFVGIEDKGIKKKR 507
ST+VVCGK +S KAI +N KKGD+K+REVEEK K+NE+++D SFV IE+K I+KKR
Sbjct: 444 SSSTIVVCGKGNSKKAIPENDI-KKGDKKEREVEEKIKLNERQID-SFVKIEEKSIRKKR 501
Query: 508 SQERSVSLRRNSRSSSRSGDVKHQFGGNELSSHDTLEAKTENKKENAVKKKKLGAASFLK 567
+++RS+S R+S +S+++G+VKHQ+GGNELSSHD LE K E K + + +KK GAASFLK
Sbjct: 502 TKDRSISNHRSSNTSNKNGEVKHQYGGNELSSHDALEMKVERKGKGSTARKKQGAASFLK 561
Query: 568 RMKQNSPSEVMEDDDEEEDENDNDNDDDDSGDDSKDSKVEEEKKRR--SVTRRDVNRVTR 625
RMKQNSPSEV E+DDE+ D++++++ ++ + KDSK +EEK RR + RVTR
Sbjct: 562 RMKQNSPSEVPENDDEDYDDDNDNDSSEED--EKKDSKGKEEKGRRRGKIIDGMTERVTR 619
Query: 626 SSRGRGVREENR-RRGVGRPPKRSASGAMSPPEKTSGKRGRDNGESEVGGGGRSRKRTRR 684
SSRGRG RE R +RGVGRPP++ A S +GKRGR+NG SEV GR+RKR++R
Sbjct: 620 SSRGRGARENGRGKRGVGRPPRKQAERGESGG--GTGKRGRENGGSEV---GRTRKRSKR 674
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|449448952|ref|XP_004142229.1| PREDICTED: uncharacterized protein LOC101213195 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|225450325|ref|XP_002268328.1| PREDICTED: uncharacterized protein LOC100263099 [Vitis vinifera] gi|147768907|emb|CAN75881.1| hypothetical protein VITISV_024454 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224073218|ref|XP_002304028.1| bromodomain protein [Populus trichocarpa] gi|222841460|gb|EEE79007.1| bromodomain protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449436657|ref|XP_004136109.1| PREDICTED: uncharacterized protein LOC101208443 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449519334|ref|XP_004166690.1| PREDICTED: uncharacterized protein LOC101228284 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297820594|ref|XP_002878180.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297324018|gb|EFH54439.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356555278|ref|XP_003545961.1| PREDICTED: uncharacterized protein LOC100779988 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356528554|ref|XP_003532866.1| PREDICTED: uncharacterized protein LOC100811021 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224053014|ref|XP_002297664.1| hypothetical protein POPTRDRAFT_547688 [Populus trichocarpa] gi|222844922|gb|EEE82469.1| hypothetical protein POPTRDRAFT_547688 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 684 | ||||||
| TAIR|locus:2060040 | 631 | AT2G42150 [Arabidopsis thalian | 0.154 | 0.167 | 0.445 | 4.7e-36 | |
| TAIR|locus:2101477 | 641 | AT3G60110 [Arabidopsis thalian | 0.296 | 0.316 | 0.324 | 2.5e-19 | |
| TAIR|locus:2050574 | 646 | AT2G44430 [Arabidopsis thalian | 0.356 | 0.377 | 0.287 | 3.1e-18 | |
| TAIR|locus:2095878 | 632 | AT3G57980 [Arabidopsis thalian | 0.321 | 0.348 | 0.305 | 1.7e-17 | |
| TAIR|locus:1006230673 | 475 | BRD4 "AT1G61215" [Arabidopsis | 0.216 | 0.311 | 0.284 | 1.7e-16 |
| TAIR|locus:2060040 AT2G42150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 240 (89.5 bits), Expect = 4.7e-36, Sum P(3) = 4.7e-36
Identities = 49/110 (44%), Positives = 69/110 (62%)
Query: 1 MARERHGTTSXXXXXWGTLEELLLACAVNRHGTRSWDSIAMEVQNRSSALSSLTPQSCRD 60
MA+ + T W T EELLLACAV+RHGT SW+S++ E+Q S L SLT +CR
Sbjct: 1 MAKPENDVTLTEKQTWSTWEELLLACAVHRHGTESWNSVSAEIQKLSPNLCSLTASACRH 60
Query: 61 KFNEIRRRFT----VKNGAESTSLVPLVDQLRQIRVQELRAEVQRRDVSI 106
K+ +++ RFT V S P +++LR++RV ELR EV++ D+SI
Sbjct: 61 KYFDLKSRFTQELPVPESVAEISTAPWLEELRKLRVDELRREVEQYDLSI 110
|
|
| TAIR|locus:2101477 AT3G60110 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2050574 AT2G44430 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2095878 AT3G57980 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:1006230673 BRD4 "AT1G61215" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| BRD913 | bromodomain protein (385 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 684 | |||
| smart00297 | 107 | smart00297, BROMO, bromo domain | 3e-17 | |
| cd04369 | 99 | cd04369, Bromodomain, Bromodomain | 2e-15 | |
| pfam00439 | 84 | pfam00439, Bromodomain, Bromodomain | 1e-12 | |
| cd05507 | 104 | cd05507, Bromo_brd8_like, Bromodomain, brd8_like s | 6e-09 | |
| cd05492 | 109 | cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like | 7e-08 | |
| cd05502 | 109 | cd05502, Bromo_tif1_like, Bromodomain; tif1_like s | 1e-06 | |
| cd05522 | 104 | cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i | 6e-06 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 6e-06 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 2e-05 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 2e-05 | |
| cd05509 | 101 | cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s | 3e-05 | |
| cd05495 | 108 | cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub | 1e-04 | |
| cd05498 | 102 | cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik | 2e-04 | |
| cd05524 | 113 | cd05524, Bromo_polybromo_I, Bromodomain, polybromo | 2e-04 | |
| PRK12678 | 672 | PRK12678, PRK12678, transcription termination fact | 9e-04 | |
| cd05505 | 97 | cd05505, Bromo_WSTF_like, Bromodomain; Williams sy | 0.001 | |
| cd05497 | 107 | cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like | 0.001 | |
| PTZ00108 | 1388 | PTZ00108, PTZ00108, DNA topoisomerase 2-like prote | 0.001 | |
| cd05499 | 102 | cd05499, Bromo_BDF1_2_II, Bromodomain | 0.002 | |
| cd05503 | 97 | cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA | 0.002 | |
| cd05504 | 115 | cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o | 0.003 | |
| PRK05901 | 509 | PRK05901, PRK05901, RNA polymerase sigma factor; P | 0.004 | |
| COG5076 | 371 | COG5076, COG5076, Transcription factor involved in | 0.004 |
| >gnl|CDD|197636 smart00297, BROMO, bromo domain | Back alignment and domain information |
|---|
Score = 77.3 bits (191), Expect = 3e-17
Identities = 28/100 (28%), Positives = 55/100 (55%), Gaps = 1/100 (1%)
Query: 312 SEPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQK 371
E L L + SH LS F + + +E+ Y ++++ +DL+TI+ +L+ G YS+ ++
Sbjct: 9 QELLKAVLDKLDSHPLSWPFLKPVSRKEAPDYYDIIKKPMDLKTIKKKLENGKYSS-VEE 67
Query: 372 FFRDLLLLFNNFVIFFRKSSQEYAAAQELRTLVIKEMTDM 411
F D L+F+N + S+ Y A++L K++ ++
Sbjct: 68 FVADFNLMFSNARTYNGPDSEVYKDAKKLEKFFEKKLREL 107
|
Length = 107 |
| >gnl|CDD|99922 cd04369, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99924 cd05492, Bromo_ZMYND11, Bromodomain; ZMYND11_like sub-family | Back alignment and domain information |
|---|
| >gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|240271 PTZ00108, PTZ00108, DNA topoisomerase 2-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|235640 PRK05901, PRK05901, RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 684 | |||
| cd05507 | 104 | Bromo_brd8_like Bromodomain, brd8_like subgroup. I | 99.93 | |
| cd05497 | 107 | Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily | 99.92 | |
| cd05495 | 108 | Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb | 99.92 | |
| cd05505 | 97 | Bromo_WSTF_like Bromodomain; Williams syndrome tra | 99.92 | |
| cd05496 | 119 | Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub | 99.92 | |
| cd05504 | 115 | Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li | 99.91 | |
| cd05508 | 99 | Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC | 99.91 | |
| cd05503 | 97 | Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s | 99.91 | |
| KOG1474 | 640 | consensus Transcription initiation factor TFIID, s | 99.91 | |
| cd05509 | 101 | Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. | 99.91 | |
| cd05502 | 109 | Bromo_tif1_like Bromodomain; tif1_like subfamily. | 99.91 | |
| cd05510 | 112 | Bromo_SPT7_like Bromodomain; SPT7_like subfamily. | 99.9 | |
| cd05528 | 112 | Bromo_AAA Bromodomain; sub-family co-occurring wit | 99.9 | |
| cd05506 | 99 | Bromo_plant1 Bromodomain, uncharacterized subfamil | 99.9 | |
| cd05511 | 112 | Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum | 99.9 | |
| cd05513 | 98 | Bromo_brd7_like Bromodomain, brd7_like subgroup. T | 99.9 | |
| cd05512 | 98 | Bromo_brd1_like Bromodomain; brd1_like subfamily. | 99.9 | |
| cd05516 | 107 | Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s | 99.89 | |
| cd05499 | 102 | Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam | 99.89 | |
| cd05520 | 103 | Bromo_polybromo_III Bromodomain, polybromo repeat | 99.89 | |
| cd05500 | 103 | Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami | 99.89 | |
| cd05498 | 102 | Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil | 99.89 | |
| cd05524 | 113 | Bromo_polybromo_I Bromodomain, polybromo repeat I. | 99.88 | |
| cd05515 | 105 | Bromo_polybromo_V Bromodomain, polybromo repeat V. | 99.88 | |
| cd05519 | 103 | Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci | 99.87 | |
| cd05501 | 102 | Bromo_SP100C_like Bromodomain, SP100C_like subfami | 99.87 | |
| smart00297 | 107 | BROMO bromo domain. | 99.87 | |
| cd05529 | 128 | Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like | 99.87 | |
| cd05518 | 103 | Bromo_polybromo_IV Bromodomain, polybromo repeat I | 99.86 | |
| cd05525 | 106 | Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 | 99.86 | |
| cd05517 | 103 | Bromo_polybromo_II Bromodomain, polybromo repeat I | 99.85 | |
| cd04369 | 99 | Bromodomain Bromodomain. Bromodomains are found in | 99.84 | |
| cd05522 | 104 | Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l | 99.84 | |
| PF00439 | 84 | Bromodomain: Bromodomain; InterPro: IPR001487 Brom | 99.84 | |
| cd05521 | 106 | Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik | 99.82 | |
| cd05492 | 109 | Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | 99.81 | |
| cd05526 | 110 | Bromo_polybromo_VI Bromodomain, polybromo repeat V | 99.69 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 99.66 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 99.66 | |
| KOG1472 | 720 | consensus Histone acetyltransferase SAGA/ADA, cata | 99.49 | |
| cd05494 | 114 | Bromodomain_1 Bromodomain; uncharacterized subfami | 99.1 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 99.06 | |
| KOG0008 | 1563 | consensus Transcription initiation factor TFIID, s | 98.97 | |
| cd05491 | 119 | Bromo_TBP7_like Bromodomain; TBP7_like subfamily, | 98.83 | |
| KOG0008 | 1563 | consensus Transcription initiation factor TFIID, s | 98.77 | |
| KOG1827 | 629 | consensus Chromatin remodeling complex RSC, subuni | 98.76 | |
| KOG0386 | 1157 | consensus Chromatin remodeling complex SWI/SNF, co | 98.74 | |
| KOG1474 | 640 | consensus Transcription initiation factor TFIID, s | 98.54 | |
| KOG1472 | 720 | consensus Histone acetyltransferase SAGA/ADA, cata | 98.45 | |
| KOG1828 | 418 | consensus IRF-2-binding protein CELTIX-1, contains | 98.43 | |
| KOG1828 | 418 | consensus IRF-2-binding protein CELTIX-1, contains | 98.13 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 97.74 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 97.42 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 97.37 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 96.89 | |
| cd05493 | 131 | Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- | 96.18 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 95.8 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 93.67 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 91.71 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 90.05 | |
| KOG0644 | 1113 | consensus Uncharacterized conserved protein, conta | 89.23 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 87.9 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 87.34 | |
| KOG0732 | 1080 | consensus AAA+-type ATPase containing the bromodom | 85.9 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 85.65 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 84.91 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 84.0 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 83.14 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 80.26 |
| >cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
Probab=99.93 E-value=6.8e-26 Score=203.53 Aligned_cols=100 Identities=23% Similarity=0.435 Sum_probs=96.3
Q ss_pred CchHHHHHHHHHHhCcCCcccccccCccccchhhhhhcCCCCHHHHHHHHhCCCccCcHHHHHHHHHHHHHHHhhhCCCC
Q 005668 311 KSEPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVIFFRKS 390 (684)
Q Consensus 311 kskpLl~ILe~L~~hk~a~pF~~PVD~qe~PdYyeIIK~PMDLsTIKkKLe~g~YsSi~~EF~rDL~LMF~NA~~FN~pd 390 (684)
..+.|+.||+.|..|+.+++|..||+...+|+||++|++||||+||++||++|.|.++. +|.+||.|||+||++||+++
T Consensus 4 ~~~~~~~il~~l~~~~~a~~F~~pV~~~~~p~Y~~iIk~PmDL~tI~~kl~~~~Y~s~~-ef~~D~~li~~Na~~yN~~~ 82 (104)
T cd05507 4 WKKAILLVYRTLASHRYASVFLKPVTEDIAPGYHSVVYRPMDLSTIKKNIENGTIRSTA-EFQRDVLLMFQNAIMYNSSD 82 (104)
T ss_pred HHHHHHHHHHHHHcCCCCHhhcCCCCccccCCHHHHhCCCcCHHHHHHHHhcCCCCCHH-HHHHHHHHHHHHHHHHCCCC
Confidence 34789999999999999999999999999999999999999999999999999999998 99999999999999999999
Q ss_pred CHHHHHHHHHHHHHHHHHHHH
Q 005668 391 SQEYAAAQELRTLVIKEMTDM 411 (684)
Q Consensus 391 S~vykaA~eLr~lf~k~msk~ 411 (684)
+.+|.+|..|+..|.+.|.+.
T Consensus 83 s~v~~~A~~l~~~~~~~~~~~ 103 (104)
T cd05507 83 HDVYLMAVEMQREVMSQIQQL 103 (104)
T ss_pred CHHHHHHHHHHHHHHHHhhcc
Confidence 999999999999999998764
|
In mammals, brd8 (bromodomain containing 8) interacts with the thyroid hormone receptor in a ligand-dependent fashion and enhances thyroid hormone-dependent activation from thyroid response elements. Brd8 is thought to be a nuclear receptor coactivator. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. |
| >cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] | Back alignment and domain information |
|---|
| >cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >cd05499 Bromo_BDF1_2_II Bromodomain | Back alignment and domain information |
|---|
| >cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >cd05500 Bromo_BDF1_2_I Bromodomain | Back alignment and domain information |
|---|
| >cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >smart00297 BROMO bromo domain | Back alignment and domain information |
|---|
| >cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >cd04369 Bromodomain Bromodomain | Back alignment and domain information |
|---|
| >cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] | Back alignment and domain information |
|---|
| >cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | Back alignment and domain information |
|---|
| >cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] | Back alignment and domain information |
|---|
| >cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi | Back alignment and domain information |
|---|
| >KOG0008 consensus Transcription initiation factor TFIID, subunit TAF1 [Transcription] | Back alignment and domain information |
|---|
| >KOG1827 consensus Chromatin remodeling complex RSC, subunit RSC1/Polybromo and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1474 consensus Transcription initiation factor TFIID, subunit BDF1 and related bromodomain proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG1472 consensus Histone acetyltransferase SAGA/ADA, catalytic subunit PCAF/GCN5 and related proteins [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] | Back alignment and domain information |
|---|
| >KOG1828 consensus IRF-2-binding protein CELTIX-1, contains BROMO domain [Transcription] | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 684 | |||
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 4e-11 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 6e-11 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 2e-10 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 5e-10 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 7e-10 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 7e-10 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 2e-09 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 2e-09 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 2e-09 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 4e-09 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 5e-09 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 8e-09 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 1e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 3e-08 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 3e-08 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 3e-06 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 8e-08 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 1e-07 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 2e-07 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 2e-07 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 3e-07 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 6e-07 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 7e-07 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 2e-06 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 8e-07 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 9e-07 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 2e-06 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 4e-06 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 4e-06 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 7e-06 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 1e-05 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 1e-05 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 1e-05 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 2e-05 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 1e-04 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 2e-04 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 6e-04 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 8e-04 |
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
Score = 59.7 bits (145), Expect = 4e-11
Identities = 17/94 (18%), Positives = 36/94 (38%), Gaps = 1/94 (1%)
Query: 325 HRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFV 384
L++ +++ Y + + +DL TI+ ++ G Y + F D+L +F N
Sbjct: 30 QALAAPLLNLPPKKKNADYYEKISDPLDLITIEKQILTGYYKT-VEAFDADMLKVFRNAE 88
Query: 385 IFFRKSSQEYAAAQELRTLVIKEMTDMLRKQQPI 418
++ + S LR + + I
Sbjct: 89 KYYGRKSPVGRDVCRLRKAYYNARHEASAQIDEI 122
|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 684 | |||
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 99.93 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 99.93 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 99.93 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 99.93 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 99.92 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 99.92 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 99.92 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 99.92 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 99.92 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 99.92 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 99.92 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 99.92 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 99.92 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.92 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.92 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 99.92 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 99.91 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 99.91 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 99.91 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 99.91 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.91 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 99.91 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 99.91 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 99.9 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 99.9 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 99.9 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.89 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 99.89 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 99.89 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 99.87 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 99.86 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 99.86 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 99.86 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 99.85 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 99.84 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 99.84 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 99.83 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 99.83 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 99.77 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 99.75 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.67 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 99.48 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 97.55 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 97.32 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 97.27 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 97.2 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 97.08 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 97.01 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 96.84 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 96.69 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 96.65 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 96.56 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 96.38 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 96.08 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 95.93 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 95.77 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 94.74 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 95.73 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 95.7 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 95.62 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 95.45 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 95.26 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 95.19 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 95.11 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 95.07 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 95.03 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 94.85 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 94.72 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 94.57 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 94.37 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 94.37 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 94.04 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 92.75 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 92.67 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 92.51 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 91.89 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 91.87 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 91.72 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 91.61 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 91.18 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 84.44 |
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A | Back alignment and structure |
|---|
Probab=99.93 E-value=6.8e-26 Score=204.71 Aligned_cols=101 Identities=25% Similarity=0.332 Sum_probs=98.0
Q ss_pred chHHHHHHHHHHhCcCCcccccccCccccchhhhhhcCCCCHHHHHHHHhCCCccCcHHHHHHHHHHHHHHHhhhCCCCC
Q 005668 312 SEPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVIFFRKSS 391 (684)
Q Consensus 312 skpLl~ILe~L~~hk~a~pF~~PVD~qe~PdYyeIIK~PMDLsTIKkKLe~g~YsSi~~EF~rDL~LMF~NA~~FN~pdS 391 (684)
.+.|..||+.|..|+.+++|..||+...+|+||++|++||||+||+.||+++.|.++. +|..||.|||.||++||+++|
T Consensus 15 ~~~c~~il~~l~~~~~s~~F~~pv~~~~~pdY~~~I~~Pmdl~tI~~kl~~~~Y~~~~-~f~~D~~li~~Na~~yN~~~s 93 (117)
T 3g0l_A 15 LALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKPMDFSTIREKLSSGQYPNLE-TFALDVRLVFDNCETFNEDDS 93 (117)
T ss_dssp HHHHHHHHHHHHTSTTCGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHH-HHHHHHHHHHHHHHHHSCSSS
T ss_pred HHHHHHHHHHHHhCCCchhhcCcCChhhcCChHHHcCCCCCHHHHHHHHhCCCCCCHH-HHHHHHHHHHHHHHHHCCCCC
Confidence 4679999999999999999999999999999999999999999999999999999998 999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHHHHhh
Q 005668 392 QEYAAAQELRTLVIKEMTDMLR 413 (684)
Q Consensus 392 ~vykaA~eLr~lf~k~msk~l~ 413 (684)
.+|.+|..|+.+|++.|.+++.
T Consensus 94 ~~~~~A~~L~~~f~~~~~~~~~ 115 (117)
T 3g0l_A 94 DIGRAGHNMRKYFEKKWTDTFK 115 (117)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHC
T ss_pred HHHHHHHHHHHHHHHHHHHHHc
Confidence 9999999999999999998874
|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 684 | ||||
| d1e6ia_ | 111 | a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c | 5e-11 | |
| d1wuma1 | 118 | a.29.2.1 (A:715-832) P300/CAF histone acetyltransf | 4e-10 | |
| d3dwya1 | 114 | a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { | 1e-09 | |
| d1eqfa2 | 128 | a.29.2.1 (A:1498-1625) TAFII250 double bromodomain | 7e-08 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 0.003 |
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bromodomain-like superfamily: Bromodomain family: Bromodomain domain: GCN5 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 58.0 bits (140), Expect = 5e-11
Identities = 19/97 (19%), Positives = 45/97 (46%), Gaps = 1/97 (1%)
Query: 315 LVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFR 374
+ L +++H + F + + +E Y +++ +DL T++ +L+ Y F
Sbjct: 8 IQNILTELQNHAAAWPFLQPVNKEEVPDYYDFIKEPMDLSTMEIKLESNKYQKMED-FIY 66
Query: 375 DLLLLFNNFVIFFRKSSQEYAAAQELRTLVIKEMTDM 411
D L+FNN ++ +++ Y A L ++ ++
Sbjct: 67 DARLVFNNCRMYNGENTSYYKYANRLEKFFNNKVKEI 103
|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 684 | |||
| d3d7ca1 | 102 | GCN5 {Human (Homo sapiens) [TaxId: 9606]} | 99.93 | |
| d1e6ia_ | 111 | GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.92 | |
| d1wuma1 | 118 | P300/CAF histone acetyltransferase bromodomain {Hu | 99.92 | |
| d3dwya1 | 114 | CREB-binding protein, CBP {Human (Homo sapiens) [T | 99.91 | |
| d1eqfa1 | 139 | TAFII250 double bromodomain module {Human (Homo sa | 99.91 | |
| d1eqfa2 | 128 | TAFII250 double bromodomain module {Human (Homo sa | 99.91 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 97.92 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 97.53 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 97.31 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 97.14 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 97.1 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 96.9 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 96.9 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 96.88 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 96.51 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 96.5 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 95.98 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 95.87 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 91.46 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 88.63 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 80.35 |
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bromodomain-like superfamily: Bromodomain family: Bromodomain domain: GCN5 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=3.9e-26 Score=200.34 Aligned_cols=97 Identities=24% Similarity=0.331 Sum_probs=93.8
Q ss_pred hHHHHHHHHHHhCcCCcccccccCccccchhhhhhcCCCCHHHHHHHHhCCCccCcHHHHHHHHHHHHHHHhhhCCCCCH
Q 005668 313 EPLVRFLGMIRSHRLSSHFERRLRSQESERYKKLVRQHIDLRTIQSRLDRGLYSNCFQKFFRDLLLLFNNFVIFFRKSSQ 392 (684)
Q Consensus 313 kpLl~ILe~L~~hk~a~pF~~PVD~qe~PdYyeIIK~PMDLsTIKkKLe~g~YsSi~~EF~rDL~LMF~NA~~FN~pdS~ 392 (684)
..|..||..|..|+.+++|..||+...+|+||++|++||||.||++||.++.|.++. +|.+||.|||.||+.||+++|.
T Consensus 5 ~~l~~il~~l~~~~~s~~F~~pv~~~~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~-~f~~D~~li~~Na~~yN~~~s~ 83 (102)
T d3d7ca1 5 TTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRK-LFVADLQRVIANCREYNPPDSE 83 (102)
T ss_dssp HHHHHHHHHHHHSGGGGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHH-HHHHHHHHHHHHHHHHSCTTSH
T ss_pred HHHHHHHHHHHhCCCCCccCCCCChhhCcCHHHHcCCccCHHHHHHHhccCccCCHH-HHHHHHHHHHHHHHHHCCCCCH
Confidence 468899999999999999999999999999999999999999999999999999998 9999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHHH
Q 005668 393 EYAAAQELRTLVIKEMTD 410 (684)
Q Consensus 393 vykaA~eLr~lf~k~msk 410 (684)
+|.+|..|+++|.++|++
T Consensus 84 ~~~~A~~l~~~f~~~~ke 101 (102)
T d3d7ca1 84 YCRCASALEKFFYFKLKE 101 (102)
T ss_dssp HHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHhc
Confidence 999999999999998875
|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|