Citrus Sinensis ID: 005990


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660------
MAPKAKPKPSPSPSQPPPPIEDLFTSLNRHIERSEFEQAVKVADQVLSTNPSDEDAMRCKVVALIKADNIDDALSTIQSSQKFTFDFNYLKAYCLYRQNRLDEALESLKIQENNPATMLLKSQILYRSGEMDACVEFYQKLQKSKIDSLEINFVAGLISAGRASEVQKTLDSLRVKATSSFELAYNTACSLAEMNKYTEAEQLLLTARRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVDKAESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESASYFEVNEAHGEGKNKDKAKKKRKRKPRYPKGFDPANPGPPPDPERWLPKRERSSYRPRRKDKRAAQVRGSQGAVVREKHDAGAAGASSNSTSSQATSSKGAAQNVAQSSKGSSKSSRKKSRN
cccccccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccccccHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHcccccccccccHHHHHHcccccccccHHHHHHHHccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHEEEEEEEccHHHHHHHHHHcccHHHHHcHHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHcHHHEcccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHcHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHccccHHHccccHHHHHHcccccccHcHccccccccccccccccHHHHHHHccccccccccccccccccccccccccHHccccccccccccccccccccccEcccHHHHHHcccccccccccccccccccHccccccccccccHHccccc
mapkakpkpspspsqppppiedLFTSLNRHIERSEFEQAVKVADQVlstnpsdedaMRCKVVALIKADNIDDALSTIQSSQKFTFDFNYLKAYCLYRQNRLDEALESLkiqennpatmlLKSQILYRSGEMDACVEFYQKLQKSKIDSLEINFVAGLISAGRASEVQKTLDSLRVKATSSFELAYNTACSLAEMNKYTEAEQLLLTARRIGqetltddnfaeddieiELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVAlkgpkdvndsLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAAlpdmfpdsvMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAanhpfiaaeslakipdiqhmpATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKlrhgreedASHLFEELVKTHGSIEALVGLVTTsahvdvdkaesyekrlkplpglngvdvdslektsgakhvesasyfevneahgegknkdkakkkrkrkprypkgfdpanpgpppdperwlpkrerssyrprrkdkraaqvrgsqgavvrekhdagaagassnstssqatsskgaaqnvaqsskgsskssrkksrn
mapkakpkpspspsqppppIEDLFTSLNRHIERSEFEQAVKVADQVlstnpsdedamRCKVVALIKADNIDDALSTIQSSQKFTFDFNYLKAYCLYRQNRLDEALESlkiqennpatmLLKSQILYRSGEMDACVEFYQKLQKSKIDSLEINFVAGLISAGRASEVQKTLDSLRVKATSSFELAYNTACSLAEMNKYTEAEQLLLTARRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNlvalkgpkdvndSLKKLDRikekdmqnfqlarvldlrlspkqREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVDKAesyekrlkplpglngvdvdSLEKTSGakhvesasyfevneahgegknkdkakkkrkrkprypkgfdpanpgpppdperwlpkrerssyrprrkdkraaqvrgsqgavvrekhdagaagassnstssqatsskgaaqnvaqsskgsskssrkksrn
MapkakpkpspspsqppppIEDLFTSLNRHIERSEFEQAVKVADQVLSTNPSDEDAMRCKVVALIKADNIDDALSTIQSSQKFTFDFNYLKAYCLYRQNRLDEALESLKIQENNPATMLLKSQILYRSGEMDACVEFYQKLQKSKIDSLEINFVAGLISAGRASEVQKTLDSLRVKATSSFELAYNTACSLAEMNKYTEAEQLLLTARRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLaraqvaaaaNHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVDKAESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESASYFEVNEAHGEGknkdkakkkrkrkprypkgfdpanpgpppdpERWLPKRERSSYRPRRKDKRAAQVRGSQGAVVREKHDagaagassnstssqatsskgaaqNVAQsskgsskssrkksrN
********************************************************MRCKVVALIKADNIDDALSTIQSSQKFTFDFNYLKAYCLYRQNRLDEALESLKIQENNPATMLLKSQILYRSGEMDACVEFYQKLQKSKIDSLEINFVAGLISAGRASEVQKTLDSLRVKATSSFELAYNTACSLAEMNKYTEAEQLLLTARRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPK****************MQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRH*****ASHLFEELVKTHGSIEALVGLVTTSAHVDVD*************************************************************************************************************************************************************
**********************LFTSLNRHIERSEFEQAVKVADQVLSTNPSDEDAMRCKVVALIKADNIDDALSTIQSSQKFTFDFNYLKAYCLYRQNRLDEALESLKIQENNPATMLLKSQILYRSGEMDACVEFYQKLQKSKIDSLEINFVAGLISAGRASEVQKTLDSLRVKATSSFELAYNTACSLAEMNKYTEAEQLLLTARRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVDKA**************GVDVDSLEKTS***********************************************PPDPERWLP**************************************************************************
****************PPPIEDLFTSLNRHIERSEFEQAVKVADQVLSTNPSDEDAMRCKVVALIKADNIDDALSTIQSSQKFTFDFNYLKAYCLYRQNRLDEALESLKIQENNPATMLLKSQILYRSGEMDACVEFYQKLQKSKIDSLEINFVAGLISAGRASEVQKTLDSLRVKATSSFELAYNTACSLAEMNKYTEAEQLLLTARRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVDKAESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESASYFEVN*********************YPKGFDPANPGPPPDPERWLPKRE***********************************************************************
*****************PPIEDLFTSLNRHIERSEFEQAVKVADQVLSTNPSDEDAMRCKVVALIKADNIDDALSTIQSSQKFTFDFNYLKAYCLYRQNRLDEALESLKIQENNPATMLLKSQILYRSGEMDACVEFYQKLQKSKIDSLEINFVAGLISAGRASEVQKTLDSLRVKATSSFELAYNTACSLAEMNKYTEAEQLLLTARRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVDKAESYEKRLKPLPGLNGVDVDSLEKTSG**********************************YPKGFDPANPGPPPDPERWLPKRERSSY*******************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPKAKPKPSPSPSQPPPPIEDLFTSLNRHIERSEFEQAVKVADQVLSTNPSDEDAMRCKVVALIKADNIDDALSTIQSSQKFTFDFNYLKAYCLYRQNRLDEALESLKIQENNPATMLLKSQILYRSGEMDACVEFYQKLQKSKIDSLEINFVAGLISAGRASEVQKTLDSLRVKATSSFELAYNTACSLAEMNKYTEAEQLLLTARRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTHGSIEALVGLVTTSAHVDVDKAESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESASYFEVNEAHGEGKNKDKAKKKRKRKPRYPKGFDPANPGPPPDPERWLPKRERSSYRPRRKDKRAAQVRGSQGAVVREKHDAGAAGASSNSTSSQATSSKGAAQNVAQSSKGSSKSSRKKSRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query666 2.2.26 [Sep-21-2011]
O76094671 Signal recognition partic yes no 0.890 0.883 0.330 3e-74
P33731671 Signal recognition partic yes no 0.890 0.883 0.330 5e-74
Q54EP7672 Signal recognition partic yes no 0.849 0.842 0.280 2e-56
P49965707 Signal recognition partic N/A no 0.873 0.823 0.278 6e-43
P91240635 Signal recognition partic yes no 0.828 0.869 0.284 2e-34
O59787561 Signal recognition partic yes no 0.744 0.884 0.227 3e-12
P38688640 Signal recognition partic yes no -0.03 -0.03 0.620 6e-05
>sp|O76094|SRP72_HUMAN Signal recognition particle 72 kDa protein OS=Homo sapiens GN=SRP72 PE=1 SV=3 Back     alignment and function desciption
 Score =  280 bits (715), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 210/635 (33%), Positives = 348/635 (54%), Gaps = 42/635 (6%)

Query: 23  LFTSLNRHIERSEFEQAVKVADQVLSTNPSDEDAMRCKVVALIKADNIDDALSTIQSSQK 82
           L++ +NR+ +  +F +A+K  +++L  N  D  A+ CKVV LI+  +  +AL+ I +  K
Sbjct: 14  LWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNVINTHTK 73

Query: 83  FTFD--FNYLKAYCLYRQNRLDEALESLKIQENNPATMLLK---SQILYRSGEMDACVEF 137
              +   ++ KAYC YR NR++ AL++  I+  N  T  LK    Q+LYR    D C+  
Sbjct: 74  VLANNSLSFEKAYCEYRLNRIENALKT--IESANQQTDKLKELYGQVLYRLERYDECLAV 131

Query: 138 YQKLQKSKIDSLEINFVAGL--ISAGRASEVQKTLDSLRVKATSSFELAYNTACSLAEMN 195
           Y+ L ++  D  +      L  + A +++  +   ++L ++   + EL YNTAC+L    
Sbjct: 132 YRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPENLGLQ-EGTHELCYNTACALIGQG 190

Query: 196 KYTEAEQLLLTARRIGQETLTDD-NFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYT 254
           +  +A ++L  A  + + +L++D +  E+D + ELA I  Q+AY+ QL G T+EA   Y 
Sbjct: 191 QLNQAMKILQKAEDLCRRSLSEDTDGTEEDPQAELAIIHGQMAYILQLQGRTEEALQLYN 250

Query: 255 DIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPK 314
            IIK    D    AV  NN++ +   ++V DS KK+             A  ++ +LS K
Sbjct: 251 QIIKLKPTDVGLLAVIANNIITINKDQNVFDSKKKVKLTN---------AEGVEFKLSKK 301

Query: 315 QREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELL 374
           Q +AI  N+ LL ++ N+ +Q R++ A+L    P+ ++P+L+QAA L RE +  KA ELL
Sbjct: 302 QLQAIEFNKALLAMYTNQAEQCRKISASLQSQSPEHLLPVLIQAAQLCREKQHTKAIELL 361

Query: 375 GQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQHMPATVATLVALKERAGD 434
            +F+++ P+ +  I L  AQ+  +  +   A   L  I +++H P  V+ LV +     D
Sbjct: 362 QEFSDQHPENAAEIKLTMAQLKISQGNISKACLILRSIEELKHKPGMVSALVTMYSHEED 421

Query: 435 IDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELVKTH-GSI 493
           ID A  V   AI+W+ N   +      +++EAA+FKL++GR+++A    ++L K +   I
Sbjct: 422 IDSAIEVFTQAIQWYQNHQPKSPAHLSLIREAANFKLKYGRKKEAISDLQQLWKQNPKDI 481

Query: 494 EALVGLVTTSAHVDVDKAESYEKRLKPLPGLN-GVDVDSLEKTSGAKHVESASYFEVNEA 552
             L  L++  + VD +KA++  K L     ++  VDV++LE ++GA ++         ++
Sbjct: 482 HTLAQLISAYSLVDPEKAKALSKHLPSSDSMSLKVDVEALENSAGATYIRKKGGKVTGDS 541

Query: 553 ----HGEGKNKDKAKKKRKRKPRYPKGFDPANPGPPPDPERWLPKRERSSYRPRRKDKRA 608
                G+G   D  KKK+K+K + PK +DP      PDPERWLP RERS YR R+K K+ 
Sbjct: 542 QPKEQGQG---DLKKKKKKKKGKLPKNYDPK---VTPDPERWLPMRERSYYRGRKKGKKK 595

Query: 609 AQV-RGSQGAVVREKHDAGAAGASSNSTSSQATSS 642
            Q+ +G+QGA          AGASS   +S+  SS
Sbjct: 596 DQIGKGTQGAT---------AGASSELDASKTVSS 621




Signal-recognition-particle assembly has a crucial role in targeting secretory proteins to the rough endoplasmic reticulum membrane. Binds the 7S RNA only in presence of SRP68. This ribonucleoprotein complex might interact directly with the docking protein in the ER membrane and possibly participate in the elongation arrest function.
Homo sapiens (taxid: 9606)
>sp|P33731|SRP72_CANFA Signal recognition particle 72 kDa protein OS=Canis familiaris GN=SRP72 PE=1 SV=3 Back     alignment and function description
>sp|Q54EP7|SRP72_DICDI Signal recognition particle 72 kDa protein homolog OS=Dictyostelium discoideum GN=srp72 PE=3 SV=1 Back     alignment and function description
>sp|P49965|SRP72_SCHMA Signal recognition particle 72 kDa protein OS=Schistosoma mansoni GN=SRP72 PE=3 SV=1 Back     alignment and function description
>sp|P91240|SRP72_CAEEL Signal recognition particle 72 kDa protein homolog OS=Caenorhabditis elegans GN=F08D12.1 PE=3 SV=2 Back     alignment and function description
>sp|O59787|SRP72_SCHPO Signal recognition particle subunit srp72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp72 PE=3 SV=1 Back     alignment and function description
>sp|P38688|SRP72_YEAST Signal recognition particle subunit SRP72 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP72 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query666
225425902673 PREDICTED: signal recognition particle 7 0.972 0.962 0.766 0.0
255547830664 Signal recognition particle subunit srp7 0.963 0.966 0.785 0.0
297738340696 unnamed protein product [Vitis vinifera] 0.965 0.923 0.767 0.0
356525126662 PREDICTED: signal recognition particle 7 0.941 0.947 0.742 0.0
449435027667 PREDICTED: signal recognition particle 7 0.974 0.973 0.738 0.0
147802240 1085 hypothetical protein VITISV_028102 [Viti 0.914 0.561 0.719 0.0
356512347662 PREDICTED: signal recognition particle 7 0.941 0.947 0.736 0.0
15220511664 signal recognition particle subunit SRP7 0.954 0.957 0.695 0.0
297841469652 hypothetical protein ARALYDRAFT_475871 [ 0.944 0.964 0.706 0.0
15220505651 signal recognition particle subunit SRP7 0.939 0.961 0.623 0.0
>gi|225425902|ref|XP_002271378.1| PREDICTED: signal recognition particle 72 kDa protein [Vitis vinifera] Back     alignment and taxonomy information
 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/654 (76%), Positives = 578/654 (88%), Gaps = 6/654 (0%)

Query: 1   MAPKAKPKPSPSPSQPPPP-IEDLFTSLNRHIERSEFEQAVKVADQVLSTNPSDEDAMRC 59
           MAPK KPKP+ S S  PPP IEDLFTSLN HI+RS+F+QAVKVADQ+L   PSDEDA+RC
Sbjct: 1   MAPKPKPKPTASSSSQPPPPIEDLFTSLNLHIQRSQFDQAVKVADQILLVAPSDEDAIRC 60

Query: 60  KVVALIKADNIDDALSTIQSSQKFTFDFNYLKAYCLYRQNRLDEALESLKIQENNPATML 119
           KVVALIK D I+DALSTIQ+SQ+   D ++ KAYCLYRQN+LDE+LESLK QE +   ML
Sbjct: 61  KVVALIKEDRINDALSTIQASQRLPIDLSFFKAYCLYRQNKLDESLESLKSQEGSSTAML 120

Query: 120 LKSQILYRSGEMDACVEFYQKLQKSKIDSLEINFVAGLISAGRASEVQKTLDSLRVKATS 179
           L+SQILYR G+MDAC++ YQKLQKSKI+SLEIN VAGL+SAGR S+VQ TLD+LRVKATS
Sbjct: 121 LESQILYRLGKMDACIDIYQKLQKSKIESLEINLVAGLVSAGRGSDVQGTLDALRVKATS 180

Query: 180 SFELAYNTACSLAEMNKYTEAEQLLLTARRIGQETLTDDNFAEDDIEIELAPIAVQLAYV 239
           SFELAYNTACSL E +KY +AEQLLL+ARR+GQETL +DN A+D+IEIELAP+AVQLAYV
Sbjct: 181 SFELAYNTACSLIERSKYKDAEQLLLSARRVGQETLMEDNLADDEIEIELAPLAVQLAYV 240

Query: 240 QQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKD-- 297
           QQLLGNT EA  AYT II RNLADESS AVAVNNLVALKGPKD++DSL+KLDR+ EK   
Sbjct: 241 QQLLGNTPEAMEAYTGIINRNLADESSLAVAVNNLVALKGPKDISDSLRKLDRLMEKGNG 300

Query: 298 MQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQ 357
            Q+FQL+  L+ +LSPKQRE IY NRVLLLLHAN+MDQARELVAALPDMF DSVMP+LLQ
Sbjct: 301 AQSFQLSNGLESKLSPKQRETIYTNRVLLLLHANRMDQARELVAALPDMFADSVMPVLLQ 360

Query: 358 AAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPDIQH 417
           AAVLVRENK+GKAEE+LGQFAEK PDK+K++LLARAQ+AA A HP IAAESL+KI DIQH
Sbjct: 361 AAVLVRENKSGKAEEILGQFAEKFPDKAKVVLLARAQIAAVAGHPQIAAESLSKIADIQH 420

Query: 418 MPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREE 477
           +PATVAT+V+LKERAGDIDGA AV DSAI+WW NAMTEDNKL+VIMQEAASFKL+HGRE+
Sbjct: 421 LPATVATIVSLKERAGDIDGAEAVFDSAIQWWSNAMTEDNKLTVIMQEAASFKLKHGREK 480

Query: 478 DASHLFEELVKTHGSIEALVGLVTTSAHVDVDKAESYEKRLKPLPGLNGVDVDSLEKTSG 537
           +A+ L+EELVK+HGS++AL+GLVTT+A VDVDKAE+YEK+LKPLPGL GVDV+SLE+TSG
Sbjct: 481 EAARLYEELVKSHGSVQALIGLVTTAARVDVDKAEAYEKQLKPLPGLKGVDVESLERTSG 540

Query: 538 AKHVESASYFEVNEAHGEGKNKDKAKKKRKRKPRYPKGFDPANPGPPPDPERWLPKRERS 597
           AKH++S S   + EA+ E KNK+KAKKKRKRKPRYPKGFDPANPGPPPDPERWLPKRERS
Sbjct: 541 AKHIQSDSRVGITEAYEESKNKEKAKKKRKRKPRYPKGFDPANPGPPPDPERWLPKRERS 600

Query: 598 SYRPRRKDKRAAQVRGSQGAVVREKHDAGAAGAS---SNSTSSQATSSKGAAQN 648
           SYRP+RKDKRAAQVRGSQGAVVREKH+A  +  S   SNS S QAT+SKG++QN
Sbjct: 601 SYRPKRKDKRAAQVRGSQGAVVREKHEAAGSDTSANTSNSKSDQATTSKGSSQN 654




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255547830|ref|XP_002514972.1| Signal recognition particle subunit srp72, putative [Ricinus communis] gi|223546023|gb|EEF47526.1| Signal recognition particle subunit srp72, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297738340|emb|CBI27541.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356525126|ref|XP_003531178.1| PREDICTED: signal recognition particle 72 kDa protein-like [Glycine max] Back     alignment and taxonomy information
>gi|449435027|ref|XP_004135297.1| PREDICTED: signal recognition particle 72 kDa protein-like [Cucumis sativus] gi|449530207|ref|XP_004172087.1| PREDICTED: signal recognition particle 72 kDa protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147802240|emb|CAN63819.1| hypothetical protein VITISV_028102 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356512347|ref|XP_003524881.1| PREDICTED: signal recognition particle 72 kDa protein-like [Glycine max] Back     alignment and taxonomy information
>gi|15220511|ref|NP_176936.1| signal recognition particle subunit SRP72 [Arabidopsis thaliana] gi|11072013|gb|AAG28892.1|AC008113_8 F12A21.17 [Arabidopsis thaliana] gi|28392947|gb|AAO41909.1| unknown protein [Arabidopsis thaliana] gi|28827690|gb|AAO50689.1| unknown protein [Arabidopsis thaliana] gi|332196560|gb|AEE34681.1| signal recognition particle subunit SRP72 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297841469|ref|XP_002888616.1| hypothetical protein ARALYDRAFT_475871 [Arabidopsis lyrata subsp. lyrata] gi|297334457|gb|EFH64875.1| hypothetical protein ARALYDRAFT_475871 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15220505|ref|NP_176933.1| signal recognition particle subunit SRP72 [Arabidopsis thaliana] gi|11072014|gb|AAG28893.1|AC008113_9 F12A21.20 [Arabidopsis thaliana] gi|332196555|gb|AEE34676.1| signal recognition particle subunit SRP72 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query666
TAIR|locus:2008610664 AT1G67680 [Arabidopsis thalian 0.789 0.792 0.691 1.6e-204
TAIR|locus:2008540651 AT1G67650 [Arabidopsis thalian 0.779 0.797 0.645 2.8e-189
UNIPROTKB|Q5ZKZ5671 SRP72 "Uncharacterized protein 0.761 0.755 0.342 3.7e-74
UNIPROTKB|E1BVX9671 SRP72 "Uncharacterized protein 0.761 0.755 0.340 7.6e-74
UNIPROTKB|P33731671 SRP72 "Signal recognition part 0.761 0.755 0.321 1.4e-72
UNIPROTKB|O76094671 SRP72 "Signal recognition part 0.761 0.755 0.321 1.4e-72
UNIPROTKB|E1BB38671 SRP72 "Uncharacterized protein 0.759 0.754 0.326 2.9e-72
ZFIN|ZDB-GENE-030131-5546670 srp72 "signal recognition part 0.779 0.774 0.298 9.8e-66
UNIPROTKB|D4A7R0671 Srp72 "Protein Srp72" [Rattus 0.761 0.755 0.298 2e-63
DICTYBASE|DDB_G0291412672 srp72 "signal recognition part 0.767 0.760 0.279 3.3e-59
TAIR|locus:2008610 AT1G67680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1839 (652.4 bits), Expect = 1.6e-204, Sum P(2) = 1.6e-204
 Identities = 372/538 (69%), Positives = 441/538 (81%)

Query:    20 IEDLFTSLNRHIERSEFEQAVKVADQVLSTNPSDEDAMRCKVVALIKADNIDD------- 72
             IEDLFTSL++HI+ +++E+AVKVADQVLS  P+DEDA+RCKVVALIK D  DD       
Sbjct:    20 IEDLFTSLHQHIKDTKYEEAVKVADQVLSIVPTDEDAIRCKVVALIKDDKFDDYLIKDVK 79

Query:    73 ---ALSTIQSSQKFTFDFNYLKAYCLYRQNRLDEALESLKIQENNPATMLLKSQILYRSG 129
                ALS I S QK   D  + KAYCLYR N+LDEAL  LK  E +  T++L++QILYR G
Sbjct:    80 INGALSVINSFQKLPIDLGFHKAYCLYRVNKLDEALVCLKGLERDTDTLVLEAQILYRLG 139

Query:   130 EMDACVEFYQKLQKSKIDSLEINFVAGLISAGRASEVQKTLDSLRVKATSSFELAYNTAC 189
             + DACV+ YQKL KS+I++LE+N VAGLISAG+AS+VQKTL+SL++K TSSFELAYNTAC
Sbjct:   140 KADACVDVYQKLTKSQIETLEVNLVAGLISAGKASQVQKTLESLKIKPTSSFELAYNTAC 199

Query:   190 SLAEMNKYTEAEQLLLTARRIGQETLTDDNFA--EDDIEIELAPIAVQLAYVQQLLGNTQ 247
             SL E N Y +AEQLLLTARRIGQETL DD+ A  +++IEIELAPIAVQLAYVQQ+LG TQ
Sbjct:   200 SLIENNNYADAEQLLLTARRIGQETLNDDDIALTDEEIEIELAPIAVQLAYVQQILGQTQ 259

Query:   248 EAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVL 307
             E+  +Y D IKRNLADE S AVAVNNLVALKG KD++D L+K D +K+KD Q FQL++ L
Sbjct:   260 ESTSSYVDFIKRNLADEPSLAVAVNNLVALKGFKDISDGLRKFDLLKDKDSQTFQLSQAL 319

Query:   308 DLRLSPKQREAIYANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKA 367
             D +LS K +EAIYANRVLLLLHANKMDQAREL AALP MFP+S++P LLQAAVLVRENKA
Sbjct:   320 DAKLSQKHKEAIYANRVLLLLHANKMDQARELCAALPGMFPESIIPTLLQAAVLVRENKA 379

Query:   368 GKAEELLGQFAEKLPDKSKIILLXXXXXXXXXNHPFIAAESLAKIPDIQHMPATVATLVA 427
              KAEELLGQ AEK P+KSK++LL         +HP +AAESL+KIPDIQH+PATVAT+VA
Sbjct:   380 AKAEELLGQCAEKFPEKSKLVLLARAQIAASASHPHVAAESLSKIPDIQHLPATVATIVA 439

Query:   428 LKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHLFEELV 487
             LKERAGD DGAAAVLDSAIKWW N+MTE +KL V+M EAA+FKLRHG+EE+AS L+EE+V
Sbjct:   440 LKERAGDNDGAAAVLDSAIKWWSNSMTESSKLRVLMPEAAAFKLRHGQEEEASRLYEEIV 499

Query:   488 KTHGSIEALVGLVTTSAHVDVDKAESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESAS 545
             K H S +ALVGLVTT A V+V+KAESYEK+LKPLPGL  VDVD LEKT GAK +E A+
Sbjct:   500 KNHNSTDALVGLVTTLARVNVEKAESYEKQLKPLPGLKAVDVDKLEKTYGAKPIEGAA 557


GO:0005737 "cytoplasm" evidence=ISM
GO:0006614 "SRP-dependent cotranslational protein targeting to membrane" evidence=IEA
GO:0008312 "7S RNA binding" evidence=IEA
GO:0048500 "signal recognition particle" evidence=IEA
GO:0005829 "cytosol" evidence=RCA
TAIR|locus:2008540 AT1G67650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZKZ5 SRP72 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVX9 SRP72 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P33731 SRP72 "Signal recognition particle 72 kDa protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O76094 SRP72 "Signal recognition particle 72 kDa protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BB38 SRP72 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5546 srp72 "signal recognition particle 72" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|D4A7R0 Srp72 "Protein Srp72" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291412 srp72 "signal recognition particle 72 kDa subunit" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O76094SRP72_HUMANNo assigned EC number0.33070.89030.8837yesno
P33731SRP72_CANFANo assigned EC number0.33070.89030.8837yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query666
pfam0849257 pfam08492, SRP72, SRP72 RNA-binding domain 7e-15
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.002
pfam1289580 pfam12895, Apc3, Anaphase-promoting complex, cyclo 0.002
>gnl|CDD|149515 pfam08492, SRP72, SRP72 RNA-binding domain Back     alignment and domain information
 Score = 69.0 bits (169), Expect = 7e-15
 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 3/43 (6%)

Query: 559 KDKAKKKRKRKPRYPKGFDPANPGPPPDPERWLPKRERSSYRP 601
           K K   K+KRKP+ PK F   NP   PDPERWLP R+RS YRP
Sbjct: 18  KKKKSAKKKRKPKLPKNF---NPVVTPDPERWLPMRDRSYYRP 57


This region has been identified as the binding site of the SRP72 protein to SRP RNA. Length = 57

>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|221837 pfam12895, Apc3, Anaphase-promoting complex, cyclosome, subunit 3 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 666
KOG2376652 consensus Signal recognition particle, subunit Srp 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.98
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.97
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.97
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.97
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 99.97
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.96
KOG2376652 consensus Signal recognition particle, subunit Srp 99.95
KOG0547606 consensus Translocase of outer mitochondrial membr 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
PRK14574 822 hmsH outer membrane protein; Provisional 99.95
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.95
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.94
PLN032181060 maturation of RBCL 1; Provisional 99.93
PLN03077857 Protein ECB2; Provisional 99.93
PLN03077857 Protein ECB2; Provisional 99.92
PLN032181060 maturation of RBCL 1; Provisional 99.92
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
KOG2076 895 consensus RNA polymerase III transcription factor 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.92
KOG1126638 consensus DNA-binding cell division cycle control 99.92
KOG2003840 consensus TPR repeat-containing protein [General f 99.91
PRK14574 822 hmsH outer membrane protein; Provisional 99.91
KOG0547606 consensus Translocase of outer mitochondrial membr 99.91
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.91
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.91
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.9
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.89
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.89
KOG1126638 consensus DNA-binding cell division cycle control 99.89
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.89
KOG2003840 consensus TPR repeat-containing protein [General f 99.87
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.87
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.86
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.86
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.86
KOG2076 895 consensus RNA polymerase III transcription factor 99.85
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.84
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.84
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.84
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.83
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.82
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.82
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.82
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.82
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.81
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.81
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.81
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.8
KOG1915677 consensus Cell cycle control protein (crooked neck 99.79
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.77
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.76
PRK12370553 invasion protein regulator; Provisional 99.76
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.76
PRK12370553 invasion protein regulator; Provisional 99.76
KOG1129478 consensus TPR repeat-containing protein [General f 99.76
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.75
PF0849259 SRP72: SRP72 RNA-binding domain; InterPro: IPR0136 99.75
KOG1129478 consensus TPR repeat-containing protein [General f 99.75
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.72
PRK11189296 lipoprotein NlpI; Provisional 99.72
PRK11189296 lipoprotein NlpI; Provisional 99.71
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.71
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.7
KOG1125579 consensus TPR repeat-containing protein [General f 99.7
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.7
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.7
KOG11271238 consensus TPR repeat-containing protein [RNA proce 99.69
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.69
KOG1915677 consensus Cell cycle control protein (crooked neck 99.69
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.68
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.67
KOG1125579 consensus TPR repeat-containing protein [General f 99.67
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.65
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.63
PRK04841903 transcriptional regulator MalT; Provisional 99.6
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.6
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.58
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.57
PLN02789320 farnesyltranstransferase 99.57
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.56
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.55
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.55
PLN02789320 farnesyltranstransferase 99.54
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.49
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.45
PRK04841903 transcriptional regulator MalT; Provisional 99.45
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.45
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.45
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.41
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.4
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.37
PRK15359144 type III secretion system chaperone protein SscB; 99.37
PRK10370198 formate-dependent nitrite reductase complex subuni 99.35
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.34
PRK10370198 formate-dependent nitrite reductase complex subuni 99.33
PRK15359144 type III secretion system chaperone protein SscB; 99.33
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.32
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.31
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.29
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.27
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 99.27
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.27
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.25
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.25
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.2
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.2
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.2
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.17
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.14
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.14
KOG1128777 consensus Uncharacterized conserved protein, conta 99.13
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.1
KOG1128777 consensus Uncharacterized conserved protein, conta 99.08
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.08
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.07
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.07
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.06
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.05
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 99.05
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.04
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.04
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 99.02
KOG0553304 consensus TPR repeat-containing protein [General f 99.0
KOG0553304 consensus TPR repeat-containing protein [General f 98.99
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.97
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.95
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.92
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.92
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.9
KOG2471696 consensus TPR repeat-containing protein [General f 98.88
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.83
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.82
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.8
KOG1941518 consensus Acetylcholine receptor-associated protei 98.79
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.78
PRK10803263 tol-pal system protein YbgF; Provisional 98.78
COG3898531 Uncharacterized membrane-bound protein [Function u 98.78
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.77
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.76
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.75
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.74
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.74
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.72
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.71
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.71
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.7
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.7
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.68
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.67
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.67
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.67
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.67
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.67
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.65
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.65
KOG2471696 consensus TPR repeat-containing protein [General f 98.65
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.64
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.63
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.62
PRK15331165 chaperone protein SicA; Provisional 98.62
PF12688120 TPR_5: Tetratrico peptide repeat 98.61
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.61
PRK10803263 tol-pal system protein YbgF; Provisional 98.59
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.59
PRK15331165 chaperone protein SicA; Provisional 98.58
KOG1941518 consensus Acetylcholine receptor-associated protei 98.56
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.56
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.55
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 98.55
COG3898531 Uncharacterized membrane-bound protein [Function u 98.54
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.53
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.52
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.5
KOG2300629 consensus Uncharacterized conserved protein [Funct 98.49
KOG4648536 consensus Uncharacterized conserved protein, conta 98.47
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.46
COG4700251 Uncharacterized protein conserved in bacteria cont 98.43
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.42
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.41
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.4
COG4700251 Uncharacterized protein conserved in bacteria cont 98.39
PRK11906458 transcriptional regulator; Provisional 98.38
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.38
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.36
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.35
PRK11906458 transcriptional regulator; Provisional 98.35
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.35
PF12688120 TPR_5: Tetratrico peptide repeat 98.34
KOG4555175 consensus TPR repeat-containing protein [Function 98.32
PF13512142 TPR_18: Tetratricopeptide repeat 98.32
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.32
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.32
COG3118304 Thioredoxin domain-containing protein [Posttransla 98.3
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.28
PF13512142 TPR_18: Tetratricopeptide repeat 98.24
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.24
KOG1586288 consensus Protein required for fusion of vesicles 98.23
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 98.21
KOG4234271 consensus TPR repeat-containing protein [General f 98.2
KOG1586288 consensus Protein required for fusion of vesicles 98.19
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 98.16
PF1337173 TPR_9: Tetratricopeptide repeat 98.16
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.15
KOG2610491 consensus Uncharacterized conserved protein [Funct 98.14
PF1337173 TPR_9: Tetratricopeptide repeat 98.14
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.13
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.12
KOG1585308 consensus Protein required for fusion of vesicles 98.1
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.09
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.08
KOG4234271 consensus TPR repeat-containing protein [General f 98.07
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.05
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.98
KOG4648536 consensus Uncharacterized conserved protein, conta 97.96
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.92
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.91
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.9
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.88
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.84
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.83
PF1343134 TPR_17: Tetratricopeptide repeat 97.79
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.79
KOG4555175 consensus TPR repeat-containing protein [Function 97.76
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.76
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.71
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.7
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 97.66
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.62
KOG20411189 consensus WD40 repeat protein [General function pr 97.61
PRK15180831 Vi polysaccharide biosynthesis protein TviD; Provi 97.61
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 97.6
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.59
PF1343134 TPR_17: Tetratricopeptide repeat 97.59
KOG1585308 consensus Protein required for fusion of vesicles 97.59
KOG1258577 consensus mRNA processing protein [RNA processing 97.58
PF1342844 TPR_14: Tetratricopeptide repeat 97.58
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.55
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.52
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.52
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.52
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.51
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.5
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.49
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.41
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.29
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 97.28
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.27
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.27
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.25
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.25
PF1342844 TPR_14: Tetratricopeptide repeat 97.25
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.24
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.18
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.17
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.16
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.14
KOG1550552 consensus Extracellular protein SEL-1 and related 97.11
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.11
KOG20411189 consensus WD40 repeat protein [General function pr 97.06
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 97.03
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 97.01
KOG4507886 consensus Uncharacterized conserved protein, conta 96.92
KOG1258577 consensus mRNA processing protein [RNA processing 96.91
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 96.9
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.84
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.76
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.74
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.72
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.71
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.65
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.64
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.6
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.58
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.53
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.5
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.49
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 96.46
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.43
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.4
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.39
PRK11619644 lytic murein transglycosylase; Provisional 96.34
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.32
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.29
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.28
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.26
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 96.26
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.23
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.19
KOG1550552 consensus Extracellular protein SEL-1 and related 96.18
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.16
COG4649221 Uncharacterized protein conserved in bacteria [Fun 96.12
KOG1463411 consensus 26S proteasome regulatory complex, subun 95.97
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.87
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.83
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.79
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 95.72
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 95.62
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.62
KOG15381081 consensus Uncharacterized conserved protein WDR10, 95.48
KOG0530318 consensus Protein farnesyltransferase, alpha subun 95.47
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.34
KOG3783546 consensus Uncharacterized conserved protein [Funct 95.21
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 95.13
PRK10941269 hypothetical protein; Provisional 94.97
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.65
KOG2581493 consensus 26S proteasome regulatory complex, subun 94.57
PF0849259 SRP72: SRP72 RNA-binding domain; InterPro: IPR0136 94.56
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.54
COG5159421 RPN6 26S proteasome regulatory complex component [ 94.5
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 94.46
PRK10941269 hypothetical protein; Provisional 94.38
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 94.36
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 94.26
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.24
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 94.21
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.17
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.12
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.06
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.03
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 93.97
PRK11619644 lytic murein transglycosylase; Provisional 93.73
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 93.72
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 93.53
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 93.5
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 93.43
COG5159421 RPN6 26S proteasome regulatory complex component [ 93.42
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.4
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.31
KOG4422625 consensus Uncharacterized conserved protein [Funct 92.82
PF1304150 PPR_2: PPR repeat family 92.38
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 92.35
PRK12798421 chemotaxis protein; Reviewed 92.28
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 92.19
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 92.06
KOG3364149 consensus Membrane protein involved in organellar 91.7
KOG0530318 consensus Protein farnesyltransferase, alpha subun 91.64
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.46
KOG4814872 consensus Uncharacterized conserved protein [Funct 91.38
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 91.34
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 91.17
COG4976287 Predicted methyltransferase (contains TPR repeat) 90.98
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 90.89
PF1285434 PPR_1: PPR repeat 90.82
KOG3783546 consensus Uncharacterized conserved protein [Funct 90.78
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 90.48
COG3629280 DnrI DNA-binding transcriptional activator of the 90.44
TIGR03362301 VI_chp_7 type VI secretion-associated protein, VC_ 90.31
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 90.09
KOG2422665 consensus Uncharacterized conserved protein [Funct 90.0
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 90.0
KOG3364149 consensus Membrane protein involved in organellar 89.5
COG4976287 Predicted methyltransferase (contains TPR repeat) 89.43
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 89.29
KOG1310758 consensus WD40 repeat protein [General function pr 88.97
KOG1463411 consensus 26S proteasome regulatory complex, subun 88.93
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 88.93
PF1285434 PPR_1: PPR repeat 88.91
KOG2422665 consensus Uncharacterized conserved protein [Funct 88.85
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 88.83
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 88.57
COG5191435 Uncharacterized conserved protein, contains HAT (H 88.38
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 87.98
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 87.86
PF07163309 Pex26: Pex26 protein; InterPro: IPR010797 This fam 87.84
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 87.45
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 87.37
COG3629280 DnrI DNA-binding transcriptional activator of the 87.18
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 87.08
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 87.06
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 86.48
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 86.4
COG1747 711 Uncharacterized N-terminal domain of the transcrip 86.38
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 85.78
COG2912269 Uncharacterized conserved protein [Function unknow 85.78
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 85.77
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 85.77
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 85.74
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 85.4
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 85.38
PRK12798421 chemotaxis protein; Reviewed 85.25
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 84.4
KOG1310758 consensus WD40 repeat protein [General function pr 84.28
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.93
PF09477116 Type_III_YscG: Bacterial type II secretion system 83.56
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 83.31
PF1304150 PPR_2: PPR repeat family 83.25
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 83.02
COG4941415 Predicted RNA polymerase sigma factor containing a 82.87
COG2912269 Uncharacterized conserved protein [Function unknow 82.77
KOG02921202 consensus Vesicle coat complex COPI, alpha subunit 82.76
COG4941415 Predicted RNA polymerase sigma factor containing a 82.73
KOG4814872 consensus Uncharacterized conserved protein [Funct 82.59
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 82.55
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 82.48
KOG0889 3550 consensus Histone acetyltransferase SAGA, TRRAP/TR 82.28
KOG2581493 consensus 26S proteasome regulatory complex, subun 82.15
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 82.07
COG4455273 ImpE Protein of avirulence locus involved in tempe 81.97
COG4455273 ImpE Protein of avirulence locus involved in tempe 81.45
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 81.33
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 80.86
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 80.71
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 80.67
KOG0529421 consensus Protein geranylgeranyltransferase type I 80.04
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
Probab=100.00  E-value=2.4e-85  Score=632.05  Aligned_cols=594  Identities=50%  Similarity=0.715  Sum_probs=514.0

Q ss_pred             CcHHHHHHHHHHHhhhccHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhcc--chhhhHHHHHHH
Q 005990           18 PPIEDLFTSLNRHIERSEFEQAVKVADQVLSTNPSDEDAMRCKVVALIKADNIDDALSTIQSSQKF--TFDFNYLKAYCL   95 (666)
Q Consensus        18 ~~~~~l~~~~~~~~~~~~~~~A~~~~~~~l~~~p~~~~a~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~a~~~   95 (666)
                      .++++++..++.+..+|+|++|++.++++|...|++.++++++.+|+++.++|++|+.+++.-...  .....|++|||+
T Consensus        10 ~~~~~l~t~ln~~~~~~e~e~a~k~~~Kil~~~pdd~~a~~cKvValIq~~ky~~ALk~ikk~~~~~~~~~~~fEKAYc~   89 (652)
T KOG2376|consen   10 DNLEALLTDLNRHGKNGEYEEAVKTANKILSIVPDDEDAIRCKVVALIQLDKYEDALKLIKKNGALLVINSFFFEKAYCE   89 (652)
T ss_pred             ccHHHHHHHHHHhccchHHHHHHHHHHHHHhcCCCcHhhHhhhHhhhhhhhHHHHHHHHHHhcchhhhcchhhHHHHHHH
Confidence            356899999999999999999999999999999999999999999999999999999888876432  233447999999


Q ss_pred             HHhCCHHHHHHHHHhcC-CChhHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCChhH----HHHHHHHHHcCChhHHHHHH
Q 005990           96 YRQNRLDEALESLKIQE-NNPATMLLKSQILYRSGEMDACVEFYQKLQKSKIDSLE----INFVAGLISAGRASEVQKTL  170 (666)
Q Consensus        96 ~~~g~~~~A~~~l~~~~-~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~p~~~~----~~l~~~~~~~g~~~~A~~~~  170 (666)
                      |++|+.++|+..++... .+..++++.||++|++|+|++|+.+|+.+++.+.++.+    .|+.++-.    ...+. .+
T Consensus        90 Yrlnk~Dealk~~~~~~~~~~~ll~L~AQvlYrl~~ydealdiY~~L~kn~~dd~d~~~r~nl~a~~a----~l~~~-~~  164 (652)
T KOG2376|consen   90 YRLNKLDEALKTLKGLDRLDDKLLELRAQVLYRLERYDEALDIYQHLAKNNSDDQDEERRANLLAVAA----ALQVQ-LL  164 (652)
T ss_pred             HHcccHHHHHHHHhcccccchHHHHHHHHHHHHHhhHHHHHHHHHHHHhcCCchHHHHHHHHHHHHHH----hhhHH-HH
Confidence            99999999999999743 46679999999999999999999999999998877776    34333322    11222 33


Q ss_pred             HHhhhcCCChHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhhhhhccCCCCChhhHhhhhhhHHHHHHHHHHHcCChHHHH
Q 005990          171 DSLRVKATSSFELAYNTACSLAEMNKYTEAEQLLLTARRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAF  250 (666)
Q Consensus       171 ~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~eA~  250 (666)
                      +..-....++++.+||.||+++..|+|.+|++.+++++.+|.+.+..++..+++++.++..+.++|+++++.+|+.++|.
T Consensus       165 q~v~~v~e~syel~yN~Ac~~i~~gky~qA~elL~kA~~~~~e~l~~~d~~eEeie~el~~IrvQlayVlQ~~Gqt~ea~  244 (652)
T KOG2376|consen  165 QSVPEVPEDSYELLYNTACILIENGKYNQAIELLEKALRICREKLEDEDTNEEEIEEELNPIRVQLAYVLQLQGQTAEAS  244 (652)
T ss_pred             HhccCCCcchHHHHHHHHHHHHhcccHHHHHHHHHHHHHHHHHhhcccccchhhHHHHHHHHHHHHHHHHHHhcchHHHH
Confidence            44334445699999999999999999999999999999999999998888889999999999999999999999999999


Q ss_pred             HHHHHHHhhCCCCHhHHHHHHhhhhhccCCCChhHHHHHhHHHhhhhhhhhhhhHHhhcCCCHHHHHHHHHHHHHHHHHc
Q 005990          251 GAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHA  330 (666)
Q Consensus       251 ~~~~~~l~~~~~~~~~~~~~~~~l~~~~~~~~~~~a~~~l~~~~~~~~~~~~~~~~l~~~~~~~q~~~~~~~~a~~~~~~  330 (666)
                      .+|..++..++.|....+++.||++++.++.++++..    -+.........+++.+...++..|+..++.|.+.+.+..
T Consensus       245 ~iy~~~i~~~~~D~~~~Av~~NNLva~~~d~~~~d~~----~l~~k~~~~~~l~~~~l~~Ls~~qk~~i~~N~~lL~l~t  320 (652)
T KOG2376|consen  245 SIYVDIIKRNPADEPSLAVAVNNLVALSKDQNYFDGD----LLKSKKSQVFKLAEFLLSKLSKKQKQAIYRNNALLALFT  320 (652)
T ss_pred             HHHHHHHHhcCCCchHHHHHhcchhhhccccccCchH----HHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            9999999999999999999999999999998887741    111122335666777788999999999999999999999


Q ss_pred             CChHHHHHHHHhccccCCCCchHHHHHHHHHHhhCChhHHHHHHHHHHhhCCChhHHHHHHHHHHHHHcCChhHHHHHHh
Q 005990          331 NKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLA  410 (666)
Q Consensus       331 ~~~~~A~~~~~~~~~~~p~~~~~~~~~a~~~~~~g~~~~A~~~l~~~~~~~p~~~~~~~~~la~~~~~~g~~~~A~~~l~  410 (666)
                      +..+++.++.......+|......+.......+...+.+|+.++....+.+|.+...+.+.++++.+.+|++..|++++.
T Consensus       321 nk~~q~r~~~a~lp~~~p~~~~~~ll~~~t~~~~~~~~ka~e~L~~~~~~~p~~s~~v~L~~aQl~is~gn~~~A~~il~  400 (652)
T KOG2376|consen  321 NKMDQVRELSASLPGMSPESLFPILLQEATKVREKKHKKAIELLLQFADGHPEKSKVVLLLRAQLKISQGNPEVALEILS  400 (652)
T ss_pred             hhHHHHHHHHHhCCccCchHHHHHHHHHHHHHHHHHHhhhHHHHHHHhccCCchhHHHHHHHHHHHHhcCCHHHHHHHHH
Confidence            99999999999999999988777777777777777899999999999999999877789999999999999999999999


Q ss_pred             --------cCcCCCCChhHHHHHHHHHHHcCChhHHHHHHHHHHHHHHHhccCcchHHHHHHHHHHHHHhCCChhhHHHH
Q 005990          411 --------KIPDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGREEDASHL  482 (666)
Q Consensus       411 --------~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~l~~a~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~  482 (666)
                              .+.+....|+++..+..+|++.++.+.|..++.+|+.+|.........+..++..++.+.++.|+.++|...
T Consensus       401 ~~~~~~~ss~~~~~~~P~~V~aiv~l~~~~~~~~~a~~vl~~Ai~~~~~~~t~s~~l~~~~~~aa~f~lr~G~~~ea~s~  480 (652)
T KOG2376|consen  401 LFLESWKSSILEAKHLPGTVGAIVALYYKIKDNDSASAVLDSAIKWWRKQQTGSIALLSLMREAAEFKLRHGNEEEASSL  480 (652)
T ss_pred             HHhhhhhhhhhhhccChhHHHHHHHHHHhccCCccHHHHHHHHHHHHHHhcccchHHHhHHHHHhHHHHhcCchHHHHHH
Confidence                    777777799999999999999999999999999999999998887888888999999999999999999999


Q ss_pred             HHHHHHhcCC-hHHHHHHHHhhccCChhhHHHHHhcCCCCCCCCCCChHHHhhccCCCcccccccccccccccCCCchhh
Q 005990          483 FEELVKTHGS-IEALVGLVTTSAHVDVDKAESYEKRLKPLPGLNGVDVDSLEKTSGAKHVESASYFEVNEAHGEGKNKDK  561 (666)
Q Consensus       483 ~~~~l~~~p~-~~~l~~l~~~~~~~d~~~a~~~~~~l~~~~~~~~~d~~~Le~~~~~~~~~~~~~~~~~~~~~~~~~~~~  561 (666)
                      ++++++.+|+ .+.++++|.+|+.+|+++|+.+.+.|+|.+.+.+||||.||.+.|++++++...+.............+
T Consensus       481 leel~k~n~~d~~~l~~lV~a~~~~d~eka~~l~k~L~p~~~l~~vdVd~LE~s~ga~~~~~~k~ta~S~~~~~~~~~~k  560 (652)
T KOG2376|consen  481 LEELVKFNPNDTDLLVQLVTAYARLDPEKAESLSKKLPPLKGLKAVDVDALEKSDGAKYSEAYKKTAVSQVEEKKSKELK  560 (652)
T ss_pred             HHHHHHhCCchHHHHHHHHHHHHhcCHHHHHHHhhcCCCcccchhcCchHhhhccCcchhhhhccccccchhhccchhhh
Confidence            9999998876 788999999999999999999999999999888999999999989888766311111111222221223


Q ss_pred             hhhhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCcccCCCCccchhhhhccCCCCCCcccccc
Q 005990          562 AKKKRKRKPRYPKGFDPANPGPPPDPERWLPKRERSSYRPRRKDKRAAQVRGSQGAVVREKH  623 (666)
Q Consensus       562 ~k~k~kr~~~~~k~~~p~~~~~~pdpERwlp~~~Rs~~~~~~~~~~~~~~~~~qg~~~~~~~  623 (666)
                      +|++||||.++||||||.   ++||||||||++|||+||||||+|++++++|||||++...+
T Consensus       561 KKk~rKrkgk~pknyn~~---~tPDPERWLP~reRS~yr~KrK~k~~~~~kgtQG~~~~~~s  619 (652)
T KOG2376|consen  561 KKKKRKRKGKLPKNYNPK---VTPDPERWLPRRERSTYRPKRKGKRAAIIKGTQGGAANDKS  619 (652)
T ss_pred             hhcccccccCCcccCCCC---CCCChhhcccchhccccCcccccchhhhhccccccccccch
Confidence            334588899999999997   99999999999999999999998887789999999986543



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF08492 SRP72: SRP72 RNA-binding domain; InterPro: IPR013699 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08492 SRP72: SRP72 RNA-binding domain; InterPro: IPR013699 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03362 VI_chp_7 type VI secretion-associated protein, VC_A0119 family Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07163 Pex26: Pex26 protein; InterPro: IPR010797 This family consists of Pex26 and related mammalian proteins Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF09477 Type_III_YscG: Bacterial type II secretion system chaperone protein (type_III_yscG); InterPro: IPR013348 YscG is a molecular chaperone for YscE, where both are part of the type III secretion system that in Yersinia is designated Ysc (Yersinia secretion) Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG0889 consensus Histone acetyltransferase SAGA, TRRAP/TRA1 component, PI-3 kinase superfamily [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query666
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-07
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-07
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-07
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-08
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-07
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-07
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-06
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 8e-07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-06
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 6e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-05
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-06
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-05
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 8e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 67.6 bits (164), Expect = 9e-12
 Identities = 79/602 (13%), Positives = 173/602 (28%), Gaps = 191/602 (31%)

Query: 17  PPPIEDLFTSLNRHIERSEFEQAV---KVADQVLSTNPSDEDAMRCKVVALIKADNI--- 70
              +++      + ++  +  +++   +  D ++ +  +    +R     L K + +   
Sbjct: 27  DAFVDNFDC---KDVQ--DMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQK 81

Query: 71  --DDALSTIQSSQKFTFDFNYLKAYCLYRQNRLDEALESLKIQENNPA--TMLLKSQI-- 124
             ++ L           ++ +L              +  +K ++  P+  T +   Q   
Sbjct: 82  FVEEVLRI---------NYKFL--------------MSPIKTEQRQPSMMTRMYIEQRDR 118

Query: 125 LYRSGE----MDAC-VEFYQKLQKS--KIDSLEINFVAGLISAGRASEVQKTLDSLRVKA 177
           LY   +     +   ++ Y KL+++  ++   +   + G++ +G+         S +V+ 
Sbjct: 119 LYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCLSYKVQC 178

Query: 178 TSSFELAYNTACSLAEMNKYTEAEQLLLTARRIGQETLTDDNFAEDDIEIELAPIAVQLA 237
              F++ +                   L    +        N  E  +E+          
Sbjct: 179 KMDFKIFW-------------------LN---LKN-----CNSPETVLEM---------- 201

Query: 238 YVQQLLGNTQEAFGAYTDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKD 297
            +Q+LL      + + +D          S    +  L+  K      + L  L      +
Sbjct: 202 -LQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSK---PYENCLLVLL-----N 252

Query: 298 MQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMDQAREL-VAALPDMFPDSVMPLLL 356
           +QN +     +L             ++LL          R   V        D +     
Sbjct: 253 VQNAKAWNAFNLSC-----------KILLT--------TRFKQVT-------DFLSAATT 286

Query: 357 QAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPF----IAAESLAKI 412
               L   +     +E+     + L    +   L R        +P     IA       
Sbjct: 287 THISLDHHSMTLTPDEVKSLLLKYL--DCRPQDLPRE---VLTTNPRRLSIIAES----- 336

Query: 413 PDIQHMPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLR 472
             I+   AT                           W +   +  KL+ I++  +S  L 
Sbjct: 337 --IRDGLAT------------------------WDNWKHVNCD--KLTTIIE--SS--LN 364

Query: 473 HGREEDASHLFEELV----KTHGSIEALVGLVTTSAHVDVDK--AESYEKRLKPLPGLNG 526
                +   +F+ L       H     L  +       DV     + ++  L        
Sbjct: 365 VLEPAEYRKMFDRLSVFPPSAHIPTILLSLIWFDVIKSDVMVVVNKLHKYSL-------- 416

Query: 527 VDVDSLEKTSGAKHVESASYFEVNEAHGEGKNKDKAKKKRKRKPRY--PKGFDPANPGPP 584
           V+    E T     +    Y E+       K +++    R     Y  PK FD  +  PP
Sbjct: 417 VEKQPKESTISIPSI----YLELKV-----KLENEYALHRSIVDHYNIPKTFDSDDLIPP 467

Query: 585 PD 586
             
Sbjct: 468 YL 469


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query666
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.98
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.98
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.96
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.96
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.96
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.94
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.94
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.93
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.93
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.93
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.92
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.91
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.91
3u4t_A272 TPR repeat-containing protein; structural genomics 99.91
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.91
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.91
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.91
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.9
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.9
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.9
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.89
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.88
3u4t_A272 TPR repeat-containing protein; structural genomics 99.88
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.88
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.88
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.88
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.88
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.88
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.87
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.87
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.87
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.86
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.86
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.85
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.85
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.84
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.84
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.84
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.83
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.82
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.82
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.82
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.81
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.81
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.8
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.8
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.8
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.8
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.8
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.8
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.79
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.79
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.79
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.78
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.78
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.78
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.77
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.77
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.77
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.77
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.76
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.76
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.76
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.76
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.75
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.74
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.74
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.73
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.71
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.7
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.7
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.7
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.69
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.69
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.69
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.69
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.67
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.67
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.67
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.66
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.65
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.64
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.64
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.64
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.63
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.61
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.61
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.61
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.6
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.57
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.54
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.53
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.53
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.53
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.52
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.52
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.51
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.5
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.48
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.47
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.47
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.47
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.46
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.45
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.45
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.44
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.44
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.44
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.42
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.41
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.41
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.41
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.4
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.4
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.4
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.38
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.38
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.38
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.38
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.38
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.37
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.37
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.37
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.36
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.36
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.35
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.34
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.34
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.33
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.33
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.32
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.32
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.32
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.31
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.31
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.3
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.3
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.3
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.29
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.28
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.28
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.28
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.27
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.27
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.26
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.26
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.25
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.23
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.22
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.22
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.21
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.2
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.2
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.19
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.18
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.15
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.14
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.14
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.13
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.12
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.12
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.11
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.11
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.11
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.09
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.09
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.08
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.08
3k9i_A117 BH0479 protein; putative protein binding protein, 99.07
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.07
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.03
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.03
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.02
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.01
3k9i_A117 BH0479 protein; putative protein binding protein, 98.99
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.94
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.92
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.83
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.79
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.79
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.78
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.7
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.7
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.65
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 98.62
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.61
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.6
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.59
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.58
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.55
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.52
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.51
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.49
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.43
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.39
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.37
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.34
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.3
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.29
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.25
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.25
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.23
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.2
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.16
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.16
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.08
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.04
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.76
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.44
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.44
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.42
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 97.39
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.25
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 97.16
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.13
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 97.07
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 96.87
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.71
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.7
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.67
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.55
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 96.43
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.42
1qsa_A618 Protein (soluble lytic transglycosylase SLT70); al 96.34
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.26
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.84
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.78
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 95.72
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 95.65
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 95.6
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.56
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 95.22
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.1
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 95.07
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 94.68
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 94.56
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 94.5
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 93.86
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.01
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.59
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 92.29
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 92.28
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 91.03
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.01
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 90.98
2qx5_A661 Nucleoporin NIC96; mRNA transport, nuclear pore co 89.82
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 89.24
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 87.94
2uwj_G115 Type III export protein PSCG; virulence, chaperone 87.38
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 87.25
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 86.92
2ynq_A161 ESSB; membrane protein, secretion, type V, secreti 86.32
2p58_C116 Putative type III secretion protein YSCG; type III 84.92
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 84.06
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=1.8e-37  Score=319.95  Aligned_cols=376  Identities=13%  Similarity=0.084  Sum_probs=343.4

Q ss_pred             HHHHHHHhhhccHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccch---hhhHHHHHHHHHhCC
Q 005990           24 FTSLNRHIERSEFEQAVKVADQVLSTNPSDEDAMRCKVVALIKADNIDDALSTIQSSQKFTF---DFNYLKAYCLYRQNR  100 (666)
Q Consensus        24 ~~~~~~~~~~~~~~~A~~~~~~~l~~~p~~~~a~~~~~~~~~~~g~~~~A~~~~~~~~~~~~---~~~~~~a~~~~~~g~  100 (666)
                      +..+..++..|++++|+..+++++..+|++..++..++.++...|++++|+..++.+....|   ..++.+|.++...|+
T Consensus         3 ~~~a~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~~~~~~a~~~~~~a~~~~p~~~~~~~~lg~~~~~~g~   82 (388)
T 1w3b_A            3 MELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERGQ   82 (388)
T ss_dssp             CTHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTC
T ss_pred             hhHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCchHHHHHHHHHHHHCCC
Confidence            35678889999999999999999999999999999999999999999999999999866544   578899999999999


Q ss_pred             HHHHHHHHHh----cCCChhHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCChhH--HHHHHHHHHcCChhHHHHHHHHhh
Q 005990          101 LDEALESLKI----QENNPATMLLKSQILYRSGEMDACVEFYQKLQKSKIDSLE--INFVAGLISAGRASEVQKTLDSLR  174 (666)
Q Consensus       101 ~~~A~~~l~~----~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~p~~~~--~~l~~~~~~~g~~~~A~~~~~~~~  174 (666)
                      +++|+..+++    .|++..++..+|.++...|++++|+..|++++..+|+...  .+++.++...|++++|+..|++++
T Consensus        83 ~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al  162 (388)
T 1w3b_A           83 LQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAI  162 (388)
T ss_dssp             HHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHcCcchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcHHHHHHHHHHHHHccCHHHHHHHHHHHH
Confidence            9999999987    6778899999999999999999999999999999999877  889999999999999999999999


Q ss_pred             hcCCChHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhhhhhccCCCCChhhHhhhhhhHHHHHHHHHHHcCChHHHHHHHH
Q 005990          175 VKATSSFELAYNTACSLAEMNKYTEAEQLLLTARRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAYT  254 (666)
Q Consensus       175 ~~~~~~~~~~~~la~~~~~~g~~~~A~~~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~eA~~~~~  254 (666)
                      ..+|++..+++++|.++...|++++|+..|++++.+.|.               ...++..+|.++...|++++|+..|+
T Consensus       163 ~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~---------------~~~~~~~lg~~~~~~~~~~~A~~~~~  227 (388)
T 1w3b_A          163 ETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPN---------------FLDAYINLGNVLKEARIFDRAVAAYL  227 (388)
T ss_dssp             HHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTT---------------CHHHHHHHHHHHHTTTCTTHHHHHHH
T ss_pred             HhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCC---------------cHHHHHHHHHHHHHcCCHHHHHHHHH
Confidence            999999999999999999999999999999999999853               23689999999999999999999999


Q ss_pred             HHHhhCCCCHhHHHHHHhhhhhccCCCChhHHHHHhHHHhhhhhhhhhhhHHhhcCCCHHHHHHHHHHHHHHHHHcCChH
Q 005990          255 DIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKMD  334 (666)
Q Consensus       255 ~~l~~~~~~~~~~~~~~~~l~~~~~~~~~~~a~~~l~~~~~~~~~~~~~~~~l~~~~~~~q~~~~~~~~a~~~~~~~~~~  334 (666)
                      +++..+|.+..                                                     ++.+++.++...|+++
T Consensus       228 ~al~~~p~~~~-----------------------------------------------------~~~~l~~~~~~~g~~~  254 (388)
T 1w3b_A          228 RALSLSPNHAV-----------------------------------------------------VHGNLACVYYEQGLID  254 (388)
T ss_dssp             HHHHHCTTCHH-----------------------------------------------------HHHHHHHHHHHTTCHH
T ss_pred             HHHhhCcCCHH-----------------------------------------------------HHHHHHHHHHHcCCHH
Confidence            99999986641                                                     1234488899999999


Q ss_pred             HHHHHHHhccccCCCCchHHHHHHHHHHhhCChhHHHHHHHHHHhhCCChhHHHHHHHHHHHHHcCChhHHHHHHhcCcC
Q 005990          335 QARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIPD  414 (666)
Q Consensus       335 ~A~~~~~~~~~~~p~~~~~~~~~a~~~~~~g~~~~A~~~l~~~~~~~p~~~~~~~~~la~~~~~~g~~~~A~~~l~~~~~  414 (666)
                      +|+..+++++...|++..++..++.++...|++++|+..|++++...|.+.. ++..++.++...|++++|+.+++++++
T Consensus       255 ~A~~~~~~al~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~~-~~~~l~~~~~~~g~~~~A~~~~~~al~  333 (388)
T 1w3b_A          255 LAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHAD-SLNNLANIKREQGNIEEAVRLYRKALE  333 (388)
T ss_dssp             HHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHH-HHHHHHHHHHTTTCHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHhhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCcccHH-HHHHHHHHHHHcCCHHHHHHHHHHHHh
Confidence            9999999999999999999999999999999999999999999999999765 889999999999999999999999999


Q ss_pred             CCC-ChhHHHHHHHHHHHcCChhHHHHHHHHHHHHHHHhccCcchHHHHHHHHHHHHHhCCC
Q 005990          415 IQH-MPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGR  475 (666)
Q Consensus       415 ~~~-~~~~~~~l~~~~~~~g~~~~A~~~l~~a~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~  475 (666)
                      ..| ++..+..++.+|...|++++|+..|+++++..|       ....++..+|.++...|+
T Consensus       334 ~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~p-------~~~~a~~~lg~~~~~~~~  388 (388)
T 1w3b_A          334 VFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISP-------TFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             SCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCT-------TCHHHHHHHHHHHHHTCC
T ss_pred             cCCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCC-------CCHHHHHhHHHHHHHccC
Confidence            999 788899999999999999999999999987643       333478889998887764



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>2ynq_A ESSB; membrane protein, secretion, type V, secretion system; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 666
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-06
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 7e-04
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 47.7 bits (112), Expect = 2e-06
 Identities = 43/367 (11%), Positives = 96/367 (26%), Gaps = 29/367 (7%)

Query: 23  LFTSLNRHIERSEFEQAVKVADQVLSTNPSDEDAMRCKVVALIKADNIDDALSTIQSSQK 82
                +R  +  +FE A +   Q+    P +   +        +   +D +      + K
Sbjct: 2   PMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIK 61

Query: 83  FTFDFNYLKAYCLYRQNRLDEALESLKIQENNPATMLLKSQILYRSGEMDACVEFYQKLQ 142
              +    +AY     + L    +     +          ++     +    +       
Sbjct: 62  --QNPLLAEAY-----SNLGNVYKERGQLQEAIEHYRHALRLKPDFIDGYINLAAALVAA 114

Query: 143 KSKIDSLEINFVAGLISAGRASEVQKTLDSLRVKATSSFELAYNTACSLAEMNKYTEAEQ 202
                +++    A   +           + L+         A        + N       
Sbjct: 115 GDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKAIETQPNFAVAWSN 174

Query: 203 LLLTARRIGQETLTDDNFAED-DIEIELAPIAVQLAYVQQLLGNTQEAFGAYTDIIKRNL 261
           L       G+  L   +F +   ++       + L  V +       A  AY   +  + 
Sbjct: 175 LGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS- 233

Query: 262 ADESSFAVAVNNL-VALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIY 320
               + AV   NL         ++ ++    R                + L P   +A Y
Sbjct: 234 ---PNHAVVHGNLACVYYEQGLIDLAIDTYRRA---------------IELQPHFPDA-Y 274

Query: 321 ANRVLLLLHANKMDQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEK 380
            N    L     + +A +       + P     L   A +   +    +A  L  +  E 
Sbjct: 275 CNLANALKEKGSVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEV 334

Query: 381 LPDKSKI 387
            P+ +  
Sbjct: 335 FPEFAAA 341


>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query666
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.92
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.9
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.81
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.81
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.79
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.77
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.75
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.73
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.73
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.7
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.53
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.49
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.48
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.43
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.42
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.41
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.41
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.36
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.36
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.35
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.29
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.29
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.28
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.26
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.26
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.22
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.19
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.19
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.18
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.14
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.14
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.11
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.07
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.07
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.03
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.02
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.99
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.91
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.86
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.85
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.77
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.67
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.66
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.45
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.31
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 98.29
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 98.15
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.8
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.65
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.43
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.41
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.13
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.6
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 85.0
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.6e-33  Score=285.62  Aligned_cols=377  Identities=13%  Similarity=0.075  Sum_probs=334.9

Q ss_pred             HHHHHHHHhhhccHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccch---hhhHHHHHHHHHhC
Q 005990           23 LFTSLNRHIERSEFEQAVKVADQVLSTNPSDEDAMRCKVVALIKADNIDDALSTIQSSQKFTF---DFNYLKAYCLYRQN   99 (666)
Q Consensus        23 l~~~~~~~~~~~~~~~A~~~~~~~l~~~p~~~~a~~~~~~~~~~~g~~~~A~~~~~~~~~~~~---~~~~~~a~~~~~~g   99 (666)
                      ++..+..+++.|+|++|+..|+++++.+|+++.+++.+|.++.++|+|++|+..|+++....|   ..++.+|.++..+|
T Consensus         2 ll~la~~~~~~G~~~~A~~~~~~~l~~~p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~p~~~~a~~~l~~~~~~~g   81 (388)
T d1w3ba_           2 PMELAHREYQAGDFEAAERHCMQLWRQEPDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQNPLLAEAYSNLGNVYKERG   81 (388)
T ss_dssp             CCTHHHHHHHHTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHT
T ss_pred             hHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhhhhc
Confidence            456789999999999999999999999999999999999999999999999999999976654   57789999999999


Q ss_pred             CHHHHHHHHHh----cCCChhHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCChhH--HHHHHHHHHcCChhHHHHHHHHh
Q 005990          100 RLDEALESLKI----QENNPATMLLKSQILYRSGEMDACVEFYQKLQKSKIDSLE--INFVAGLISAGRASEVQKTLDSL  173 (666)
Q Consensus       100 ~~~~A~~~l~~----~~~~~~~~~~la~~~~~~g~~~~A~~~~~~~l~~~p~~~~--~~l~~~~~~~g~~~~A~~~~~~~  173 (666)
                      ++++|+..+..    .+.........+......+.+..+...+.......+....  ..........+....+...+.+.
T Consensus        82 ~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  161 (388)
T d1w3ba_          82 QLQEAIEHYRHALRLKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKACYLKA  161 (388)
T ss_dssp             CHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHTTSCHHHHHHHHHHH
T ss_pred             cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccchhhhhHHHHHHh
Confidence            99999998877    4567788888888888888888888888877766555544  66666677788899999999999


Q ss_pred             hhcCCChHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhhhhhccCCCCChhhHhhhhhhHHHHHHHHHHHcCChHHHHHHH
Q 005990          174 RVKATSSFELAYNTACSLAEMNKYTEAEQLLLTARRIGQETLTDDNFAEDDIEIELAPIAVQLAYVQQLLGNTQEAFGAY  253 (666)
Q Consensus       174 ~~~~~~~~~~~~~la~~~~~~g~~~~A~~~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~eA~~~~  253 (666)
                      +...|++..+++.+|.++...|++++|...+++++.+.|..               ..++..+|.++...|++++|+..|
T Consensus       162 ~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~---------------~~~~~~l~~~~~~~~~~~~A~~~~  226 (388)
T d1w3ba_         162 IETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNF---------------LDAYINLGNVLKEARIFDRAVAAY  226 (388)
T ss_dssp             HHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTC---------------HHHHHHHHHHHHTTTCTTHHHHHH
T ss_pred             hccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCccc---------------HHHHHHHhhhhhccccHHHHHHHH
Confidence            99999999999999999999999999999999999998532               358999999999999999999999


Q ss_pred             HHHHhhCCCCHhHHHHHHhhhhhccCCCChhHHHHHhHHHhhhhhhhhhhhHHhhcCCCHHHHHHHHHHHHHHHHHcCCh
Q 005990          254 TDIIKRNLADESSFAVAVNNLVALKGPKDVNDSLKKLDRIKEKDMQNFQLARVLDLRLSPKQREAIYANRVLLLLHANKM  333 (666)
Q Consensus       254 ~~~l~~~~~~~~~~~~~~~~l~~~~~~~~~~~a~~~l~~~~~~~~~~~~~~~~l~~~~~~~q~~~~~~~~a~~~~~~~~~  333 (666)
                      +++....+.+..                                                     ...+++.++...|++
T Consensus       227 ~~~~~~~~~~~~-----------------------------------------------------~~~~l~~~~~~~~~~  253 (388)
T d1w3ba_         227 LRALSLSPNHAV-----------------------------------------------------VHGNLACVYYEQGLI  253 (388)
T ss_dssp             HHHHHHCTTCHH-----------------------------------------------------HHHHHHHHHHHTTCH
T ss_pred             HHhHHHhhhHHH-----------------------------------------------------HHHHHHHHHHHCCCH
Confidence            999988775531                                                     123347888999999


Q ss_pred             HHHHHHHHhccccCCCCchHHHHHHHHHHhhCChhHHHHHHHHHHhhCCChhHHHHHHHHHHHHHcCChhHHHHHHhcCc
Q 005990          334 DQARELVAALPDMFPDSVMPLLLQAAVLVRENKAGKAEELLGQFAEKLPDKSKIILLARAQVAAAANHPFIAAESLAKIP  413 (666)
Q Consensus       334 ~~A~~~~~~~~~~~p~~~~~~~~~a~~~~~~g~~~~A~~~l~~~~~~~p~~~~~~~~~la~~~~~~g~~~~A~~~l~~~~  413 (666)
                      ++|+..++++++.+|++..+++.+|.++...|++++|+..|+.++...|.+.. .+..++.++...|++++|+.+|++++
T Consensus       254 ~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~~~~~~-~~~~l~~~~~~~~~~~~A~~~~~~al  332 (388)
T d1w3ba_         254 DLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLCPTHAD-SLNNLANIKREQGNIEEAVRLYRKAL  332 (388)
T ss_dssp             HHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHCTTCHH-HHHHHHHHHHTTTCHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccCCccch-hhhHHHHHHHHCCCHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999765 88999999999999999999999999


Q ss_pred             CCCC-ChhHHHHHHHHHHHcCChhHHHHHHHHHHHHHHHhccCcchHHHHHHHHHHHHHhCCC
Q 005990          414 DIQH-MPATVATLVALKERAGDIDGAAAVLDSAIKWWLNAMTEDNKLSVIMQEAASFKLRHGR  475 (666)
Q Consensus       414 ~~~~-~~~~~~~l~~~~~~~g~~~~A~~~l~~a~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~  475 (666)
                      +..| ++.++..+|.+|...|++++|+..|+++++..|+.       ..++..+|.+|.+.||
T Consensus       333 ~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~-------~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         333 EVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTF-------ADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             TSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTC-------HHHHHHHHHHHHHTCC
T ss_pred             HhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCC-------HHHHHHHHHHHHHcCC
Confidence            9999 88889999999999999999999999999875433       3488899999999886



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure