Citrus Sinensis ID: 006364


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------65
MNMYCKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKSDDALSFALRMNLIGVVFDAVTYSTALSFCLDHEGFLFGLQLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFDEMPNKDSVSWNAILSGYTQDGDYGVEAILALIEMMRKGLRLDHVSFTSAASACGHEKNLELGKQIHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMISMNREDAVSLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLITMYARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKESKPNAYTFGSVLNAVGAAEDISLKHGQRCHSHIIKVGLDSDPIVGSALLDMYGKRGSIFESQRVFNETQEKSEFAWTAIISALARHGDYESVMNQFKEMENKGVRPDSITFLSVLTVCGRNGMIHKGRHLFDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPGGPGLSVLQSLLGACRIHGNVEMGERIADALMKMEPAGSGSYVLMSNLYAEKGDWEMVAILRKGMKSKGVRKEVGFSWADVGDIDGLHGFSSGDNTHPRSEEIYRMAECLGSEMKYLNSKRERAIAL
ccEEEccccccHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHcccccccEEEHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHcccccccEEEHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHccccccccEEHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEEEcccccEEEEEccccccccHHHHHHHHHHHHHHHHHccccccccccc
cccEEEcccHHHHHHHHHHccccccEHHHHHHHHHHHccHHHHHHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHccccHHHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEEEEEEcccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccEcc
mnmycksgqfdKALCIfnnlnnpdiVSWNTVLSGFEKSDDALSFALRMNLIGVVFDAVTYSTALSFCLDHEGFLFGLQLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRvfdempnkdsvsWNAILSGYTQDGDYGVEAILALIEMMRKGLrldhvsftsaasacgheknlelgkqiHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMISMNREDAVSLFKEmrldgvcpndvtFIGLIHAISIGNLVKEGRMIHglciktnflsepsvcNCLITMYARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVikeskpnaytfgSVLNAVGaaedislkhgqrcHSHIIKvgldsdpivGSALLDmygkrgsifeSQRVFNETQEKSEFAWTAIISALARHGDYESVMNQFKEmenkgvrpdsiTFLSVLTVCgrngmihkgrhLFDSMlkdyhiepspdhySCMVDMLGRVGRLEEAEElvgqipggpglSVLQSLLGACRIHGNVEMGERIADALMkmepagsgsyVLMSNLYAEKGDWEMVAILRKGmkskgvrkevgfswadvgdidglhgfssgdnthprSEEIYRMAECLGSEMKYLNSKRERAIAL
MNMYCKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKSDDALSFALRMNLIGVVFDAVTYSTALSFCLDHEGFLFGLQLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFdempnkdsVSWNAILSGYTQDGDYGVEAILALIEMMRKGLRLDHVSFTSAASACGHEKNLELGKQIHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMISMNREDAVSLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLITMYARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKESKPNAYTFGSVLNAVGAAEDISLKHGQRCHSHIIkvgldsdpIVGSALLDMYGKRGSIFESQRVFNETQEKSEFAWTAIISALARHGDYESVMNQFKEMEnkgvrpdsITFLSVLTVCGRNGMIHKGRHLFDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPGGPGLSVLQSLLGACRIHGNVEMGERIADALMKMEPAGSGSYVLMSNLYAEKGDWEMVAILRKGmkskgvrkEVGFSWAdvgdidglhgfssgdnthpRSEEIYRMAECLGSemkylnskreraial
MNMYCKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKSDDALSFALRMNLIGVVFDAVTYSTALSFCLDHEGFLFGLQLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFDEMPNKDSVSWNAILSGYTQDGDYGVEAILALIEMMRKGLRLDHVSFTSAASACGHEKNLELGKQIHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMISMNREDAVSLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLITMYARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKESKPNAYTFGSVLNAVGAAEDISLKHGQRCHSHIIKVGLDSDPIVGSALLDMYGKRGSIFESQRVFNETQEKSEFAWTAIISALARHGDYESVMNQFKEMENKGVRPDSITFLSVLTVCGRNGMIHKGRHLFDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPGGPGLSVLQSLLGACRIHGNVEMGERIADALMKMEPAGSGSYVLMSNLYAEKGDWEMVAILRKGMKSKGVRKEVGFSWADVGDIDGLHGFSSGDNTHPRSEEIYRMAECLGSEMKYLNSKRERAIAL
***YCKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKSDDALSFALRMNLIGVVFDAVTYSTALSFCLDHEGFLFGLQLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFDEMPNKDSVSWNAILSGYTQDGDYGVEAILALIEMMRKGLRLDHVSFTSAASACGHEKNLELGKQIHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMISMNREDAVSLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLITMYARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKESKPNAYTFGSVLNAVGAAEDISLKHGQRCHSHIIKVGLDSDPIVGSALLDMYGKRGSIFESQRVFNETQEKSEFAWTAIISALARHGDYESVMNQFKEMENKGVRPDSITFLSVLTVCGRNGMIHKGRHLFDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPGGPGLSVLQSLLGACRIHGNVEMGERIADALMKMEPAGSGSYVLMSNLYAEKGDWEMVAILRKGMKSKGVRKEVGFSWADVGDIDGLHGF******************C******************
MNMYCKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKSDDALSFALRMNLIGVVFDAVTYSTALSFCLDHEGFLFGLQLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFDEMPNKDSVSWNAILSGYTQDGDYGVEAILALIEMMRKGLRLDHVSFTSAASACGHEKNLELGKQIHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMISMNREDAVSLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLITMYARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKESKPNAYTFGSVLNAVGAAEDISLKHGQRCHSHIIKVGLDSDPIVGSALLDMYGKRGSIFESQRVFNETQEKSEFAWTAIISALARHGDYESVMNQFKEMENKGVRPDSITFLSVLTVCGRNGMIHKGRHLFDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPGGPGLSVLQSLLGACRIHGNVEMGERIADALMKMEPAGSGSYVLMSNLYAEKGDWEMVAILRKGMKSKGVRKEVGFSWADVGDIDGLHGFSSGDNTHPRSEEIYRMAECLGSEMKYLNSKRERAIAL
MNMYCKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKSDDALSFALRMNLIGVVFDAVTYSTALSFCLDHEGFLFGLQLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFDEMPNKDSVSWNAILSGYTQDGDYGVEAILALIEMMRKGLRLDHVSFTSAASACGHEKNLELGKQIHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMISMNREDAVSLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLITMYARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKESKPNAYTFGSVLNAVGAAEDISLKHGQRCHSHIIKVGLDSDPIVGSALLDMYGKRGSIFESQRVFNETQEKSEFAWTAIISALARHGDYESVMNQFKEMENKGVRPDSITFLSVLTVCGRNGMIHKGRHLFDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPGGPGLSVLQSLLGACRIHGNVEMGERIADALMKMEPAGSGSYVLMSNLYAEKGDWEMVAILRKGMKSKGVRKEVGFSWADVGDIDGLHGFSSGDNTHPRSEEIYRMAECLGSEMKYLNSKRERAIAL
MNMYCKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKSDDALSFALRMNLIGVVFDAVTYSTALSFCLDHEGFLFGLQLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFDEMPNKDSVSWNAILSGYTQDGDYGVEAILALIEMMRKGLRLDHVSFTSAASACGHEKNLELGKQIHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMISMNREDAVSLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLITMYARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKESKPNAYTFGSVLNAVGAAEDISLKHGQRCHSHIIKVGLDSDPIVGSALLDMYGKRGSIFESQRVFNETQEKSEFAWTAIISALARHGDYESVMNQFKEMENKGVRPDSITFLSVLTVCGRNGMIHKGRHLFDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPGGPGLSVLQSLLGACRIHGNVEMGERIADALMKMEPAGSGSYVLMSNLYAEKGDWEMVAILRKGMKSKGVRKEVGFSWADVGDIDGLHGFSSGDNTHPRSEEIYRMAECLGSEMKYLNSKRERAIAL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNMYCKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKSDDALSFALRMNLIGVVFDAVTYSTALSFCLDHEGFLFGLQLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFDEMPNKDSVSWNAILSGYTQDGDYGVEAILALIEMMRKGLRLDHVSFTSAASACGHEKNLELGKQIHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMISMNREDAVSLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLITMYARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKESKPNAYTFGSVLNAVGAAEDISLKHGQRCHSHIIKVGLDSDPIVGSALLDMYGKRGSIFESQRVFNETQEKSEFAWTAIISALARHGDYESVMNQFKEMENKGVRPDSITFLSVLTVCGRNGMIHKGRHLFDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPGGPGLSVLQSLLGACRIHGNVEMGERIADALMKMEPAGSGSYVLMSNLYAEKGDWEMVAILRKGMKSKGVRKEVGFSWADVGDIDGLHGFSSGDNTHPRSEEIYRMAECLGSEMKYLNSKRERAIAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query648 2.2.26 [Sep-21-2011]
Q84MA3763 Pentatricopeptide repeat- yes no 0.979 0.832 0.594 0.0
Q9ZUW3868 Pentatricopeptide repeat- no no 0.972 0.725 0.347 1e-117
Q3E6Q1809 Pentatricopeptide repeat- no no 0.973 0.779 0.334 1e-109
O81767823 Pentatricopeptide repeat- no no 0.962 0.758 0.354 1e-108
Q9SS831028 Pentatricopeptide repeat- no no 0.972 0.612 0.350 1e-103
Q9SIT7697 Pentatricopeptide repeat- no no 0.890 0.827 0.321 1e-103
Q9SUH6792 Pentatricopeptide repeat- no no 0.964 0.789 0.336 1e-103
Q9SVA5834 Pentatricopeptide repeat- no no 0.972 0.755 0.325 1e-102
Q9STE1857 Pentatricopeptide repeat- no no 0.966 0.730 0.342 1e-102
Q9SN39871 Pentatricopeptide repeat- no no 0.952 0.708 0.321 1e-102
>sp|Q84MA3|PP345_ARATH Pentatricopeptide repeat-containing protein At4g32430, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E40 PE=2 SV=1 Back     alignment and function desciption
 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/638 (59%), Positives = 495/638 (77%), Gaps = 3/638 (0%)

Query: 1   MNMYCKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKSDDALSFALRMNLIGVVFDAVTY 60
           M MY K+G+FD ALCIF NL +PD+VSWNT+LSGF+ +  AL+F +RM   GVVFDA TY
Sbjct: 118 MGMYRKAGRFDNALCIFENLVDPDVVSWNTILSGFDDNQIALNFVVRMKSAGVVFDAFTY 177

Query: 61  STALSFCLDHEGFLFGLQLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFDEMPN 120
           STALSFC+  EGFL GLQL S +VK GL+S++ VGN+ ITMYSR G    ARRVFDEM  
Sbjct: 178 STALSFCVGSEGFLLGLQLQSTVVKTGLESDLVVGNSFITMYSRSGSFRGARRVFDEMSF 237

Query: 121 KDSVSWNAILSGYTQDGDYGVEAILALIEMMRKGLRLDHVSFTSAASACGHEKNLELGKQ 180
           KD +SWN++LSG +Q+G +G EA++   +MMR+G+ LDHVSFTS  + C HE +L+L +Q
Sbjct: 238 KDMISWNSLLSGLSQEGTFGFEAVVIFRDMMREGVELDHVSFTSVITTCCHETDLKLARQ 297

Query: 181 IHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMISMNREDAV 240
           IHG+ IK GY + + VGN+LMS YSKC V      VF +M +RNV+SWTTMIS N++DAV
Sbjct: 298 IHGLCIKRGYESLLEVGNILMSRYSKCGVLEAVKSVFHQMSERNVVSWTTMISSNKDDAV 357

Query: 241 SLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLITMY 300
           S+F  MR DGV PN+VTF+GLI+A+     +KEG  IHGLCIKT F+SEPSV N  IT+Y
Sbjct: 358 SIFLNMRFDGVYPNEVTFVGLINAVKCNEQIKEGLKIHGLCIKTGFVSEPSVGNSFITLY 417

Query: 301 ARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKESKPNAYTFGS 360
           A+FE+++D++K F++++ REIISWNA+ISG+AQNG S  A++ F     E+ PN YTFGS
Sbjct: 418 AKFEALEDAKKAFEDITFREIISWNAMISGFAQNGFSHEALKMFLSAAAETMPNEYTFGS 477

Query: 361 VLNAVGAAEDISLKHGQRCHSHIIKVGLDSDPIVGSALLDMYGKRGSIFESQRVFNETQE 420
           VLNA+  AEDIS+K GQRCH+H++K+GL+S P+V SALLDMY KRG+I ES++VFNE  +
Sbjct: 478 VLNAIAFAEDISVKQGQRCHAHLLKLGLNSCPVVSSALLDMYAKRGNIDESEKVFNEMSQ 537

Query: 421 KSEFAWTAIISALARHGDYESVMNQFKEMENKGVRPDSITFLSVLTVCGRNGMIHKGRHL 480
           K++F WT+IISA + HGD+E+VMN F +M  + V PD +TFLSVLT C R GM+ KG  +
Sbjct: 538 KNQFVWTSIISAYSSHGDFETVMNLFHKMIKENVAPDLVTFLSVLTACNRKGMVDKGYEI 597

Query: 481 FDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPGGPGLSVLQSLLGACRIHG 540
           F+ M++ Y++EPS +HYSCMVDMLGR GRL+EAEEL+ ++PGGPG S+LQS+LG+CR+HG
Sbjct: 598 FNMMIEVYNLEPSHEHYSCMVDMLGRAGRLKEAEELMSEVPGGPGESMLQSMLGSCRLHG 657

Query: 541 NVEMGERIADALMKMEPAGSGSYVLMSNLYAEKGDWEMVAILRKGMKSKGVRKEVGFSWA 600
           NV+MG ++A+  M+M+P  SGSYV M N+YAEK +W+  A +RK M+ K V KE GFSW 
Sbjct: 658 NVKMGAKVAELAMEMKPELSGSYVQMYNIYAEKEEWDKAAEIRKAMRKKNVSKEAGFSWI 717

Query: 601 DVGDIDG---LHGFSSGDNTHPRSEEIYRMAECLGSEM 635
           DVGD +G   + GFSSGD +HP+S+EIYRM E +G EM
Sbjct: 718 DVGDTEGSLTMQGFSSGDKSHPKSDEIYRMVEIIGLEM 755





Arabidopsis thaliana (taxid: 3702)
>sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protein At2g27610 OS=Arabidopsis thaliana GN=PCMP-H60 PE=2 SV=1 Back     alignment and function description
>sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protein At1g11290 OS=Arabidopsis thaliana GN=PCMP-H40 PE=2 SV=1 Back     alignment and function description
>sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protein At4g33990 OS=Arabidopsis thaliana GN=EMB2758 PE=3 SV=2 Back     alignment and function description
>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein At3g09040, mitochondrial OS=Arabidopsis thaliana GN=PCMP-E88 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protein At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=3 SV=1 Back     alignment and function description
>sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protein At4g30700 OS=Arabidopsis thaliana GN=DYW9 PE=2 SV=1 Back     alignment and function description
>sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protein At4g39530 OS=Arabidopsis thaliana GN=PCMP-E52 PE=1 SV=1 Back     alignment and function description
>sp|Q9STE1|PP333_ARATH Pentatricopeptide repeat-containing protein At4g21300 OS=Arabidopsis thaliana GN=PCMP-E36 PE=3 SV=1 Back     alignment and function description
>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein At4g18750, chloroplastic OS=Arabidopsis thaliana GN=PCMP-H45 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query648
225445472 773 PREDICTED: pentatricopeptide repeat-cont 0.993 0.833 0.709 0.0
224141133 770 predicted protein [Populus trichocarpa] 0.992 0.835 0.698 0.0
449519412 781 PREDICTED: pentatricopeptide repeat-cont 0.992 0.823 0.669 0.0
297738941 760 unnamed protein product [Vitis vinifera] 0.961 0.819 0.681 0.0
356506341 895 PREDICTED: pentatricopeptide repeat-cont 0.993 0.719 0.667 0.0
357514793 791 Pentatricopeptide repeat-containing prot 0.983 0.805 0.668 0.0
297802780686 hypothetical protein ARALYDRAFT_491483 [ 0.979 0.925 0.600 0.0
4049345688 putative protein [Arabidopsis thaliana] 0.979 0.922 0.594 0.0
30689384 763 pentatricopeptide repeat-containing prot 0.979 0.832 0.594 0.0
115473985726 Os07g0670000 [Oryza sativa Japonica Grou 0.981 0.876 0.5 1e-179
>gi|225445472|ref|XP_002281953.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial [Vitis vinifera] Back     alignment and taxonomy information
 Score =  969 bits (2505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/647 (70%), Positives = 546/647 (84%), Gaps = 3/647 (0%)

Query: 1   MNMYCKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKSDDALSFALRMNLIGVVFDAVTY 60
           MNMYCK+G FD+AL +F NLNNPDIVSWNTVLSGF++SDDAL+FALRMN  GV FDAVT 
Sbjct: 120 MNMYCKAGLFDRALVVFENLNNPDIVSWNTVLSGFQRSDDALNFALRMNFTGVAFDAVTC 179

Query: 61  STALSFCLDHEGFLFGLQLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFDEMPN 120
           +T L+FC DHEGF+FG QLHS I+K GLD EV+VGNALITMYSR  RLVEARRVFDEM N
Sbjct: 180 TTVLAFCSDHEGFIFGFQLHSRILKCGLDCEVFVGNALITMYSRCCRLVEARRVFDEMRN 239

Query: 121 KDSVSWNAILSGYTQDGDYGVEAILALIEMMRKGLRLDHVSFTSAASACGHEKNLELGKQ 180
           KD VSWNA+LSGY Q+G+ G+EAIL  +EM+++G++LDHVSFT A SACGH K  ELG+Q
Sbjct: 240 KDLVSWNAMLSGYAQEGNSGLEAILVFLEMLKEGMKLDHVSFTGAISACGHGKEFELGRQ 299

Query: 181 IHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMISMNREDAV 240
           IH +++K+GY THV V NVL+STYSKCE   DA  VF  + DRNV+SWTTMIS++ EDA 
Sbjct: 300 IHSLAVKIGYDTHVKVCNVLISTYSKCEDIEDAKLVFESIIDRNVVSWTTMISISEEDAT 359

Query: 241 SLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLITMY 300
           SLF EMR DGV PNDVTF+GLIHAI++ NLV+EG+MIHG+C+KT+FLSE +V N LITMY
Sbjct: 360 SLFNEMRRDGVYPNDVTFVGLIHAITMKNLVEEGQMIHGVCVKTSFLSELNVSNSLITMY 419

Query: 301 ARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKESKPNAYTFGS 360
           A+FESM DS KVF+EL+ REIISWN+LISGYAQNGL   A+Q F   + ES+PN +TFGS
Sbjct: 420 AKFESMSDSMKVFEELNYREIISWNSLISGYAQNGLWQEALQTFLSALMESRPNEFTFGS 479

Query: 361 VLNAVGAAEDISLKHGQRCHSHIIKVGLDSDPIVGSALLDMYGKRGSIFESQRVFNETQE 420
           VL+++ +AE IS++HGQRCHSHI+K+GL+++PIV SALLDMY KRGSI ES  VF+ET  
Sbjct: 480 VLSSIASAEAISMRHGQRCHSHILKLGLNTNPIVSSALLDMYAKRGSICESLGVFSETPL 539

Query: 421 KSEFAWTAIISALARHGDYESVMNQFKEMENKGVRPDSITFLSVLTVCGRNGMIHKGRHL 480
           K+E AWTAIISA ARHGDYE+VMN FK+ME +GV+PDSITFL+V+T CGR GM+  G  L
Sbjct: 540 KNEVAWTAIISAHARHGDYEAVMNLFKDMEREGVKPDSITFLAVITACGRKGMVDTGYQL 599

Query: 481 FDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPGGPGLSVLQSLLGACRIHG 540
           F+SM+KD+ IEPSP+HYS MVDMLGR GRL+EAEE VGQIPGG GLSVLQSLLGACRIHG
Sbjct: 600 FNSMVKDHLIEPSPEHYSSMVDMLGRAGRLKEAEEFVGQIPGGAGLSVLQSLLGACRIHG 659

Query: 541 NVEMGERIADALMKMEPAGSGSYVLMSNLYAEKGDWEMVAILRKGMKSKGVRKEVGFSWA 600
           NV+M +R+AD L++MEP GSGSYVLMSNLYAEKG+WE VA +RKGM+ +GVRKE+GFSW 
Sbjct: 660 NVDMAKRVADDLIEMEPMGSGSYVLMSNLYAEKGEWEKVAKIRKGMRERGVRKEIGFSWV 719

Query: 601 DVGDIDG---LHGFSSGDNTHPRSEEIYRMAECLGSEMKYLNSKRER 644
           DVGD DG   LHGFSS D  HP+SEEIYRMAE LG EMK+L  +R+R
Sbjct: 720 DVGDADGSLYLHGFSSDDKFHPQSEEIYRMAETLGLEMKFLEKERKR 766




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224141133|ref|XP_002323929.1| predicted protein [Populus trichocarpa] gi|222866931|gb|EEF04062.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449519412|ref|XP_004166729.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297738941|emb|CBI28186.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356506341|ref|XP_003521943.1| PREDICTED: pentatricopeptide repeat-containing protein At4g32430, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|357514793|ref|XP_003627685.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|358344437|ref|XP_003636296.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|358345563|ref|XP_003636846.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355502231|gb|AES83434.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355502781|gb|AES83984.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355521707|gb|AET02161.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297802780|ref|XP_002869274.1| hypothetical protein ARALYDRAFT_491483 [Arabidopsis lyrata subsp. lyrata] gi|297315110|gb|EFH45533.1| hypothetical protein ARALYDRAFT_491483 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|4049345|emb|CAA22570.1| putative protein [Arabidopsis thaliana] gi|7270147|emb|CAB79960.1| putative protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30689384|ref|NP_194969.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75147159|sp|Q84MA3.1|PP345_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g32430, mitochondrial; Flags: Precursor gi|30102674|gb|AAP21255.1| At4g32430 [Arabidopsis thaliana] gi|110742925|dbj|BAE99358.1| hypothetical protein [Arabidopsis thaliana] gi|332660658|gb|AEE86058.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|115473985|ref|NP_001060591.1| Os07g0670000 [Oryza sativa Japonica Group] gi|22831115|dbj|BAC15976.1| selenium-binding protein-like protein [Oryza sativa Japonica Group] gi|50510078|dbj|BAD30730.1| selenium-binding protein-like protein [Oryza sativa Japonica Group] gi|113612127|dbj|BAF22505.1| Os07g0670000 [Oryza sativa Japonica Group] gi|125559550|gb|EAZ05086.1| hypothetical protein OsI_27276 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query648
TAIR|locus:2127801763 AT4G32430 "AT4G32430" [Arabido 0.979 0.832 0.594 8.7e-214
TAIR|locus:2038603868 AT2G27610 "AT2G27610" [Arabido 0.986 0.736 0.349 4.8e-110
TAIR|locus:20952891028 AT3G09040 "AT3G09040" [Arabido 0.972 0.612 0.350 4e-104
TAIR|locus:2202074809 CRR22 "CHLORORESPIRATORY REDUC 0.970 0.777 0.335 9.8e-103
TAIR|locus:2032840937 AT1G16480 "AT1G16480" [Arabido 0.952 0.658 0.351 3.3e-102
TAIR|locus:2118964823 EMB2758 "embryo defective 2758 0.959 0.755 0.354 6.9e-102
TAIR|locus:2178188995 MEF7 "AT5G09950" [Arabidopsis 0.973 0.634 0.328 9.4e-98
TAIR|locus:2131939792 MEF29 "AT4G30700" [Arabidopsis 0.964 0.789 0.341 6.6e-97
TAIR|locus:2141171857 AT4G21300 [Arabidopsis thalian 0.962 0.728 0.346 1.4e-96
TAIR|locus:2122551834 AT4G39530 [Arabidopsis thalian 0.964 0.749 0.329 1.4e-96
TAIR|locus:2127801 AT4G32430 "AT4G32430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2066 (732.3 bits), Expect = 8.7e-214, P = 8.7e-214
 Identities = 379/638 (59%), Positives = 495/638 (77%)

Query:     1 MNMYCKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKSDDALSFALRMNLIGVVFDAVTY 60
             M MY K+G+FD ALCIF NL +PD+VSWNT+LSGF+ +  AL+F +RM   GVVFDA TY
Sbjct:   118 MGMYRKAGRFDNALCIFENLVDPDVVSWNTILSGFDDNQIALNFVVRMKSAGVVFDAFTY 177

Query:    61 STALSFCLDHEGFLFGLQLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFDEMPN 120
             STALSFC+  EGFL GLQL S +VK GL+S++ VGN+ ITMYSR G    ARRVFDEM  
Sbjct:   178 STALSFCVGSEGFLLGLQLQSTVVKTGLESDLVVGNSFITMYSRSGSFRGARRVFDEMSF 237

Query:   121 KDSVSWNAILSGYTQDGDYGVEAILALIEMMRKGLRLDHVSFTSAASACGHEKNLELGKQ 180
             KD +SWN++LSG +Q+G +G EA++   +MMR+G+ LDHVSFTS  + C HE +L+L +Q
Sbjct:   238 KDMISWNSLLSGLSQEGTFGFEAVVIFRDMMREGVELDHVSFTSVITTCCHETDLKLARQ 297

Query:   181 IHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMISMNREDAV 240
             IHG+ IK GY + + VGN+LMS YSKC V      VF +M +RNV+SWTTMIS N++DAV
Sbjct:   298 IHGLCIKRGYESLLEVGNILMSRYSKCGVLEAVKSVFHQMSERNVVSWTTMISSNKDDAV 357

Query:   241 SLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLITMY 300
             S+F  MR DGV PN+VTF+GLI+A+     +KEG  IHGLCIKT F+SEPSV N  IT+Y
Sbjct:   358 SIFLNMRFDGVYPNEVTFVGLINAVKCNEQIKEGLKIHGLCIKTGFVSEPSVGNSFITLY 417

Query:   301 ARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKESKPNAYTFGS 360
             A+FE+++D++K F++++ REIISWNA+ISG+AQNG S  A++ F     E+ PN YTFGS
Sbjct:   418 AKFEALEDAKKAFEDITFREIISWNAMISGFAQNGFSHEALKMFLSAAAETMPNEYTFGS 477

Query:   361 VLNAVGAAEDISLKHGQRCHSHIIKVGLDSDPIVGSALLDMYGKRGSIFESQRVFNETQE 420
             VLNA+  AEDIS+K GQRCH+H++K+GL+S P+V SALLDMY KRG+I ES++VFNE  +
Sbjct:   478 VLNAIAFAEDISVKQGQRCHAHLLKLGLNSCPVVSSALLDMYAKRGNIDESEKVFNEMSQ 537

Query:   421 KSEFAWTAIISALARHGDYESVMNQFKEMENKGVRPDSITFLSVLTVCGRNGMIHKGRHL 480
             K++F WT+IISA + HGD+E+VMN F +M  + V PD +TFLSVLT C R GM+ KG  +
Sbjct:   538 KNQFVWTSIISAYSSHGDFETVMNLFHKMIKENVAPDLVTFLSVLTACNRKGMVDKGYEI 597

Query:   481 FDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPGGPGLSVLQSLLGACRIHG 540
             F+ M++ Y++EPS +HYSCMVDMLGR GRL+EAEEL+ ++PGGPG S+LQS+LG+CR+HG
Sbjct:   598 FNMMIEVYNLEPSHEHYSCMVDMLGRAGRLKEAEELMSEVPGGPGESMLQSMLGSCRLHG 657

Query:   541 NVEMGERIADALMKMEPAGSGSYVLMSNLYAEKGDWEMVAILRKGMKSKGVRKEVGFSWA 600
             NV+MG ++A+  M+M+P  SGSYV M N+YAEK +W+  A +RK M+ K V KE GFSW 
Sbjct:   658 NVKMGAKVAELAMEMKPELSGSYVQMYNIYAEKEEWDKAAEIRKAMRKKNVSKEAGFSWI 717

Query:   601 DVGDIDG---LHGFSSGDNTHPRSEEIYRMAECLGSEM 635
             DVGD +G   + GFSSGD +HP+S+EIYRM E +G EM
Sbjct:   718 DVGDTEGSLTMQGFSSGDKSHPKSDEIYRMVEIIGLEM 755


GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2038603 AT2G27610 "AT2G27610" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2095289 AT3G09040 "AT3G09040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202074 CRR22 "CHLORORESPIRATORY REDUCTION22" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032840 AT1G16480 "AT1G16480" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118964 EMB2758 "embryo defective 2758" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178188 MEF7 "AT5G09950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2131939 MEF29 "AT4G30700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141171 AT4G21300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122551 AT4G39530 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q84MA3PP345_ARATHNo assigned EC number0.59400.97990.8322yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00016878001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (773 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query648
PLN03077857 PLN03077, PLN03077, Protein ECB2; Provisional 1e-144
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-80
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 9e-69
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 4e-43
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 8e-42
PLN03081697 PLN03081, PLN03081, pentatricopeptide (PPR) repeat 2e-29
PLN03077 857 PLN03077, PLN03077, Protein ECB2; Provisional 8e-09
pfam1304150 pfam13041, PPR_2, PPR repeat family 1e-06
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-06
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-06
pfam1304150 pfam13041, PPR_2, PPR repeat family 3e-06
PLN032181060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 7e-05
pfam1304150 pfam13041, PPR_2, PPR repeat family 8e-05
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 1e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 2e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-04
pfam0153531 pfam01535, PPR, PPR repeat 0.001
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.002
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 0.002
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
 Score =  439 bits (1130), Expect = e-144
 Identities = 218/645 (33%), Positives = 353/645 (54%), Gaps = 16/645 (2%)

Query: 1   MNMYCKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKS---DDALSFALRMNLIGVVFDA 57
           ++M+ + G+   A  +F  +   D+ SWN ++ G+ K+   D+AL    RM   GV  D 
Sbjct: 128 LSMFVRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDV 187

Query: 58  VTYSTALSFCLDHEGFLFGLQLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFDE 117
            T+   L  C        G ++H+ +V+FG + +V V NALITMY + G +V AR VFD 
Sbjct: 188 YTFPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDR 247

Query: 118 MPNKDSVSWNAILSGYTQDGDYGVEAILALIEMMRK-GLRLDHVSFTSAASACGHEKNLE 176
           MP +D +SWNA++SGY ++G+      L L   MR+  +  D ++ TS  SAC    +  
Sbjct: 248 MPRRDCISWNAMISGYFENGE--CLEGLELFFTMRELSVDPDLMTITSVISACELLGDER 305

Query: 177 LGKQIHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMISMNR 236
           LG+++HG  +K G+   VSV N L+  Y      G+A KVF RM  ++ +SWT MIS   
Sbjct: 306 LGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYE 365

Query: 237 -----EDAVSLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPS 291
                + A+  +  M  D V P+++T   ++ A +    +  G  +H L  +   +S   
Sbjct: 366 KNGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVV 425

Query: 292 VCNCLITMYARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKES 351
           V N LI MY++ + +  + +VF  +  +++ISW ++I+G   N     A+  F  ++   
Sbjct: 426 VANALIEMYSKCKCIDKALEVFHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQMLLTL 485

Query: 352 KPNAYTFGSVLNAVGAAEDISLKHGQRCHSHIIKVGLDSDPIVGSALLDMYGKRGSIFES 411
           KPN+ T  + L+A       +L  G+  H+H+++ G+  D  + +ALLD+Y + G +  +
Sbjct: 486 KPNSVTLIAALSACARIG--ALMCGKEIHAHVLRTGIGFDGFLPNALLDLYVRCGRMNYA 543

Query: 412 QRVFNETQEKSEFAWTAIISALARHGDYESVMNQFKEMENKGVRPDSITFLSVLTVCGRN 471
              FN + EK   +W  +++    HG     +  F  M   GV PD +TF+S+L  C R+
Sbjct: 544 WNQFN-SHEKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRS 602

Query: 472 GMIHKGRHLFDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPGGPGLSVLQS 531
           GM+ +G   F SM + Y I P+  HY+C+VD+LGR G+L EA   + ++P  P  +V  +
Sbjct: 603 GMVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGA 662

Query: 532 LLGACRIHGNVEMGERIADALMKMEPAGSGSYVLMSNLYAEKGDWEMVAILRKGMKSKGV 591
           LL ACRIH +VE+GE  A  + +++P   G Y+L+ NLYA+ G W+ VA +RK M+  G+
Sbjct: 663 LLNACRIHRHVELGELAAQHIFELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGL 722

Query: 592 RKEVGFSWADVGDIDGLHGFSSGDNTHPRSEEIYRMAECLGSEMK 636
             + G SW +V     +H F + D +HP+ +EI  + E    +MK
Sbjct: 723 TVDPGCSWVEVKGK--VHAFLTDDESHPQIKEINTVLEGFYEKMK 765


Length = 857

>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215563 PLN03081, PLN03081, pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|215561 PLN03077, PLN03077, Protein ECB2; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|144943 pfam01535, PPR, PPR repeat Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 648
PLN03077857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.94
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.92
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.89
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.84
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.83
PRK11788389 tetratricopeptide repeat protein; Provisional 99.82
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.81
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.8
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.79
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.78
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.77
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.77
PRK14574 822 hmsH outer membrane protein; Provisional 99.77
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.75
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.73
PRK14574 822 hmsH outer membrane protein; Provisional 99.72
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.67
KOG2003840 consensus TPR repeat-containing protein [General f 99.66
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.66
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.59
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.59
KOG2076895 consensus RNA polymerase III transcription factor 99.58
KOG2076 895 consensus RNA polymerase III transcription factor 99.58
KOG1126638 consensus DNA-binding cell division cycle control 99.56
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.56
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.56
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.53
KOG0547606 consensus Translocase of outer mitochondrial membr 99.5
KOG2003840 consensus TPR repeat-containing protein [General f 99.5
KOG1915677 consensus Cell cycle control protein (crooked neck 99.48
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.47
KOG1126638 consensus DNA-binding cell division cycle control 99.44
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.44
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.44
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.42
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.39
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.38
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.36
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.35
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.34
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.34
PF1304150 PPR_2: PPR repeat family 99.33
PF1304150 PPR_2: PPR repeat family 99.32
KOG0547606 consensus Translocase of outer mitochondrial membr 99.29
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.29
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.27
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.24
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.24
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.2
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.19
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.17
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.16
PRK12370553 invasion protein regulator; Provisional 99.14
PRK11189296 lipoprotein NlpI; Provisional 99.1
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.09
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.09
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.09
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.09
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.08
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.07
PRK12370553 invasion protein regulator; Provisional 99.05
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.05
KOG2376652 consensus Signal recognition particle, subunit Srp 99.02
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.02
KOG1129478 consensus TPR repeat-containing protein [General f 99.0
KOG1129478 consensus TPR repeat-containing protein [General f 98.99
KOG3785557 consensus Uncharacterized conserved protein [Funct 98.95
PRK11189296 lipoprotein NlpI; Provisional 98.92
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.89
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.88
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.84
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.83
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.8
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.79
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.78
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.76
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.75
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.73
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.72
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.71
PRK15359144 type III secretion system chaperone protein SscB; 98.66
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.66
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.65
PRK10370198 formate-dependent nitrite reductase complex subuni 98.65
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.63
PF1285434 PPR_1: PPR repeat 98.63
KOG1125579 consensus TPR repeat-containing protein [General f 98.62
KOG2376 652 consensus Signal recognition particle, subunit Srp 98.62
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.61
PRK04841903 transcriptional regulator MalT; Provisional 98.61
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.61
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.59
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.58
PF1285434 PPR_1: PPR repeat 98.57
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.57
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.54
PRK15359144 type III secretion system chaperone protein SscB; 98.54
PRK10370198 formate-dependent nitrite reductase complex subuni 98.49
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.49
KOG1128 777 consensus Uncharacterized conserved protein, conta 98.48
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.46
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.45
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.4
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.39
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.38
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.37
KOG1128777 consensus Uncharacterized conserved protein, conta 98.36
KOG1125579 consensus TPR repeat-containing protein [General f 98.36
PRK04841903 transcriptional regulator MalT; Provisional 98.33
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.31
PLN02789320 farnesyltranstransferase 98.29
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.28
PLN02789320 farnesyltranstransferase 98.27
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.27
KOG4340 459 consensus Uncharacterized conserved protein [Funct 98.27
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 98.26
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.25
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.2
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.19
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.18
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.17
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.16
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.13
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.12
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.11
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.08
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.07
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.07
PF1381234 PPR_3: Pentatricopeptide repeat domain 98.05
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.03
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.0
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.96
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.92
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.91
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.88
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.88
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.84
KOG0553304 consensus TPR repeat-containing protein [General f 97.83
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.82
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.82
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.79
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.79
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.78
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.77
KOG1914656 consensus mRNA cleavage and polyadenylation factor 97.76
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.74
PRK15331165 chaperone protein SicA; Provisional 97.73
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.73
COG4235287 Cytochrome c biogenesis factor [Posttranslational 97.69
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.67
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.65
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.63
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.56
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.55
KOG0553304 consensus TPR repeat-containing protein [General f 97.5
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.5
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.46
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.45
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.45
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.43
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.43
PF1337173 TPR_9: Tetratricopeptide repeat 97.42
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.42
PF1343134 TPR_17: Tetratricopeptide repeat 97.4
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.38
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.37
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.35
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.34
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.34
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.33
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.31
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.3
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.2
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.2
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.18
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.17
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.16
PF12688120 TPR_5: Tetratrico peptide repeat 97.12
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.09
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.09
COG3898531 Uncharacterized membrane-bound protein [Function u 97.03
PF1342844 TPR_14: Tetratricopeptide repeat 97.0
COG4700251 Uncharacterized protein conserved in bacteria cont 96.97
PF12688120 TPR_5: Tetratrico peptide repeat 96.97
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.93
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.93
PF1337173 TPR_9: Tetratricopeptide repeat 96.92
PRK10803263 tol-pal system protein YbgF; Provisional 96.92
PRK10803263 tol-pal system protein YbgF; Provisional 96.91
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.9
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.87
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.83
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.74
COG4700251 Uncharacterized protein conserved in bacteria cont 96.7
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.68
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.68
KOG20411189 consensus WD40 repeat protein [General function pr 96.57
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.53
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.49
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.38
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.38
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 96.38
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.37
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.35
PRK11906458 transcriptional regulator; Provisional 96.3
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.3
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.3
COG3898531 Uncharacterized membrane-bound protein [Function u 96.29
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.28
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.13
PF13512142 TPR_18: Tetratricopeptide repeat 95.96
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.85
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 95.85
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.74
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.74
KOG3941406 consensus Intermediate in Toll signal transduction 95.64
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.56
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.53
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.38
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.35
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.33
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 95.3
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 95.28
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.25
KOG3941406 consensus Intermediate in Toll signal transduction 95.24
KOG4555175 consensus TPR repeat-containing protein [Function 95.16
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 95.13
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.05
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.03
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 94.92
KOG2610 491 consensus Uncharacterized conserved protein [Funct 94.92
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 94.79
PRK11906458 transcriptional regulator; Provisional 94.73
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 94.71
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.69
KOG4555175 consensus TPR repeat-containing protein [Function 94.49
KOG1941 518 consensus Acetylcholine receptor-associated protei 94.35
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.34
PRK11619 644 lytic murein transglycosylase; Provisional 94.32
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 94.23
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 93.89
PRK15331165 chaperone protein SicA; Provisional 93.81
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.78
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 93.73
KOG4234271 consensus TPR repeat-containing protein [General f 93.7
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.59
smart00299140 CLH Clathrin heavy chain repeat homology. 93.34
smart00299140 CLH Clathrin heavy chain repeat homology. 93.21
COG4105254 ComL DNA uptake lipoprotein [General function pred 93.12
PF13512142 TPR_18: Tetratricopeptide repeat 93.1
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.99
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 92.96
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.87
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 92.77
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 92.72
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 92.64
PF13281374 DUF4071: Domain of unknown function (DUF4071) 92.46
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 92.45
COG3629280 DnrI DNA-binding transcriptional activator of the 92.33
KOG1585308 consensus Protein required for fusion of vesicles 92.3
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.27
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 92.12
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 92.0
KOG2610 491 consensus Uncharacterized conserved protein [Funct 91.94
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 91.75
KOG1258577 consensus mRNA processing protein [RNA processing 91.72
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.39
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.35
COG3947361 Response regulator containing CheY-like receiver a 91.15
PF13170297 DUF4003: Protein of unknown function (DUF4003) 91.02
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 90.98
KOG1941518 consensus Acetylcholine receptor-associated protei 90.85
COG0457291 NrfG FOG: TPR repeat [General function prediction 90.75
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.74
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.5
PF1342844 TPR_14: Tetratricopeptide repeat 90.47
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 90.42
PF14432116 DYW_deaminase: DYW family of nucleic acid deaminas 89.97
KOG20411189 consensus WD40 repeat protein [General function pr 89.94
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 89.76
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 89.39
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.2
KOG4570418 consensus Uncharacterized conserved protein [Funct 88.88
KOG4648 536 consensus Uncharacterized conserved protein, conta 88.85
PF1343134 TPR_17: Tetratricopeptide repeat 88.63
COG3629280 DnrI DNA-binding transcriptional activator of the 88.61
KOG4570418 consensus Uncharacterized conserved protein [Funct 88.4
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 88.32
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.21
PRK10941269 hypothetical protein; Provisional 88.21
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 87.68
KOG1586288 consensus Protein required for fusion of vesicles 87.59
COG4105254 ComL DNA uptake lipoprotein [General function pred 87.57
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.35
KOG1585308 consensus Protein required for fusion of vesicles 87.3
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 86.91
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 86.71
COG2976207 Uncharacterized protein conserved in bacteria [Fun 86.67
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 86.36
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 86.3
PRK09687280 putative lyase; Provisional 86.23
COG4649221 Uncharacterized protein conserved in bacteria [Fun 86.19
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 85.71
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 85.67
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 85.46
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 84.86
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 84.73
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 84.4
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 84.02
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 84.0
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 83.71
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 83.57
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 83.41
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 83.12
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 83.07
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 83.07
PF06552186 TOM20_plant: Plant specific mitochondrial import r 83.03
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 82.89
KOG4234271 consensus TPR repeat-containing protein [General f 82.73
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 82.53
KOG1550552 consensus Extracellular protein SEL-1 and related 81.98
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 81.45
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 81.39
PF13762145 MNE1: Mitochondrial splicing apparatus component 81.15
KOG1498 439 consensus 26S proteasome regulatory complex, subun 80.3
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 80.15
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.1e-109  Score=915.81  Aligned_cols=640  Identities=34%  Similarity=0.625  Sum_probs=628.9

Q ss_pred             CcccccCCChhHHHHHhhcCCCCCcchHHHHHHhhccCC---hHHHHHHHHHhCCCCCChhhHHHHHHHhhcccChhhHh
Q 006364            1 MNMYCKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKSD---DALSFALRMNLIGVVFDAVTYSTALSFCLDHEGFLFGL   77 (648)
Q Consensus         1 i~~~~~~g~~~~A~~~f~~~~~p~~~~~~~ll~~~~~~~---~a~~~~~~m~~~g~~~~~~~~~~ll~~~~~~~~~~~a~   77 (648)
                      |++|+++|++++|+++|++|++||+++||+||.+|++.+   +|+++|++|...|+.||.+||+.++++|+..+++..+.
T Consensus       128 i~~~~~~g~~~~A~~~f~~m~~~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t~~~ll~~~~~~~~~~~~~  207 (857)
T PLN03077        128 LSMFVRFGELVHAWYVFGKMPERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYTFPCVLRTCGGIPDLARGR  207 (857)
T ss_pred             HHHHHhCCChHHHHHHHhcCCCCCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHhCCccchhhHH
Confidence            357899999999999999999999999999999999999   99999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCCCcchHHHHHHHHHhCCChhHHHHHhccCCCCCcchHHHHHHHHHcCCCChHHHHHHHHHHHHCCCCC
Q 006364           78 QLHSLIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFDEMPNKDSVSWNAILSGYTQDGDYGVEAILALIEMMRKGLRL  157 (648)
Q Consensus        78 ~~~~~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~~a~~~~~~m~~~g~~p  157 (648)
                      ++|..+.+.|+.||+.++|+||++|+++|+++.|.++|++|++||.++||++|.+|++.| .+++|+++|.+|.+.|+.|
T Consensus       208 ~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~~d~~s~n~li~~~~~~g-~~~eAl~lf~~M~~~g~~P  286 (857)
T PLN03077        208 EVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPRRDCISWNAMISGYFENG-ECLEGLELFFTMRELSVDP  286 (857)
T ss_pred             HHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcCCCCCcchhHHHHHHHHhCC-CHHHHHHHHHHHHHcCCCC
Confidence            999999999999999999999999999999999999999999999999999999999999 9999999999999999999


Q ss_pred             ChhhHHHHHHHhcCCCChhHHHHHHHHHHHhcCCCCcchHHHHHHHHHhCCChHHHHHHHhcCCCCCchhhHHHhc----
Q 006364          158 DHVSFTSAASACGHEKNLELGKQIHGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFRRMHDRNVISWTTMIS----  233 (648)
Q Consensus       158 ~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~----  233 (648)
                      |..||+.+|.+|++.|+++.|.+++..+.+.|+.||..+||+||.+|+++|++++|.++|+.|..||+++||++|.    
T Consensus       287 d~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~d~~s~n~li~~~~~  366 (857)
T PLN03077        287 DLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEKVFSRMETKDAVSWTAMISGYEK  366 (857)
T ss_pred             ChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHHHHhhCCCCCeeeHHHHHHHHHh
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999998    


Q ss_pred             -CChhhHHHHHHHHHHCCCCCChhhHHHHHHHHhcCCchHHHHHHHHHHHHhcCCCCchhHHHHHHHHHhcCChHHHHHH
Q 006364          234 -MNREDAVSLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLITMYARFESMQDSEKV  312 (648)
Q Consensus       234 -g~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~  312 (648)
                       |++++|+++|++|...|+.||..||++++.+|++.|+++.|.++++.+.+.|+.|+..++++||++|+++|++++|.++
T Consensus       367 ~g~~~~A~~lf~~M~~~g~~Pd~~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~v  446 (857)
T PLN03077        367 NGLPDKALETYALMEQDNVSPDEITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEV  446 (857)
T ss_pred             CCCHHHHHHHHHHHHHhCCCCCceeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHH
Confidence             9999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhcCCCCcccHHHHHHHHHhcCCcHHHHHHHHHhHhCCCCCHHHHHHHHHHhccCchhhHHHHHHHHHHHHHhCCCCch
Q 006364          313 FDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKESKPNAYTFGSVLNAVGAAEDISLKHGQRCHSHIIKVGLDSDP  392 (648)
Q Consensus       313 ~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~p~~~~~~~ll~a~~~~~~~~~~~a~~~~~~~~~~~~~~~~  392 (648)
                      |++|.++|+++||++|.+|+++|+.++|+.+|++|..+++||..||++++.+|++.|  .++.+.++|..+.+.|+.++.
T Consensus       447 f~~m~~~d~vs~~~mi~~~~~~g~~~eA~~lf~~m~~~~~pd~~t~~~lL~a~~~~g--~l~~~~~i~~~~~~~g~~~~~  524 (857)
T PLN03077        447 FHNIPEKDVISWTSIIAGLRLNNRCFEALIFFRQMLLTLKPNSVTLIAALSACARIG--ALMCGKEIHAHVLRTGIGFDG  524 (857)
T ss_pred             HHhCCCCCeeeHHHHHHHHHHCCCHHHHHHHHHHHHhCCCCCHhHHHHHHHHHhhhc--hHHHhHHHHHHHHHhCCCccc
Confidence            999999999999999999999999999999999998899999999999999999999  999999999999999999999


Q ss_pred             hHHHHHHHHHhhcCCHHHHHHHHhhcCCCChhHHHHHHHHHHhCCChHHHHHHHHHHHHCCCCCCHHHHHHHHHHhcccC
Q 006364          393 IVGSALLDMYGKRGSIFESQRVFNETQEKSEFAWTAIISALARHGDYESVMNQFKEMENKGVRPDSITFLSVLTVCGRNG  472 (648)
Q Consensus       393 ~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~a~~~~g  472 (648)
                      .++|+|+++|+++|++++|.++|+.+ .+|+++||+||.+|+++|+.++|+++|++|.+.|++||..||+.++.+|++.|
T Consensus       525 ~~~naLi~~y~k~G~~~~A~~~f~~~-~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g  603 (857)
T PLN03077        525 FLPNALLDLYVRCGRMNYAWNQFNSH-EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSG  603 (857)
T ss_pred             eechHHHHHHHHcCCHHHHHHHHHhc-CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcC
Confidence            99999999999999999999999999 89999999999999999999999999999999999999999999999999999


Q ss_pred             cHHHHHHHHHHhHHhcCCCCChHHHHHHHHHHhhcCCHHHHHHHHhhCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHH
Q 006364          473 MIHKGRHLFDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPGGPGLSVLQSLLGACRIHGNVEMGERIADAL  552 (648)
Q Consensus       473 ~~~~a~~~~~~m~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~  552 (648)
                      ++++|.++|+.|.+++|+.|+..+|++|+++|++.|++++|.+++++|+.+||..+|++|+.+|+.+|+.+.|+.+.+++
T Consensus       604 ~v~ea~~~f~~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l  683 (857)
T PLN03077        604 MVTQGLEYFHSMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKMPITPDPAVWGALLNACRIHRHVELGELAAQHI  683 (857)
T ss_pred             hHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCChHHHHHHHHHH
Confidence            99999999999997889999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCCCchhHHHHHHHHHhcCCcHHHHHHHHHHhhCCCccCCceeEEEEcCCCceEEEecCCCCCcChHHHHHHHHHHH
Q 006364          553 MKMEPAGSGSYVLMSNLYAEKGDWEMVAILRKGMKSKGVRKEVGFSWADVGDIDGLHGFSSGDNTHPRSEEIYRMAECLG  632 (648)
Q Consensus       553 ~~~~p~~~~~~~~l~~~~~~~g~~~~a~~~~~~m~~~~~~~~~~~s~~~~~~~~~~~~f~~~~~~~~~~~~i~~~l~~l~  632 (648)
                      .+++|+++..|..|+++|+..|+|++|.++++.|+++|++|+||+|||+++  +++|.|++||.+||+.++||..|+.|.
T Consensus       684 ~~l~p~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~ie~~--~~~~~f~~~d~~h~~~~~i~~~l~~l~  761 (857)
T PLN03077        684 FELDPNSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVK--GKVHAFLTDDESHPQIKEINTVLEGFY  761 (857)
T ss_pred             HhhCCCCcchHHHHHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccEEEEC--CEEEEEecCCCCCcchHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999999999  999999999999999999999999999


Q ss_pred             HHhc-------------cchhhhhhhc
Q 006364          633 SEMK-------------YLNSKRERAI  646 (648)
Q Consensus       633 ~~~~-------------~~~~~~~~~~  646 (648)
                      .+|+             .++|+||+.+
T Consensus       762 ~~~~~~g~~~~~~~~~~~~~~~k~~~~  788 (857)
T PLN03077        762 EKMKASGLAGSESSSMDEIEVSKDDIF  788 (857)
T ss_pred             HHHHhCCcCCCcchhccccHHHHHHHH
Confidence            9987             2467777664



>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF14432 DYW_deaminase: DYW family of nucleic acid deaminases Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13762 MNE1: Mitochondrial splicing apparatus component Back     alignment and domain information
>KOG1498 consensus 26S proteasome regulatory complex, subunit RPN5/PSMD12 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query648
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-07
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 6e-06
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 5e-04
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 53.3 bits (126), Expect = 3e-07
 Identities = 29/245 (11%), Positives = 67/245 (27%), Gaps = 14/245 (5%)

Query: 351 SKPNAYTFGSVLNAVGAAEDISLKHGQRCHSHIIKVGLDSDPIVGSALLDMYGKRGSIFE 410
             P       +L    A   +SL   Q       +  L        A          +  
Sbjct: 88  ESPWEEQLARLLQE--APGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPL 145

Query: 411 SQRVFNETQEKSE-------FAWTAIISALARHGDYESVMNQFKEMENKGVRPDSITFLS 463
           +  +      + +         + A++   AR G ++ ++     +++ G+ PD +++ +
Sbjct: 146 AHHLLVVHHGQRQKRKLLTLDMYNAVMLGWARQGAFKELVYVLFMVKDAGLTPDLLSYAA 205

Query: 464 VLTVCGRNGMIHKG-RHLFDSMLKDYHIEPSPDHYSCMVDMLGRVGRLEEAEELVGQIPG 522
            L   GR            + M ++               +L    R    + +    P 
Sbjct: 206 ALQCMGRQDQDAGTIERCLEQMSQE----GLKLQALFTAVLLSEEDRATVLKAVHKVKPT 261

Query: 523 GPGLSVLQSLLGACRIHGNVEMGERIADALMKMEPAGSGSYVLMSNLYAEKGDWEMVAIL 582
                 L   +   ++  +V   +          P  +   +    L+ E      V  +
Sbjct: 262 FSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLHMELASRVCVVSV 321

Query: 583 RKGMK 587
            K   
Sbjct: 322 EKPTL 326


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query648
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 99.96
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.95
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.9
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.9
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.88
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.87
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.84
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.82
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.82
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.8
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.79
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.78
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.78
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.77
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.74
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.74
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.73
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.73
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.72
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.72
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.71
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.71
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.71
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.7
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.69
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.69
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.67
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.64
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.63
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.62
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.62
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.58
3u4t_A272 TPR repeat-containing protein; structural genomics 99.55
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.54
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.53
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.53
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.51
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.49
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.47
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.47
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.47
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.47
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.46
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.46
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.45
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.45
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.44
3u4t_A272 TPR repeat-containing protein; structural genomics 99.44
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.43
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.41
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.41
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.4
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.4
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.39
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.38
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.38
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.37
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.35
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.32
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.32
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.31
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.28
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.27
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.27
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.26
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.24
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.23
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.23
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.23
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.21
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.16
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.16
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.14
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.13
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.1
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.08
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.07
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.07
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.07
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.03
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.01
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.99
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.97
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.96
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.96
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.96
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.96
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.95
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.94
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.93
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.91
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.9
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.88
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.86
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.85
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.84
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.84
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.82
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.81
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.8
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.77
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.77
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.76
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.74
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.72
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.72
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.71
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.71
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.69
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.69
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.69
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.69
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.68
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.67
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.67
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.65
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.65
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.65
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.64
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.63
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.62
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.59
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.58
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.58
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.57
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.56
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.53
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.53
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.5
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.5
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.48
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.48
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.46
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.46
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.46
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.45
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.45
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.43
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.43
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.43
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.42
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.41
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.41
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.4
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.4
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.38
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.35
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.35
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.34
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.3
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.29
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.28
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.27
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.24
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.23
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.21
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.21
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.2
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.19
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.19
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.17
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.17
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.16
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.16
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.16
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.15
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.14
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.14
3k9i_A117 BH0479 protein; putative protein binding protein, 98.13
3k9i_A117 BH0479 protein; putative protein binding protein, 98.11
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.11
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.11
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.1
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.07
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.07
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.04
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.02
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.01
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.01
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.01
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.96
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.95
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.93
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.93
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.91
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.86
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.83
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.82
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.81
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.78
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.67
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.66
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.55
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.53
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.47
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.45
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.42
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.39
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.37
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.37
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.17
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.08
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.07
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.06
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.02
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.91
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 96.84
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.79
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.39
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 96.21
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.05
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.03
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.94
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.91
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.91
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.74
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 95.48
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.33
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.8
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.5
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 94.48
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 94.45
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 94.45
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.39
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.32
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.78
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.35
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.08
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 89.95
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 89.07
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 89.06
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 87.19
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 87.08
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 86.85
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 86.58
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 86.28
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 86.26
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 85.75
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 85.73
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 84.49
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 84.18
2uwj_G115 Type III export protein PSCG; virulence, chaperone 84.05
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 83.39
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 82.87
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 82.82
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 82.32
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 82.03
2p58_C116 Putative type III secretion protein YSCG; type III 81.88
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 80.57
2uwj_G115 Type III export protein PSCG; virulence, chaperone 80.43
2p58_C116 Putative type III secretion protein YSCG; type III 80.37
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=1.9e-40  Score=356.94  Aligned_cols=496  Identities=7%  Similarity=-0.063  Sum_probs=291.7

Q ss_pred             ccCCChhHHHHHhhcCCCCCcchHHHHHHhhccCC---hHHHHHHHHHhCCCCCChhhHHHHHHHhhcccChhhHhHHHH
Q 006364            5 CKSGQFDKALCIFNNLNNPDIVSWNTVLSGFEKSD---DALSFALRMNLIGVVFDAVTYSTALSFCLDHEGFLFGLQLHS   81 (648)
Q Consensus         5 ~~~g~~~~A~~~f~~~~~p~~~~~~~ll~~~~~~~---~a~~~~~~m~~~g~~~~~~~~~~ll~~~~~~~~~~~a~~~~~   81 (648)
                      .+.|.+..+...|+.++.+++..|+.++..|.+.+   +|+.+|++|..  ..|+..++..+..+|...|++++|..+++
T Consensus        64 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~--~~p~~~~~~~l~~~~~~~g~~~~A~~~~~  141 (597)
T 2xpi_A           64 STDGSFLKERNAQNTDSLSREDYLRLWRHDALMQQQYKCAAFVGEKVLD--ITGNPNDAFWLAQVYCCTGDYARAKCLLT  141 (597)
T ss_dssp             ------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHH--HHCCHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             cccCccCCCCCccccchHHHHHHHHHHHHHHHHccCchHHHHHHHHHHh--hCCCchHHHHHHHHHHHcCcHHHHHHHHH
Confidence            34566666777777777777778888888887777   77788887774  45677777778888888888888888877


Q ss_pred             HHHHhCCCCCcchHHHHHHHHHhCCChhHHHHHhccCCC-C------------------CcchHHHHHHHHHcCCCChHH
Q 006364           82 LIVKFGLDSEVYVGNALITMYSRWGRLVEARRVFDEMPN-K------------------DSVSWNAILSGYTQDGDYGVE  142 (648)
Q Consensus        82 ~~~~~g~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~-~------------------~~~~~~~li~~~~~~g~~~~~  142 (648)
                      .+...  ++++.+++.++.+|.+.|++++|.++|+++.. .                  ++.+|+.++.+|.+.| ++++
T Consensus       142 ~~~~~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g-~~~~  218 (597)
T 2xpi_A          142 KEDLY--NRSSACRYLAAFCLVKLYDWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLS-NFDR  218 (597)
T ss_dssp             HTCGG--GTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTT-CHHH
T ss_pred             HHhcc--ccchhHHHHHHHHHHHHhhHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcC-CHHH
Confidence            76543  56777788888888888888888888874332 2                  3667777777777777 7777


Q ss_pred             HHHHHHHHHHCCCCCC-hhhHHHHHHHhcCCCChhHHH--HH-HHHHHHhcCCCCcchHHHHHHHHHhCCChHHHHHHHh
Q 006364          143 AILALIEMMRKGLRLD-HVSFTSAASACGHEKNLELGK--QI-HGVSIKMGYGTHVSVGNVLMSTYSKCEVTGDANKVFR  218 (648)
Q Consensus       143 a~~~~~~m~~~g~~p~-~~t~~~ll~~~~~~~~~~~a~--~~-~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~  218 (648)
                      |++.|++|.+.+  |+ ...+..+...+...+..+.+.  .+ +..+...+..+...+|+.++.+|.+.|++++|.++|+
T Consensus       219 A~~~~~~~~~~~--p~~~~~~~~l~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~  296 (597)
T 2xpi_A          219 AKECYKEALMVD--AKCYEAFDQLVSNHLLTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLS  296 (597)
T ss_dssp             HHHHHHHHHHHC--TTCHHHHHHHHHTTCSCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHhC--chhhHHHHHHHHhhcccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHH
Confidence            777777776643  33 233333333333222211111  11 2222222223333344444445555555555544444


Q ss_pred             cCCCCCchhhHHHhcCChhhHHHHHHHHHHCCCCCChhhHHHHHHHHhcCCchHHHHHHHHHHHHhcCCCCchhHHHHHH
Q 006364          219 RMHDRNVISWTTMISMNREDAVSLFKEMRLDGVCPNDVTFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLIT  298 (648)
Q Consensus       219 ~~~~~~~~~~~~li~g~~~~a~~~~~~m~~~g~~p~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~  298 (648)
                      .+.+                          .  .++..+++.++.++.+.|++++|..+++.+.+.+ +           
T Consensus       297 ~~~~--------------------------~--~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~-----------  336 (597)
T 2xpi_A          297 SING--------------------------L--EKSSDLLLCKADTLFVRSRFIDVLAITTKILEID-P-----------  336 (597)
T ss_dssp             TSTT--------------------------G--GGCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-T-----------
T ss_pred             Hhhc--------------------------C--CchHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcC-c-----------
Confidence            4431                          0  1233344444444444444444444444443332 1           


Q ss_pred             HHHhcCChHHHHHHHhhcCCCCcccHHHHHHHHHhcCCcHHHHHHHHHhHhCCCCCHHHHHHHHHHhccCchhhHHHHHH
Q 006364          299 MYARFESMQDSEKVFDELSCREIISWNALISGYAQNGLSLAAVQAFFGVIKESKPNAYTFGSVLNAVGAAEDISLKHGQR  378 (648)
Q Consensus       299 ~~~~~g~~~~a~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~p~~~~~~~ll~a~~~~~~~~~~~a~~  378 (648)
                                          .+..+|+.++.++.+.|++++|..+|+++....+.+..++..+...+.+.|  ++++|..
T Consensus       337 --------------------~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g--~~~~A~~  394 (597)
T 2xpi_A          337 --------------------YNLDVYPLHLASLHESGEKNKLYLISNDLVDRHPEKAVTWLAVGIYYLCVN--KISEARR  394 (597)
T ss_dssp             --------------------TCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTSHHHHHHHHHHHHHTT--CHHHHHH
T ss_pred             --------------------ccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHhc--cHHHHHH
Confidence                                233445555555555555555555555554433334444444444444444  4555555


Q ss_pred             HHHHHHHhCCCCchhHHHHHHHHHhhcCCHHHHHHHHhhcCC---CChhHHHHHHHHHHhCCChHHHHHHHHHHHHCCCC
Q 006364          379 CHSHIIKVGLDSDPIVGSALLDMYGKRGSIFESQRVFNETQE---KSEFAWTAIISALARHGDYESVMNQFKEMENKGVR  455 (648)
Q Consensus       379 ~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~---~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~  455 (648)
                      ++..+.+.. +.+..+++.++.+|.+.|++++|.++|+++.+   .+..+|+.++.+|.+.|++++|+++|++|.+.. +
T Consensus       395 ~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~  472 (597)
T 2xpi_A          395 YFSKSSTMD-PQFGPAWIGFAHSFAIEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYALF-Q  472 (597)
T ss_dssp             HHHHHHHHC-TTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC-C
T ss_pred             HHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-C
Confidence            555444432 23455666677777777777777777766542   356677777777777777777777777777642 3


Q ss_pred             CCHHHHHHHHHHhcccCcHHHHHHHHHHhHHhc---CCCCC--hHHHHHHHHHHhhcCCHHHHHHHHhhCC--CCCCHHH
Q 006364          456 PDSITFLSVLTVCGRNGMIHKGRHLFDSMLKDY---HIEPS--PDHYSCMVDMLGRVGRLEEAEELVGQIP--GGPGLSV  528 (648)
Q Consensus       456 p~~~t~~~ll~a~~~~g~~~~a~~~~~~m~~~~---~~~p~--~~~~~~l~~~~~~~g~~~~A~~~~~~~~--~~~~~~~  528 (648)
                      .+..+|+.+...|.+.|++++|.++|+++.+..   +..|+  ..+|..++.+|.+.|++++|.+.++++.  .+.+..+
T Consensus       473 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~  552 (597)
T 2xpi_A          473 YDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANV  552 (597)
T ss_dssp             CCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHH
T ss_pred             CChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHH
Confidence            356777777777777777777777777775432   45666  6677777777777777777777777654  3346777


Q ss_pred             HHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCchhHHHHHHHHH
Q 006364          529 LQSLLGACRIHGNVEMGERIADALMKMEPAGSGSYVLMSNLYA  571 (648)
Q Consensus       529 ~~~l~~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l~~~~~  571 (648)
                      |..+..+|...|++++|.+.++++++++|+++..+..++++|.
T Consensus       553 ~~~l~~~~~~~g~~~~A~~~~~~~l~~~p~~~~~~~~l~~~~~  595 (597)
T 2xpi_A          553 HTAIALVYLHKKIPGLAITHLHESLAISPNEIMASDLLKRALE  595 (597)
T ss_dssp             HHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHhCCHHHHHHHHHHHHhcCCCChHHHHHHHHHHh
Confidence            7777777777888888888888888878877777777777764



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query648
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.87
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.87
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.54
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.51
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.06
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.02
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.0
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.94
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.94
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.93
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.91
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.88
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.85
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.66
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.62
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.55
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.54
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.53
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.51
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.5
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.47
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.45
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.4
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.4
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.28
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.15
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.14
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.14
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.12
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.11
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.1
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.1
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.09
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.05
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.02
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.01
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.95
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.81
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.81
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.77
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.71
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.62
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.61
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 97.53
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.44
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.44
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.43
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.41
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.21
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.15
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.15
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.14
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.59
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 96.4
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.24
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.02
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.98
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 92.85
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 90.68
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 85.19
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 82.89
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87  E-value=4.4e-19  Score=176.44  Aligned_cols=310  Identities=10%  Similarity=0.065  Sum_probs=220.4

Q ss_pred             hHHHHHHHHhcCCchHHHHHHHHHHHHhcCCCCchhHHHHHHHHHhcCChHHHHHHHhhc---CCCCcccHHHHHHHHHh
Q 006364          257 TFIGLIHAISIGNLVKEGRMIHGLCIKTNFLSEPSVCNCLITMYARFESMQDSEKVFDEL---SCREIISWNALISGYAQ  333 (648)
Q Consensus       257 ~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~~---~~~~~~~~~~li~~~~~  333 (648)
                      ++..+...+...|++++|...+....+... .+..............+....+.......   .................
T Consensus        69 a~~~l~~~~~~~g~~~~A~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  147 (388)
T d1w3ba_          69 AYSNLGNVYKERGQLQEAIEHYRHALRLKP-DFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKA  147 (388)
T ss_dssp             HHHHHHHHHHHHTCHHHHHHHHHHHHHHCT-TCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCTHHHHHHHHHHHT
T ss_pred             HHHHHHHHhhhhcccccccccccccccccc-ccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            344444444445555555555554444331 22222222333333333333333322222   22233444445555666


Q ss_pred             cCCcHHHHHHHHHhHhCCCCCHHHHHHHHHHhccCchhhHHHHHHHHHHHHHhCCCCchhHHHHHHHHHhhcCCHHHHHH
Q 006364          334 NGLSLAAVQAFFGVIKESKPNAYTFGSVLNAVGAAEDISLKHGQRCHSHIIKVGLDSDPIVGSALLDMYGKRGSIFESQR  413 (648)
Q Consensus       334 ~g~~~~A~~~~~~m~~~~~p~~~~~~~ll~a~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~  413 (648)
                      .+....+...+.......+.+...+..+...+...+  ..+.|...+....+.. +.+...+..+...|...|++++|..
T Consensus       148 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~--~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~  224 (388)
T d1w3ba_         148 LGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQG--EIWLAIHHFEKAVTLD-PNFLDAYINLGNVLKEARIFDRAVA  224 (388)
T ss_dssp             TSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTT--CHHHHHHHHHHHHHHC-TTCHHHHHHHHHHHHTTTCTTHHHH
T ss_pred             cchhhhhHHHHHHhhccCcchhHHHHhhcccccccC--cHHHHHHHHHHHHHhC-cccHHHHHHHhhhhhccccHHHHHH
Confidence            666677777666666544455666666667777777  7778888777777654 3355677788888899999999999


Q ss_pred             HHhhcCC---CChhHHHHHHHHHHhCCChHHHHHHHHHHHHCCCCCC-HHHHHHHHHHhcccCcHHHHHHHHHHhHHhcC
Q 006364          414 VFNETQE---KSEFAWTAIISALARHGDYESVMNQFKEMENKGVRPD-SITFLSVLTVCGRNGMIHKGRHLFDSMLKDYH  489 (648)
Q Consensus       414 ~~~~~~~---~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~-~~t~~~ll~a~~~~g~~~~a~~~~~~m~~~~~  489 (648)
                      .|+....   .+...|..+...+.+.|++++|+..|++..+.  .|+ ..++..+...+...|++++|.+.++.....  
T Consensus       225 ~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~--  300 (388)
T d1w3ba_         225 AYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIEL--QPHFPDAYCNLANALKEKGSVAEAEDCYNTALRL--  300 (388)
T ss_dssp             HHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHT--CSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHH--
T ss_pred             HHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhcc--
Confidence            8886553   46677888889999999999999999998874  454 577888888999999999999999988755  


Q ss_pred             CCCC-hHHHHHHHHHHhhcCCHHHHHHHHhhCC-CC-CCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcCCCCchhHHHH
Q 006364          490 IEPS-PDHYSCMVDMLGRVGRLEEAEELVGQIP-GG-PGLSVLQSLLGACRIHGNVEMGERIADALMKMEPAGSGSYVLM  566 (648)
Q Consensus       490 ~~p~-~~~~~~l~~~~~~~g~~~~A~~~~~~~~-~~-~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~~~~p~~~~~~~~l  566 (648)
                       .|+ ...+..+...+.+.|++++|.+.+++.. .. .+..+|..+..++...|++++|...++++++++|+++.+|..|
T Consensus       301 -~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~l  379 (388)
T d1w3ba_         301 -CPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNM  379 (388)
T ss_dssp             -CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHH
T ss_pred             -CCccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHH
Confidence             454 7888899999999999999999998854 33 4577888899999999999999999999999999999999999


Q ss_pred             HHHHHhcCC
Q 006364          567 SNLYAEKGD  575 (648)
Q Consensus       567 ~~~~~~~g~  575 (648)
                      +++|.+.||
T Consensus       380 g~~~~~~~D  388 (388)
T d1w3ba_         380 GNTLKEMQD  388 (388)
T ss_dssp             HHHHHHTCC
T ss_pred             HHHHHHcCC
Confidence            999998875



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure