Citrus Sinensis ID: 006372

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------65
MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDKGIWLASHKHVRKFRRIGIVPSMFPSGSSHMDATDIEPKHGNVTDVNSDEGLQQVEDVLTSADDLEEEVSDLPLERCMRLVPHDQNSGAFFIAVLQKVSPLPVVQEKHINPEEKMLPRNDDPPKKLQNQDTEEVNGMEVDLADGTDEKDPEGSLEANSIDNEDGAAVEPDPLTCEKVDSEETEVPVNTETKSERTGGKRKLQIQGKWKGIDPVIFFNDETIINSIKTFYGIDDSFQLSGQLVSRNGDTNRVKRIYYVSKSVKDALDLNFRVGQQLKITSVGLKMFERQTSREGNSAPCSFRISSEGLPVILPYITKQILYASLVDFKHLLQYKTIKFADFVDAEFGEKASKLMMGCCVIVLSKGGEALSNPIQIDASTIAIGCWKGRASLSVMVTAIDCQELLERLLMRLEIEKGDLVQENALGTDEVQEEMNDNGKEEPESLEVAVNT
cccccccHHHHHHHHHHccccccccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEccccccccccccccccccccccccccccccccccccEEEEcccccccccccccHHHHHcccccccccHHHHHHHHHHHHHHccccccEEEEEcccccccccHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccEEEEccccccccEEEEEcHHHHHHHHHccccccccEEEEEEEEEEEEEcccccccccccEEEccccHHHHHccccccEEEEcHHHHHHHHHcccccccccccHHHHHHHHccccccEEEEEEcccccccccccccccEEEEEEEEcccEEEEEccHHHHHHHHHHHHHHHHHcccccHHHccccccHHHHHcccccccccccccccccc
cccccccHHHHHHHHHHccccccccccEEEEEEcccHHHHHHHHHHHHccccccEEEEEccccccccEEccccccccccccccccccccEEEEcEEEEcccccccccccccccHHHcccccccccHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHccccEEEEEcccccccccccccccEEEEEcccccEccHccccHcccccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHHHccHHHHEEEcccccccccEEEEEEEEccccccccccccccccccccccccccHHcccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccEEEccccccHHHHHHHccccccccccccEEEEcccccccEEEEEEcHHHHHHHHHccccccEEEEEEccEEEEEEccccccccccccEEEcHccHHHEHHHccccEEEEcHHHHHHHHHHcccccHHcccHHHHHHHHHccccEEEEEEccccccccccccccccEEEEEEEccccEEEEEccHHHHHHHHHHHHccccHHHcccccHHHcccccccHHHccccccccccccccccc
mcaapgsktFQLLEIIHqstnpgalpngmviandldvQRCNLLIHQTKRMCTANlivtnheaqhfpgcranknfssasdkgiesesnMGQLLFDRVlcdvpcsgdgtlrkapdiwrkwnvglgngLHSLQVQIAMRGISLLKVGGRIvystcsmnpveNEAVVAEILRKCEgsvelvdvsnevpqlihrpglrkwkvrdkGIWLASHKHVRKFRrigivpsmfpsgsshmdatdiepkhgnvtdvnsdegLQQVEDVLTSADDLeeevsdlplercmrlvphdqnsGAFFIAVLQkvsplpvvqekhinpeekmlprnddppkklqnqdteevngmevdladgtdekdpegsleansidnedgaavepdpltcekvdseetevpvntetksertggkrklqiqgkwkgidpviffndetIINSIktfygiddsfqlsgqlvsrngdtnrvKRIYYVSKSVKDALDLNFRVGQQLKITSVGLKMFerqtsregnsapcsfrisseglpvilpyITKQILYASLVDFKHLLQYKTIKFADFVDAEFGEKASKLMMGCCVIVLSkggealsnpiqidasTIAIGCWKGRASLSVMVTAIDCQELLERLLMRLEIEkgdlvqenalgtdEVQEEMndngkeepesLEVAVNT
MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDgtlrkapdiwRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVelvdvsnevpqlihrpglrkwkvrdKGIWLashkhvrkfrriGIVPSMFPSGSSHMDATDIEPKHGNVTDVNSDEGLQQVEDVLTSADDLEEEVSDLPLERCMRLVPHDQNSGAFFIAVLQKVSPLPVVQEKhinpeekmlprnddppkklqnqdteevNGMEVDLADGTDEKDPEGSLeansidnedgaavepdpltcekvdseetevpvntetksertggkrklqiqgkwkgidpvIFFNDETIINSIKTFYGIDDSFQLSgqlvsrngdtnrvKRIYYVSKsvkdaldlnfrvgQQLKITSVGLKMFerqtsregnsapcsfriSSEGLPVILPYITKQILYASLVDFKHLLQYKTIKFADFVDAEFGEKASKLMMGCCVIVLSKGGEALSNPIQIDASTIAIGCWKGRASLSVMVTAIDCQELLERLLMRLEIEKGDLVQENALGTDEVQEemndngkeepeslevavnt
MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDKGIWLASHKHVRKFRRIGIVPSMFPSGSSHMDATDIEPKHGNVTDVNSDEGLQQVEDVLTSADDLEEEVSDLPLERCMRLVPHDQNSGAFFIAVLQKVSPLPVVQEKHINPEEKMLPRNDDPPKKLQNQDTEEVNGMEVDLADGTDEKDPEGSLEANSIDNEDGAAVEPDPLTCEKVDSEETEVPVNTETKSERTGGKRKLQIQGKWKGIDPVIFFNDETIINSIKTFYGIDDSFQLSGQLVSRNGDTNRVKRIYYVSKSVKDALDLNFRVGQQLKITSVGLKMFERQTSREGNSAPCSFRISSEGLPVILPYITKQILYASLVDFKHLLQYKTIKFADFVDAEFGEKASKLMMGCCVIVLSKGGEALSNPIQIDASTIAIGCWKGRASLSVMVTAIDCQellerllmrleieKGDLVQENALGTDEVQEEMNDNGKEEPESLEVAVNT
*********FQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGC********************GQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDKGIWLASHKHVRKFRRIGIVPS***************************************************LERCMRLVPHDQNSGAFFIAVLQKVSPLPVV************************************************************************************************LQIQGKWKGIDPVIFFNDETIINSIKTFYGIDDSFQLSGQLVSRNGDTNRVKRIYYVSKSVKDALDLNFRVGQQLKITSVGLKMFE***********CSFRISSEGLPVILPYITKQILYASLVDFKHLLQYKTIKFADFVDAEFGEKASKLMMGCCVIVLSKGGEALSNPIQIDASTIAIGCWKGRASLSVMVTAIDCQELLERLLMRLEIEKGDLV*******************************
MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDKGIWLASHKHVRKFRRIGIVPSMF**********DIEPKHGNVTDVN**EGLQQVEDVLTSADDLEEEVSDLPLERCMRLVPHDQNSGAFFIA*******************************************************************************************************************GIDPVIFFNDETIINSIKTFYGIDDSFQLSGQLVSRNGDTNRVKRIYYVSKSVKDALDLNFRVGQQLKITSVGLKMFERQTSREGNSAPCSFRISSEGLPVILPYITKQILYASLVDFKHLLQYKTIKFADF********ASKLMMGCCVIVLSKGGEALSNPIQIDASTIAIGCWKGRASLSVMVTAIDCQELLERLLMR****************************************
MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDKGIWLASHKHVRKFRRIGIVPSMFPSGSSHMDATDIEPKHGNVTDVNSDEGLQQVEDVLTSADDLEEEVSDLPLERCMRLVPHDQNSGAFFIAVLQKVSPLPVVQEKHINPEEKMLPRNDDPPKKLQNQDTEEVNGMEVDLADGTDEKDPEGSLEANSIDNEDGAAVEPDPLTCEK*************************QIQGKWKGIDPVIFFNDETIINSIKTFYGIDDSFQLSGQLVSRNGDTNRVKRIYYVSKSVKDALDLNFRVGQQLKITSVGLKMFERQ********PCSFRISSEGLPVILPYITKQILYASLVDFKHLLQYKTIKFADFVDAEFGEKASKLMMGCCVIVLSKGGEALSNPIQIDASTIAIGCWKGRASLSVMVTAIDCQELLERLLMRLEIEKGDLVQENALGTDE**********************
********TFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKN************SNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDKGIWLASHKHVRKFRR*GIVPSMFPS************************************DDLEEEVSDLPLERCMRLVPHDQNSGAFFIAVLQKVSPL*******************************************************************************************************GKWKGIDPVIFFNDETIINSIKTFYGIDDSFQLSGQLVSRNGDTNRVKRIYYVSKSVKDALDLNFRVGQQLKITSVGLKMFERQTSREGNSAPCSFRISSEGLPVILPYITKQILYASLVDFKHLLQYKTIKFADFVDAEFGEKASKLMMGCCVIVLSKGGEALSNPIQIDASTIAIGCWKGRASLSVMVTAIDCQELLERLLMRLEIE************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDKGIWLASHKHVRKFRRIGIVPSMFPSGSSHMDATDIEPKHGNVTDVNSDEGLQQVEDVLTSADDLEEEVSDLPLERCMRLVPHDQNSGAFFIAVLQKVSPLPVVQEKHINPEEKMLPRNDDPPKKLQNQDTEEVNGMEVDLADGTDEKDPEGSLEANSIDNEDGAAVEPDPLTCEKVDSEETEVPVNTETKSERTGGKRKLQIQGKWKGIDPVIFFNDETIINSIKTFYGIDDSFQLSGQLVSRNGDTNRVKRIYYVSKSVKDALDLNFRVGQQLKITSVGLKMFERQTSREGNSAPCSFRISSEGLPVILPYITKQILYASLVDFKHLLQYKTIKFADFVDAEFGEKASKLMMGCCVIVLSKGGEALSNPIQIDASTIAIGCWKGRASLSVMVTAIDCxxxxxxxxxxxxxxxxxxxxxNALGTDEVQEEMNDNGKEEPESLEVAVNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query648 2.2.26 [Sep-21-2011]
Q28E61798 tRNA (cytosine(34)-C(5))- yes no 0.850 0.690 0.326 3e-82
Q5ZLV4796 tRNA (cytosine(34)-C(5))- yes no 0.768 0.625 0.327 2e-80
Q08J23767 tRNA (cytosine(34)-C(5))- yes no 0.819 0.692 0.331 2e-79
Q1HFZ0757 tRNA (cytosine(34)-C(5))- yes no 0.839 0.718 0.319 8e-79
Q4V7N2698 tRNA (cytosine(34)-C(5))- N/A no 0.794 0.737 0.324 3e-78
O13935685 Multisite-specific tRNA:( yes no 0.743 0.703 0.311 3e-66
Q9W4M9746 tRNA (cytosine(34)-C(5))- yes no 0.608 0.528 0.328 2e-65
Q9HGQ2688 Multisite-specific tRNA:( no no 0.762 0.718 0.304 1e-64
P38205684 Multisite-specific tRNA:( yes no 0.370 0.350 0.417 1e-60
Q9V106311 tRNA (cytosine(49)-C(5))- yes no 0.231 0.482 0.324 5e-17
>sp|Q28E61|NSUN2_XENTR tRNA (cytosine(34)-C(5))-methyltransferase OS=Xenopus tropicalis GN=nsun2 PE=2 SV=1 Back     alignment and function desciption
 Score =  306 bits (784), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 216/661 (32%), Positives = 334/661 (50%), Gaps = 110/661 (16%)

Query: 1   MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNH 60
           MCAAPGSKT Q++E++H   N    P G VIAND+D +RC LL+HQ KR+ +  ++V NH
Sbjct: 185 MCAAPGSKTAQIIEMLHADMN-VPFPEGFVIANDVDNKRCYLLVHQAKRLNSPCIMVVNH 243

Query: 61  EAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNV 120
           +A   P      N S               L +DR+LCDVPCSGDGTLRK  D+W+KW  
Sbjct: 244 DASSIPRLLVENNGSREV------------LYYDRILCDVPCSGDGTLRKNIDVWKKWTT 291

Query: 121 GLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVS 180
                LH LQ++IA RG+  L  GGR+VYSTCS+NPVE+EAV+A +L K EGS+EL DV+
Sbjct: 292 LNSLQLHGLQIRIATRGVEQLAEGGRMVYSTCSLNPVEDEAVIASLLDKSEGSLELADVA 351

Query: 181 NEVPQLIHRPGLRKWKVRDK-GIWLASHKHVRKFRRIGIVPSMFPSGSSHMDATDIEPKH 239
           +E+P L   PG+ +WKV  K G W    + +   R   I P+MFP            PK 
Sbjct: 352 SEIPGLKWMPGITQWKVMTKEGHWYEKWEDIPTSRHTQIRPTMFP------------PKD 399

Query: 240 GNVTDVNSDEGLQQVEDVLTSADDLEEEVSDLPLERCMRLVPHDQNSGAFFIAVLQKVSP 299
                                    EE++  + L RCMR++PH QN+G FF+AVL K +P
Sbjct: 400 -------------------------EEKLKSMNLNRCMRILPHHQNTGGFFVAVLIKKAP 434

Query: 300 LPVVQEKHINPEEKMLPRNDDPPKKLQNQDTEEVNGMEVDLADGTDEKDPEGSLEANSID 359
           +P       N  +  L R   PP               V   D +    PE  L     +
Sbjct: 435 MP------WNKRQPKLQRR--PP---------------VSACDASIAVAPE--LVKAVTE 469

Query: 360 NEDGAAVEPDPLTCEKVDSEETEV-PVNTETKSERTG------GKRKLQIQGKWKGIDPV 412
           N  G A EP       VD+E  E  P   ++ S +T         +K+++ G  +  DP 
Sbjct: 470 NSAGMADEP------AVDTENGETKPCTNQSDSSKTDIVCCPPPSKKMKLFGFKE--DPF 521

Query: 413 IFFN-DETIINSIKTFYGIDDSFQLSGQLVSRNGDTNRVKRIYYVSKSVKDALDLNFRVG 471
           +F + D+ I + I+TFY +D SF     L++R  +  + +++Y VSK +++ L  N    
Sbjct: 522 VFVSEDDPIFDPIQTFYALDPSFP-KKNLLTRTQEGKK-RQLYMVSKELRNVLLHN---S 576

Query: 472 QQLKITSVGLKMFERQTSREGNSAPCSFRISSEGLPVILPYITKQILYASLVDFKHLLQY 531
           +++K+ + G+K+  R  + +G    C++R++ EG+  + P+I  +I+  S+ D K LL  
Sbjct: 577 EKMKVINTGIKVLCR--NNDGEQYGCAYRLAQEGIYTLYPFINARIVTVSIEDIKVLLTQ 634

Query: 532 KTIKFADFVDAEFGEKASKLMMGCCVIVLSKGGEALSNPIQIDASTIAIGCWKGRASLSV 591
           +    + F   E  ++A+   MG  V+      +    P  +    +  G W+G+ S+  
Sbjct: 635 ENPFLSKF-SKETQKQANNFDMGSIVLKYEPDPQ---EPETLQCPIVLCG-WRGKTSIRS 689

Query: 592 MVTAIDCQELLERLLMRLEIEKGDLVQE-----NALGTDEVQEEMNDNGKEEPESLEVAV 646
            V   +    L  + + +  EK +++++      A   + + E+M+ +G +E ES E++ 
Sbjct: 690 FVPKNERLHYLRMMGVEVFKEKAEVLEKKPVEGKACDEEHIDEKMDIDGAKE-ESKELSG 748

Query: 647 N 647
           N
Sbjct: 749 N 749
RNA methyltransferase that methylates tRNAs, and possibly RNA polymerase III transcripts. Methylates cytosine to 5-methylcytosine (m5C) at position 34 of intron-containing tRNA(Leu)(CAA) precursors.
Xenopus tropicalis (taxid: 8364)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 0EC: 3
>sp|Q5ZLV4|NSUN2_CHICK tRNA (cytosine(34)-C(5))-methyltransferase OS=Gallus gallus GN=NSUN2 PE=2 SV=1 Back     alignment and function description
>sp|Q08J23|NSUN2_HUMAN tRNA (cytosine(34)-C(5))-methyltransferase OS=Homo sapiens GN=NSUN2 PE=1 SV=2 Back     alignment and function description
>sp|Q1HFZ0|NSUN2_MOUSE tRNA (cytosine(34)-C(5))-methyltransferase OS=Mus musculus GN=Nsun2 PE=1 SV=2 Back     alignment and function description
>sp|Q4V7N2|NSUN2_XENLA tRNA (cytosine(34)-C(5))-methyltransferase OS=Xenopus laevis GN=nsun2 PE=2 SV=1 Back     alignment and function description
>sp|O13935|TRM4B_SCHPO Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm4b PE=3 SV=2 Back     alignment and function description
>sp|Q9W4M9|NSUN2_DROME tRNA (cytosine(34)-C(5))-methyltransferase OS=Drosophila melanogaster GN=CG6133 PE=2 SV=1 Back     alignment and function description
>sp|Q9HGQ2|TRM4A_SCHPO Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm4a PE=1 SV=3 Back     alignment and function description
>sp|P38205|NCL1_YEAST Multisite-specific tRNA:(cytosine-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCL1 PE=1 SV=1 Back     alignment and function description
>sp|Q9V106|TRCM_PYRAB tRNA (cytosine(49)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB06230 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query648
255581738 843 conserved hypothetical protein [Ricinus 0.983 0.755 0.706 0.0
297741823 837 unnamed protein product [Vitis vinifera] 0.979 0.758 0.679 0.0
147811154 906 hypothetical protein VITISV_039256 [Viti 0.979 0.700 0.679 0.0
359480502 834 PREDICTED: tRNA (cytosine(34)-C(5))-meth 0.975 0.757 0.678 0.0
224093730 799 predicted protein [Populus trichocarpa] 0.933 0.757 0.673 0.0
356525455 820 PREDICTED: tRNA (cytosine(34)-C(5))-meth 0.925 0.731 0.645 0.0
449451413 812 PREDICTED: tRNA (cytosine(34)-C(5))-meth 0.907 0.724 0.630 0.0
449496414 812 PREDICTED: tRNA (cytosine(34)-C(5))-meth 0.907 0.724 0.628 0.0
356538146 810 PREDICTED: tRNA (cytosine(34)-C(5))-meth 0.939 0.751 0.624 0.0
297825119 838 hypothetical protein ARALYDRAFT_320078 [ 0.915 0.707 0.594 0.0
>gi|255581738|ref|XP_002531671.1| conserved hypothetical protein [Ricinus communis] gi|223528702|gb|EEF30715.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  912 bits (2358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/650 (70%), Positives = 533/650 (82%), Gaps = 13/650 (2%)

Query: 1   MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNH 60
           MCAAPGSKTFQLLEII+QST PG+LPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTN+
Sbjct: 201 MCAAPGSKTFQLLEIIYQSTKPGSLPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNN 260

Query: 61  EAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNV 120
           EAQHFPGCRANK+ + AS+  IE E  +GQLLFDRVLCDVPCSGDGTLRKAPD+WRKWN 
Sbjct: 261 EAQHFPGCRANKSCTKASE--IEFEPPIGQLLFDRVLCDVPCSGDGTLRKAPDLWRKWNS 318

Query: 121 GLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVS 180
           G+GNGLH LQ+QIAMRG+SLLKVGGR+VYSTCSMNPVENEAVVAEILRKC GSVEL++VS
Sbjct: 319 GMGNGLHVLQIQIAMRGMSLLKVGGRMVYSTCSMNPVENEAVVAEILRKCGGSVELLNVS 378

Query: 181 NEVPQLIHRPGLRKWKVRDKGIWLASHKHVRKFRRIGIVPSMFPSGSSHMDATDIEPKHG 240
           +E+PQL+ RPGLRKWKVRDKGIWL+SHK V KFRR GI+PSMFPSG S++   + + KH 
Sbjct: 379 SELPQLVRRPGLRKWKVRDKGIWLSSHKDVSKFRRYGILPSMFPSGRSYVAPAESDHKHE 438

Query: 241 NVTDVNSDEGLQQVEDVLTSADDLEEEVSDLPLERCMRLVPHDQNSGAFFIAVLQKVSPL 300
           N  +  S++  + +ED + S +D  EEVSDLPLERCMR+VPHDQNSGAFFIAV  K+SPL
Sbjct: 439 NGGNKISED--EPMEDPMAS-EDSNEEVSDLPLERCMRIVPHDQNSGAFFIAVFHKLSPL 495

Query: 301 PVVQEKHINPEEK-MLPRNDDPPKKLQNQDTEEVNGMEVDLADGTDEKDPEGSLEANSID 359
           PV+ EK   P  +  L R  +P +K  +QDTE  NG+E+   +   E+ PE + EA+ I+
Sbjct: 496 PVIPEK---PSRRGNLNRKHEPQEKSLDQDTEGNNGVELKSEEAAAERFPEAASEADLIE 552

Query: 360 NE-DGAAVEPDPL-TCEKVDSEETEVPVNTETKSERTGGKRKLQIQGKWKGIDPVIFFND 417
           NE D  A+EPD   TC + +S + +  VN ET+S    GKRKLQIQGKWKG+DPV+FF D
Sbjct: 553 NELDSTALEPDSCNTCGENESGKAQALVNGETQSSNAVGKRKLQIQGKWKGVDPVLFFKD 612

Query: 418 ETIINSIKTFYGIDDSFQLSGQLVSRNGDTNRVKRIYYVSKSVKDALDLNFRVGQQLKIT 477
           E IINSIK FYGID+SF  +G L+SRN D N VKRIYYVSKSVKD L+LN  VGQQLKI 
Sbjct: 613 EAIINSIKAFYGIDESFPFNGHLISRNNDNNHVKRIYYVSKSVKDVLELNLLVGQQLKIA 672

Query: 478 SVGLKMFERQTSREGNSAPCSFRISSEGLPVILPYITKQILYASLVDFKHLLQYKTIKFA 537
           SVGLKMFERQTSREG SAPCSFRISSEGLPVILP+ITKQILYASLVDFKHLLQYK++K+ 
Sbjct: 673 SVGLKMFERQTSREGTSAPCSFRISSEGLPVILPHITKQILYASLVDFKHLLQYKSVKYT 732

Query: 538 DFVDAEFGEKASKLMMGCCVIVLSKGGEALSNPIQIDASTIAIGCWKGRASLSVMVTAID 597
           DFVDAEFGEKASKL+MGCCVIVL + G+  S+PIQ+DASTIAIGCWKGR+SLSVMVTAID
Sbjct: 733 DFVDAEFGEKASKLLMGCCVIVL-RDGKIFSDPIQVDASTIAIGCWKGRSSLSVMVTAID 791

Query: 598 CQELLERLLMRLEIEKGDLVQENALGTDEVQEEMNDNGK-EEPESLEVAV 646
           CQELLERLL R++  +G  VQE+     E Q++MN   K E+ E+ E A 
Sbjct: 792 CQELLERLLARMDTGEGSSVQESIAEACEAQDDMNGIEKVEDTETTEQAT 841

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297741823|emb|CBI33136.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147811154|emb|CAN70164.1| hypothetical protein VITISV_039256 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480502|ref|XP_002271053.2| PREDICTED: tRNA (cytosine(34)-C(5))-methyltransferase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224093730|ref|XP_002309966.1| predicted protein [Populus trichocarpa] gi|222852869|gb|EEE90416.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356525455|ref|XP_003531340.1| PREDICTED: tRNA (cytosine(34)-C(5))-methyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|449451413|ref|XP_004143456.1| PREDICTED: tRNA (cytosine(34)-C(5))-methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449496414|ref|XP_004160128.1| PREDICTED: tRNA (cytosine(34)-C(5))-methyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356538146|ref|XP_003537565.1| PREDICTED: tRNA (cytosine(34)-C(5))-methyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|297825119|ref|XP_002880442.1| hypothetical protein ARALYDRAFT_320078 [Arabidopsis lyrata subsp. lyrata] gi|297326281|gb|EFH56701.1| hypothetical protein ARALYDRAFT_320078 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query648
TAIR|locus:2041213808 AT2G22400 [Arabidopsis thalian 0.893 0.716 0.615 3.3e-189
TAIR|locus:2140094783 AT4G40000 [Arabidopsis thalian 0.563 0.466 0.555 5.3e-104
ZFIN|ZDB-GENE-030131-4017766 nsun2 "NOL1/NOP2/Sun domain fa 0.331 0.280 0.480 1.7e-87
UNIPROTKB|Q08J23767 NSUN2 "tRNA (cytosine(34)-C(5) 0.325 0.275 0.484 5.6e-81
MGI|MGI:107252757 Nsun2 "NOL1/NOP2/Sun domain fa 0.325 0.278 0.475 6.4e-81
UNIPROTKB|F1MK61777 NSUN2 "Uncharacterized protein 0.325 0.271 0.497 2.2e-78
POMBASE|SPAC23C4.17685 trm402 "tRNA (cytosine-5-)-met 0.358 0.338 0.439 8.9e-73
FB|FBgn0026079746 Nsun2 "NOP2-Sun domain family, 0.347 0.301 0.453 4.7e-71
UNIPROTKB|Q5ZLV4796 NSUN2 "tRNA (cytosine(34)-C(5) 0.325 0.265 0.484 6.7e-71
UNIPROTKB|F1NJM1793 NSUN2 "tRNA (cytosine(34)-C(5) 0.325 0.266 0.484 7.9e-71
TAIR|locus:2041213 AT2G22400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1834 (650.7 bits), Expect = 3.3e-189, P = 3.3e-189
 Identities = 372/604 (61%), Positives = 458/604 (75%)

Query:     1 MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNH 60
             MCAAPGSKTFQLLEIIH+++ PG+LPNG+V+AND+D +R NLLIHQTKRMCT+NLIVTNH
Sbjct:   192 MCAAPGSKTFQLLEIIHEASEPGSLPNGLVVANDVDFKRSNLLIHQTKRMCTSNLIVTNH 251

Query:    61 EAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNV 120
             E Q FPGCR NK  S AS+KGI     + QL FDRVLCDVPCSGDGTLRKAPDIWRKWN 
Sbjct:   252 EGQQFPGCRLNK--SRASEKGISENMPINQLAFDRVLCDVPCSGDGTLRKAPDIWRKWNS 309

Query:   121 GLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVS 180
             G+GNGLHSLQ+ +AMRG+SLLKVGG+++YSTCSMNPVE+EAVVAEILR+C  SVEL+DVS
Sbjct:   310 GMGNGLHSLQIILAMRGLSLLKVGGKMIYSTCSMNPVEDEAVVAEILRRCGDSVELLDVS 369

Query:   181 NEVPQLIHRPGLRKWKVRDKGIWLASHKHVRKFRRIGIVPSMFPSGSSHMDATDIEPKHG 240
             +++P+LI RPGL+ WKVRDKG W  S+K V + RR G++ SMFPSG    D+T+   K+ 
Sbjct:   370 DKLPELIRRPGLKAWKVRDKGGWFTSYKDVPQNRRGGVLVSMFPSGKYLKDSTETTEKNE 429

Query:   241 NVTDVNS-DEGLQQVEDVLTSA--DDLEEEVSDLPLERCMRLVPHDQNSGAFFIAVLQKV 297
             N  DVN  ++GL++ +  +  A  ++  EEVSDLPLERCMR++PHDQN+GAFFIAVLQK 
Sbjct:   430 N-GDVNGCEDGLKETDISVVDATPEEQAEEVSDLPLERCMRIIPHDQNTGAFFIAVLQKK 488

Query:   298 SPLPVVQEKHINPEEKMLPRNDDPPKKLQNQDTEEVNGMEVDLADGTDEKDPEGSLEANS 357
             SPLP  QEK  N +     ++ D  +K  ++  E V  + VD A   DE   E  +EA+S
Sbjct:   489 SPLPEFQEKP-NTKRNSTAKSTDSTEKSPSK--ESV--VTVD-AGVPDESAVEKVIEADS 542

Query:   358 -IDNEDGAAVEPDPLTCEKVDSEETEVPVNTETKSERTGGKRKLQIQGKWKGIDPVIFFN 416
              I+  D  ++EP     EK  +E   +  + E  S   GGKRK+ +QGKWKG DPV+F  
Sbjct:   543 NIEKND--SLEP-----EKKITEGESITEDKEANSSNAGGKRKVPMQGKWKGFDPVVFVK 595

Query:   417 DETIINSIKTFYGI-DDSFQLSGQLVSRNGDTNRVKRIYYVSKSVKDALDLNFRVGQQLK 475
             DET+IN IK FYGI D+SF L G LV+RN DT+ VKRIYYVSKSVK+ L LNF VGQQLK
Sbjct:   596 DETVINGIKEFYGIKDESFPLHGHLVARNTDTSSVKRIYYVSKSVKEVLQLNFAVGQQLK 655

Query:   476 ITSVGLKMFERQTSREGNSAPCSFRISSEGLPVILPYITKQILYASLVDFKHLLQYKTIK 535
             I SVGLKMFERQ+++EG+S  C FRISSEGLPVILPYITKQ+LY  + DFK LLQ K+IK
Sbjct:   656 IASVGLKMFERQSAKEGSSTLCPFRISSEGLPVILPYITKQVLYTPMADFKLLLQDKSIK 715

Query:   536 FADFVDAEFGEKASKLMMGCCVIVLSKGGEALSNPIQIDASTIAIGCWKGRASLSVMVTA 595
             F DFV+ +  +KA+ L+MG CV++LS G E    P++ DASTIAI CW+G+ASL+VM T 
Sbjct:   716 FHDFVNPQLAQKATDLVMGSCVVILSDG-EV---PVKADASTIAISCWRGKASLAVMATV 771

Query:   596 IDCQ 599
              DCQ
Sbjct:   772 ADCQ 775
GO:0003723 "RNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008168 "methyltransferase activity" evidence=IEA
TAIR|locus:2140094 AT4G40000 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-4017 nsun2 "NOL1/NOP2/Sun domain family, member 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q08J23 NSUN2 "tRNA (cytosine(34)-C(5))-methyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:107252 Nsun2 "NOL1/NOP2/Sun domain family member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MK61 NSUN2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
POMBASE|SPAC23C4.17 trm402 "tRNA (cytosine-5-)-methyltransferase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
FB|FBgn0026079 Nsun2 "NOP2-Sun domain family, member 2 ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLV4 NSUN2 "tRNA (cytosine(34)-C(5))-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJM1 NSUN2 "tRNA (cytosine(34)-C(5))-methyltransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691
4th Layer2.1.1.29LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_VII0458
hypothetical protein (799 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.I.4832.1
hypothetical protein (422 aa)
   •  ••0.681
gw1.XIX.1572.1
hypothetical protein (303 aa)
   •• • 0.675
estExt_fgenesh4_pg.C_LG_XV0629
hypothetical protein (314 aa)
   •  • 0.658
eugene3.00090493
hypothetical protein (840 aa)
   •  • 0.651
eugene3.00640202
hypothetical protein (1181 aa)
   •    0.604
gw1.86.17.1
hypothetical protein (573 aa)
   •    0.590
estExt_fgenesh4_pm.C_280108
hypothetical protein (960 aa)
   •    0.590
estExt_fgenesh4_pm.C_1070023
hypothetical protein (554 aa)
   •    0.564
estExt_Genewise1_v1.C_LG_IV0024
SubName- Full=Putative uncharacterized protein; (604 aa)
   •    0.559
estExt_fgenesh4_pm.C_LG_I0505
SubName- Full=Putative uncharacterized protein; (474 aa)
   •• • 0.553

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query648
COG0144355 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases 4e-43
TIGR00446264 TIGR00446, nop2p, NOL1/NOP2/sun family putative RN 8e-30
PRK14902444 PRK14902, PRK14902, 16S rRNA methyltransferase B; 2e-27
pfam01189277 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family 2e-25
PRK14901434 PRK14901, PRK14901, 16S rRNA methyltransferase B; 3e-18
TIGR00563426 TIGR00563, rsmB, ribosomal RNA small subunit methy 7e-18
PRK11933470 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransf 3e-17
PRK10901427 PRK10901, PRK10901, 16S rRNA methyltransferase B; 1e-15
PRK14903431 PRK14903, PRK14903, 16S rRNA methyltransferase B; 2e-14
PRK14904445 PRK14904, PRK14904, 16S rRNA methyltransferase B; 1e-12
pfam01189277 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family 2e-11
COG0144355 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases 8e-04
>gnl|CDD|223222 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  158 bits (402), Expect = 4e-43
 Identities = 67/198 (33%), Positives = 89/198 (44%), Gaps = 26/198 (13%)

Query: 1   MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNH 60
           +CAAPG KT  L E++    N GA+    V+A D+  +R   L    KR+   N+IV N 
Sbjct: 163 LCAAPGGKTTHLAELME---NEGAI----VVAVDVSPKRLKRLRENLKRLGVRNVIVVNK 215

Query: 61  EAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNV 120
           +A+               +     E       FDR+L D PCSG G +R+ PD+  +   
Sbjct: 216 DARRLA------------ELLPGGEK------FDRILLDAPCSGTGVIRRDPDVKWRRTP 257

Query: 121 GLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVS 180
                L  LQ +I    + LLK GG +VYSTCS+ P ENE VV   L +     EL  V 
Sbjct: 258 EDIAELAKLQKEILAAALKLLKPGGVLVYSTCSLTPEENEEVVERFLERHPD-FELEPVR 316

Query: 181 NEVPQLIHRPGLRKWKVR 198
                L    G    K R
Sbjct: 317 LPWGPLFEGLGSELGKTR 334

Length = 355
>gnl|CDD|188051 TIGR00446, nop2p, NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>gnl|CDD|237857 PRK14902, PRK14902, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|201649 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family Back     alignment and domain information
>gnl|CDD|237856 PRK14901, PRK14901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|233025 TIGR00563, rsmB, ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>gnl|CDD|183387 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>gnl|CDD|236790 PRK10901, PRK10901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|184896 PRK14903, PRK14903, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|237858 PRK14904, PRK14904, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|201649 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family Back     alignment and domain information
>gnl|CDD|223222 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 648
KOG2198375 consensus tRNA cytosine-5-methylases and related e 100.0
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 100.0
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 100.0
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 100.0
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 100.0
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 100.0
PRK14903431 16S rRNA methyltransferase B; Provisional 100.0
PRK14901434 16S rRNA methyltransferase B; Provisional 100.0
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 100.0
PRK14904445 16S rRNA methyltransferase B; Provisional 100.0
PRK14902444 16S rRNA methyltransferase B; Provisional 100.0
PRK10901427 16S rRNA methyltransferase B; Provisional 99.97
KOG2360413 consensus Proliferation-associated nucleolar prote 99.93
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.03
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.03
COG1092393 Predicted SAM-dependent methyltransferases [Genera 98.86
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 98.74
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.68
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 98.65
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 98.64
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 98.62
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 98.61
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 98.57
PRK14967223 putative methyltransferase; Provisional 98.55
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 98.51
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 98.32
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.3
PTZ00146293 fibrillarin; Provisional 98.3
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 98.25
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 98.24
PRK04266226 fibrillarin; Provisional 98.2
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.2
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 98.16
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 98.16
TIGR00438188 rrmJ cell division protein FtsJ. 98.15
PRK07402196 precorrin-6B methylase; Provisional 98.14
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 98.12
PRK14968188 putative methyltransferase; Provisional 98.11
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 98.09
TIGR00536284 hemK_fam HemK family putative methylases. The gene 98.08
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 98.06
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 97.86
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 97.85
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 97.84
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 97.82
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 97.81
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 97.81
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.73
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 97.72
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 97.72
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 97.7
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 97.7
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 97.69
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 97.69
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 97.69
PLN02476278 O-methyltransferase 97.66
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 97.66
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 97.63
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 97.61
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 97.6
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 97.56
COG1041347 Predicted DNA modification methylase [DNA replicat 97.56
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 97.5
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 97.48
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 97.47
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 97.46
COG2520341 Predicted methyltransferase [General function pred 97.45
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 97.44
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 97.43
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 97.42
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 97.39
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 97.38
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 97.34
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 97.29
COG0742187 N6-adenine-specific methylase [DNA replication, re 97.29
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 97.28
PRK08317241 hypothetical protein; Provisional 97.27
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 97.22
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.21
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 97.19
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 97.19
COG4122219 Predicted O-methyltransferase [General function pr 97.17
COG2265432 TrmA SAM-dependent methyltransferases related to t 97.17
COG2263198 Predicted RNA methylase [Translation, ribosomal st 97.13
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 97.07
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 97.04
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 97.01
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 97.0
PLN02233261 ubiquinone biosynthesis methyltransferase 96.98
PLN02244340 tocopherol O-methyltransferase 96.96
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 96.93
PLN03075296 nicotianamine synthase; Provisional 96.9
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 96.84
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 96.83
PHA03412241 putative methyltransferase; Provisional 96.81
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 96.79
COG4123248 Predicted O-methyltransferase [General function pr 96.79
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 96.78
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 96.78
PRK00811283 spermidine synthase; Provisional 96.77
COG2890280 HemK Methylase of polypeptide chain release factor 96.71
PRK04457262 spermidine synthase; Provisional 96.68
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 96.68
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 96.58
PRK11207197 tellurite resistance protein TehB; Provisional 96.58
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 96.55
PRK01581374 speE spermidine synthase; Validated 96.53
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 96.53
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 96.53
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 96.52
KOG1099294 consensus SAM-dependent methyltransferase/cell div 96.48
PLN02589247 caffeoyl-CoA O-methyltransferase 96.43
PF01795310 Methyltransf_5: MraW methylase family; InterPro: I 96.42
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 96.4
PRK03612521 spermidine synthase; Provisional 96.38
KOG2904328 consensus Predicted methyltransferase [General fun 96.37
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 96.34
PHA03411279 putative methyltransferase; Provisional 96.31
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 96.25
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 96.18
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 96.15
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 96.1
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 96.06
TIGR00740239 methyltransferase, putative. A simple BLAST search 96.04
PRK10258251 biotin biosynthesis protein BioC; Provisional 96.01
PLN02336475 phosphoethanolamine N-methyltransferase 95.99
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 95.97
COG4076252 Predicted RNA methylase [General function predicti 95.95
TIGR00452314 methyltransferase, putative. Known examples to dat 95.91
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 95.86
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 95.86
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 95.63
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 95.57
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 95.54
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 95.51
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 95.49
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 95.48
PLN02672 1082 methionine S-methyltransferase 95.44
PRK12335287 tellurite resistance protein TehB; Provisional 95.27
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 95.21
KOG1663237 consensus O-methyltransferase [Secondary metabolit 95.15
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 94.92
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 94.9
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 94.77
PLN02366308 spermidine synthase 94.7
PLN02823336 spermine synthase 94.54
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 94.35
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 94.34
PRK06922677 hypothetical protein; Provisional 94.3
PLN02490340 MPBQ/MSBQ methyltransferase 94.28
smart00650169 rADc Ribosomal RNA adenine dimethylases. 94.26
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 94.2
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 94.13
KOG2671421 consensus Putative RNA methylase [Replication, rec 94.09
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 94.06
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 94.0
TIGR02987524 met_A_Alw26 type II restriction m6 adenine DNA met 93.94
PF02005377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 93.84
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 93.78
TIGR03438301 probable methyltransferase. This model represents 93.73
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 93.66
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 93.55
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 92.8
PRK10742250 putative methyltransferase; Provisional 92.79
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 92.24
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 92.01
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 91.8
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 91.7
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 91.52
PLN02336475 phosphoethanolamine N-methyltransferase 91.16
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 91.14
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 90.96
KOG2899288 consensus Predicted methyltransferase [General fun 90.53
PTZ00338294 dimethyladenosine transferase-like protein; Provis 90.05
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 89.89
KOG1271227 consensus Methyltransferases [General function pre 89.76
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 89.29
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 88.3
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 88.14
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 87.71
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 87.41
PLN02232160 ubiquinone biosynthesis methyltransferase 86.67
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 86.51
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 86.18
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 86.12
COG4262508 Predicted spermidine synthase with an N-terminal m 85.77
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 84.92
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 84.92
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 84.9
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 84.04
KOG2730263 consensus Methylase [General function prediction o 83.2
KOG1253525 consensus tRNA methyltransferase [Translation, rib 82.21
PF05430124 Methyltransf_30: S-adenosyl-L-methionine-dependent 81.76
COG4106257 Tam Trans-aconitate methyltransferase [General fun 81.64
KOG1270282 consensus Methyltransferases [Coenzyme transport a 81.6
COG0421282 SpeE Spermidine synthase [Amino acid transport and 81.11
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 81.11
PRK13255218 thiopurine S-methyltransferase; Reviewed 80.54
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 80.28
COG2521287 Predicted archaeal methyltransferase [General func 80.06
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
Probab=100.00  E-value=1.5e-51  Score=433.43  Aligned_cols=199  Identities=55%  Similarity=0.919  Sum_probs=183.6

Q ss_pred             CcccchHHHHHHHHHHhcCCCCCCCCCEEEEEEcCChHHHHHHHHHHHHhCCCcEEEeecccccCCCcccCCCCCCCCCc
Q 006372            1 MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDK   80 (648)
Q Consensus         1 mCAAPGgKT~qlae~l~~~~~~~~~~~G~ViAnD~d~kR~~~L~~~lkRlg~~nv~vtn~Da~~~p~~~~~~~~~~~~~~   80 (648)
                      |||||||||+||+|.+|...+     .|.|+|||.|.+|+++|+|+++|+..+++.|++||++.||++.+...       
T Consensus       162 mCAAPG~Kt~qLLeal~~~~~-----~g~vvaND~d~~R~~~L~~q~~~l~~~~~~v~~~~~~~~p~~~~~~~-------  229 (375)
T KOG2198|consen  162 MCAAPGGKTAQLLEALHKDPT-----RGYVVANDVDPKRLNMLVHQLKRLPSPNLLVTNHDASLFPNIYLKDG-------  229 (375)
T ss_pred             eccCCCccHHHHHHHHhcCCC-----CCeeEecccCHHHHHHHHHHHhccCCcceeeecccceeccccccccC-------
Confidence            899999999999999996432     68999999999999999999999999999999999999999865311       


Q ss_pred             CcccccccccccccEEEEcCCCCCCCccccCcccccc-cCcchhhhhHHHHHHHHHHHhhccccCcEEEEecccCCcccc
Q 006372           81 GIESESNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRK-WNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVEN  159 (648)
Q Consensus        81 ~~~~~~~~~~~~FDrILlDvPCSGdGtlrk~p~i~~k-ws~~~~~~L~~lQ~~IL~~Al~lLk~GG~LVYSTCSl~p~EN  159 (648)
                           ...+..+|||||||||||||||+|+++++|+. |+.....+||.+|.+||+||+++||+||+|||||||+||+||
T Consensus       230 -----~~~~~~~fDrVLvDVPCS~Dgt~rk~~~i~~~~w~~~~~~~L~~LQ~~iL~rgl~lLk~GG~lVYSTCSLnpieN  304 (375)
T KOG2198|consen  230 -----NDKEQLKFDRVLVDVPCSGDGTLRKNPNIWKEGWKTQRALGLHALQLRILRRGLRLLKVGGRLVYSTCSLNPIEN  304 (375)
T ss_pred             -----chhhhhhcceeEEecccCCCcccccCchHhhhhhhhhhccCChHHHHHHHHHHHHHhcCCCEEEEeccCCCchhh
Confidence                 12345899999999999999999999999999 999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhCCCceEEEeCCCcCCccccCCCccccccccCCc-cccchhhHHhhhhc
Q 006372          160 EAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDKGI-WLASHKHVRKFRRI  216 (648)
Q Consensus       160 EaVV~~~L~~~~g~veLvd~s~~lP~l~~~pGl~~W~v~~~~~-~~~~~~~~~~~~~~  216 (648)
                      |+||+++|++++++++|++++..||.+++.+|.+.|++.+++. |+.++.++|.....
T Consensus       305 EaVV~~~L~~~~~~~~lv~~~~~lp~l~r~~g~t~~~~~~~~~~~~~~~~~vp~~~~~  362 (375)
T KOG2198|consen  305 EAVVQEALQKVGGAVELVDVSGDLPGLKRMFGSTGWKVHDKVLKWFTSPLEVPKLVAN  362 (375)
T ss_pred             HHHHHHHHHHhcCcccceeeccccccceecCCCCcceEEecCcccccCccccccchhh
Confidence            9999999999999999999999999999999999999999764 88999999876543

>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG2360 consensus Proliferation-associated nucleolar protein (NOL1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query648
3m4x_A456 Structure Of A Ribosomal Methyltransferase Length = 2e-16
2frx_A479 Crystal Structure Of Yebu, A M5c Rna Methyltransfer 5e-15
1ixk_A315 Crystal Structure Analysis Of Methyltransferase Hom 1e-13
3m6w_A464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 3e-13
3m6u_A464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 3e-13
3m6x_A464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 5e-13
1sqf_A429 The Crystal Structure Of E. Coli Fmu Binary Complex 7e-13
3a4t_A274 Crystal Structure Of Atrm4 From M.Jannaschii With S 1e-11
2yxl_A450 Crystal Structure Of Ph0851 Length = 450 3e-10
4fzv_A359 Crystal Structure Of The Human Mterf4:nsun4:sam Ter 2e-07
4fp9_A360 Human Mterf4-Nsun4 Protein Complex Length = 360 2e-07
>pdb|3M4X|A Chain A, Structure Of A Ribosomal Methyltransferase Length = 456 Back     alignment and structure 
Iteration: 1

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 57/213 (26%), Positives = 93/213 (43%), Gaps = 44/213 (20%)
Query: 1   MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNH 60
           +CAAPG K+ QL      +   G    G+++ N++  +R  +L    +R   +N IVTNH
Sbjct: 112 LCAAPGGKSTQL-----AAQXKG---KGLLVTNEIFPKRAKILSENIERWGVSNAIVTNH 163
Query: 61  EAQ----HFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDGTLRKAPDIWR 116
                  HF G                         FDR++ D PCSG+G  RK P+  +
Sbjct: 164 APAELVPHFSG------------------------FFDRIVVDAPCSGEGXFRKDPNAIK 199
Query: 117 KWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVEL 176
           +W           Q +I    I  LK  G+++YSTC+  P ENE +++ ++     ++E 
Sbjct: 200 EWTEESPLYCQKRQQEILSSAIKXLKNKGQLIYSTCTFAPEENEEIISWLVENYPVTIEE 259
Query: 177 VDVSNEVPQLIHRPG--------LRKWKVRDKG 201
           + ++  V       G        +R W  +D+G
Sbjct: 260 IPLTQSVSSGRSEWGSVAGLEKTIRIWPHKDQG 292
>pdb|2FRX|A Chain A, Crystal Structure Of Yebu, A M5c Rna Methyltransferase From E.Coli Length = 479 Back     alignment and structure
>pdb|1IXK|A Chain A, Crystal Structure Analysis Of Methyltransferase Homolog Protein From Pyrococcus Horikoshii Length = 315 Back     alignment and structure
>pdb|3M6W|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group P21212 In Complex With S-Adenosyl-L- Methionine Length = 464 Back     alignment and structure
>pdb|3M6U|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group 43 Length = 464 Back     alignment and structure
>pdb|3M6X|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group P21212 Length = 464 Back     alignment and structure
>pdb|1SQF|A Chain A, The Crystal Structure Of E. Coli Fmu Binary Complex With S- Adenosylmethionine At 2.1 A Resolution Length = 429 Back     alignment and structure
>pdb|3A4T|A Chain A, Crystal Structure Of Atrm4 From M.Jannaschii With Sinefungin Length = 274 Back     alignment and structure
>pdb|2YXL|A Chain A, Crystal Structure Of Ph0851 Length = 450 Back     alignment and structure
>pdb|4FZV|A Chain A, Crystal Structure Of The Human Mterf4:nsun4:sam Ternary Complex Length = 359 Back     alignment and structure
>pdb|4FP9|A Chain A, Human Mterf4-Nsun4 Protein Complex Length = 360 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query648
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 6e-45
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 5e-05
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 5e-43
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 2e-42
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 3e-41
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 1e-40
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 5e-39
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 1e-34
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 3e-32
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Length = 479 Back     alignment and structure
 Score =  166 bits (421), Expect = 6e-45
 Identities = 53/228 (23%), Positives = 93/228 (40%), Gaps = 42/228 (18%)

Query: 1   MCAAPGSKTFQLLEIIHQSTNPGALPN-GMVIANDLDVQRCNLLIHQTKRMCTANLIVTN 59
           + AAPGSKT Q+            + N G ++AN+    R  +L     R   +N+ +T+
Sbjct: 124 VAAAPGSKTTQISA---------RMNNEGAILANEFSASRVKVLHANISRCGISNVALTH 174

Query: 60  HEAQHFPGCRANKNFSSASDKGIESESNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRKWN 119
            + + F                           FD +L D PCSG+G +RK PD  + W+
Sbjct: 175 FDGRVFGAAVPEM--------------------FDAILLDAPCSGEGVVRKDPDALKNWS 214

Query: 120 VGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENEAVVAEILRKCEGSVELVDV 179
                 + + Q ++       L+ GG +VYSTC++N  ENEAV   +      +VE + +
Sbjct: 215 PESNQEIAATQRELIDSAFHALRPGGTLVYSTCTLNQEENEAVCLWLKETYPDAVEFLPL 274

Query: 180 SNEVPQLIHRPGLRKWKVRDKGIWLASHKH------VRKFRRIGIVPS 221
            +  P          + +    ++     +      V + R+   +P+
Sbjct: 275 GDLFPGANKALTEEGF-LH---VF--PQIYDCEGFFVARLRKTQAIPA 316
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Length = 479 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Length = 315 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Length = 456 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Length = 464 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Length = 274 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Length = 309 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Length = 450 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Length = 429 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Length = 429 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query648
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 100.0
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 100.0
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 100.0
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 100.0
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 100.0
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 100.0
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 100.0
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 100.0
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 99.98
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.39
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.32
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.23
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.09
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.05
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 98.99
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 98.99
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 98.96
2frn_A278 Hypothetical protein PH0793; structural genomics, 98.85
2b78_A385 Hypothetical protein SMU.776; structure genomics, 98.83
3k6r_A278 Putative transferase PH0793; structural genomics, 98.83
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 98.79
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 98.78
2b3t_A276 Protein methyltransferase HEMK; translation termin 98.77
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 98.75
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 98.69
3lpm_A259 Putative methyltransferase; structural genomics, p 98.67
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 98.66
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 98.64
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 98.61
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.6
2qm3_A373 Predicted methyltransferase; putative methyltransf 98.6
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.58
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.58
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 98.51
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 98.5
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 98.5
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 98.49
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.48
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 98.48
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 98.46
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 98.45
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 98.44
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 98.43
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 98.43
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 98.41
3duw_A223 OMT, O-methyltransferase, putative; alternating of 98.4
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 98.39
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.37
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 98.35
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 98.35
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 98.33
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 98.28
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 98.27
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 98.26
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 98.26
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.25
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 98.23
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.22
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.2
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 98.2
2fpo_A202 Methylase YHHF; structural genomics, putative meth 98.2
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 98.17
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.17
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 98.17
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 98.13
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 98.12
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.11
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.11
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 98.11
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 98.09
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 98.06
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 98.05
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.04
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 98.04
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.03
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 98.02
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 98.01
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 97.99
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 97.97
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 97.96
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 97.96
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 97.95
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 97.94
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 97.93
2esr_A177 Methyltransferase; structural genomics, hypothetic 97.91
2b25_A336 Hypothetical protein; structural genomics, methyl 97.9
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 97.89
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 97.89
3f4k_A257 Putative methyltransferase; structural genomics, P 97.87
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 97.83
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 97.82
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 97.81
2avd_A229 Catechol-O-methyltransferase; structural genomics, 97.79
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 97.79
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 97.79
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.78
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 97.77
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 97.76
2h00_A254 Methyltransferase 10 domain containing protein; st 97.76
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 97.76
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 97.75
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 97.73
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 97.72
1jsx_A207 Glucose-inhibited division protein B; methyltransf 97.7
1ws6_A171 Methyltransferase; structural genomics, riken stru 97.68
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 97.68
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 97.66
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 97.65
3dtn_A234 Putative methyltransferase MM_2633; structural gen 97.65
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 97.64
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 97.64
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 97.63
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 97.62
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 97.61
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 97.6
1xxl_A239 YCGJ protein; structural genomics, protein structu 97.59
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 97.59
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.57
2kw5_A202 SLR1183 protein; structural genomics, northeast st 97.57
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 97.57
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 97.56
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 97.53
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 97.51
3lcc_A235 Putative methyl chloride transferase; halide methy 97.47
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 97.46
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 97.46
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 97.45
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 97.43
1ne2_A200 Hypothetical protein TA1320; structural genomics, 97.43
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 97.43
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 97.43
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 97.41
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 97.41
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 97.41
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 97.4
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 97.39
3ocj_A305 Putative exported protein; structural genomics, PS 97.39
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 97.38
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 97.38
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 97.37
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 97.37
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 97.35
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 97.34
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 97.33
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 97.31
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 97.31
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 97.3
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 97.29
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 97.29
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 97.29
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 97.28
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 97.27
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 97.26
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 97.26
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 97.25
3m70_A286 Tellurite resistance protein TEHB homolog; structu 97.25
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 97.23
2o07_A304 Spermidine synthase; structural genomics, structur 97.23
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 97.22
2i7c_A283 Spermidine synthase; transferase, structural genom 97.22
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 97.2
1vl5_A260 Unknown conserved protein BH2331; putative methylt 97.19
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 97.18
2pt6_A321 Spermidine synthase; transferase, structural genom 97.17
3lkd_A542 Type I restriction-modification system methyltrans 97.13
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 97.13
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 97.12
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 97.09
3cvo_A202 Methyltransferase-like protein of unknown functio; 97.08
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 97.05
3hnr_A220 Probable methyltransferase BT9727_4108; structural 97.05
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 97.05
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 97.02
1wzn_A252 SAM-dependent methyltransferase; structural genomi 97.0
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 97.0
3gjy_A317 Spermidine synthase; APC62791, structural genomics 96.99
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 96.99
1xj5_A334 Spermidine synthase 1; structural genomics, protei 96.95
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 96.95
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 96.94
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 96.93
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 96.9
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 96.88
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 96.86
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 96.84
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 96.83
3ll7_A410 Putative methyltransferase; methytransferase, stru 96.81
3gu3_A284 Methyltransferase; alpha-beta protein, structural 96.8
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 96.8
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 96.79
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 96.75
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 96.73
3m33_A226 Uncharacterized protein; structural genomics, PSI- 96.73
2fyt_A340 Protein arginine N-methyltransferase 3; structural 96.72
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 96.71
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 96.68
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 96.65
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 96.64
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 96.59
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 96.59
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 96.58
3i9f_A170 Putative type 11 methyltransferase; structural gen 96.58
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 96.57
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 96.54
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 96.54
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 96.54
2r3s_A335 Uncharacterized protein; methyltransferase domain, 96.54
3khk_A544 Type I restriction-modification system methylation 96.5
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 96.45
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 96.33
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 96.27
2cmg_A262 Spermidine synthase; transferase, putrescine amino 96.25
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 96.24
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 96.13
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 96.11
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 96.1
3dp7_A363 SAM-dependent methyltransferase; structural genomi 96.08
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 96.04
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 96.03
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 96.02
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 96.0
2p7i_A250 Hypothetical protein; putative methyltransferase, 95.97
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 95.97
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 95.96
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 95.85
2i62_A265 Nicotinamide N-methyltransferase; structural genom 95.85
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 95.84
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 95.72
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 95.69
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 95.59
3sso_A419 Methyltransferase; macrolide, natural product, ros 95.58
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 95.52
3s1s_A878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 95.49
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 95.43
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 95.43
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 95.41
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 95.35
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 95.34
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 95.34
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 95.19
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 95.14
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 94.9
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 94.89
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 94.82
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 94.81
3ege_A261 Putative methyltransferase from antibiotic biosyn 94.68
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 94.66
4hg2_A257 Methyltransferase type 11; structural genomics, PS 94.59
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 94.58
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 94.53
1vlm_A219 SAM-dependent methyltransferase; possible histamin 94.49
3ufb_A530 Type I restriction-modification system methyltran 94.34
3cc8_A230 Putative methyltransferase; structural genomics, j 94.21
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 94.06
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 94.02
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 93.94
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 93.74
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 93.7
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 93.06
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 92.96
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 92.88
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 92.87
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 92.71
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 92.45
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 92.3
1g55_A343 DNA cytosine methyltransferase DNMT2; human DNA me 92.18
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 92.15
3tka_A347 Ribosomal RNA small subunit methyltransferase H; H 91.7
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 91.18
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 90.72
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 90.58
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 90.37
3g7u_A376 Cytosine-specific methyltransferase; DNA-binding, 89.75
2oo3_A283 Protein involved in catabolism of external DNA; st 89.29
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 88.57
2c7p_A327 Modification methylase HHAI; DNA methyltransferase 86.86
2px2_A269 Genome polyprotein [contains: capsid protein C (co 86.81
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 86.07
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 85.22
3giw_A277 Protein of unknown function DUF574; rossmann-fold 83.96
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 83.76
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 83.47
1sqw_A188 Saccharomyces cerevisiae NIP7P homolog; PUA, unkno 83.38
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 82.92
3fut_A271 Dimethyladenosine transferase; methyltransferase, 81.71
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 80.93
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 80.4
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
Probab=100.00  E-value=7.8e-46  Score=396.89  Aligned_cols=142  Identities=32%  Similarity=0.462  Sum_probs=129.7

Q ss_pred             CcccchHHHHHHHHHHhcCCCCCCCCCEEEEEEcCChHHHHHHHHHHHHhCC------CcEEEeecccccCCCcccCCCC
Q 006372            1 MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCT------ANLIVTNHEAQHFPGCRANKNF   74 (648)
Q Consensus         1 mCAAPGgKT~qlae~l~~~~~~~~~~~G~ViAnD~d~kR~~~L~~~lkRlg~------~nv~vtn~Da~~~p~~~~~~~~   74 (648)
                      |||||||||+||++++.         .|.|+|||++.+|+..|+++++|++.      .++.+++.|+..++..      
T Consensus       155 ~CAaPGGKT~~la~~~~---------~~~l~A~D~~~~R~~~l~~~l~r~~~~~~~~~~~v~v~~~D~~~~~~~------  219 (359)
T 4fzv_A          155 LCAAPGGKTLALLQTGC---------CRNLAANDLSPSRIARLQKILHSYVPEEIRDGNQVRVTSWDGRKWGEL------  219 (359)
T ss_dssp             SSCTTCHHHHHHHHTTC---------EEEEEEECSCHHHHHHHHHHHHHHSCTTTTTSSSEEEECCCGGGHHHH------
T ss_pred             ecCCccHHHHHHHHhcC---------CCcEEEEcCCHHHHHHHHHHHHHhhhhhhccCCceEEEeCchhhcchh------
Confidence            89999999999998753         58899999999999999999999986      4789999998876421      


Q ss_pred             CCCCCcCcccccccccccccEEEEcCCCCCC--CccccCcccccccCcchhhhhHHHHHHHHHHHhhccccCcEEEEecc
Q 006372           75 SSASDKGIESESNMGQLLFDRVLCDVPCSGD--GTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTC  152 (648)
Q Consensus        75 ~~~~~~~~~~~~~~~~~~FDrILlDvPCSGd--Gtlrk~p~i~~kws~~~~~~L~~lQ~~IL~~Al~lLk~GG~LVYSTC  152 (648)
                                    ....||+|||||||||+  |++|++|++|++|++.++..|+.+|++||.+|+++|||||+||||||
T Consensus       220 --------------~~~~fD~VLlDaPCSg~g~g~~r~~~~~~~~~~~~~~~~l~~lQ~~iL~~a~~~lkpGG~LVYsTC  285 (359)
T 4fzv_A          220 --------------EGDTYDRVLVDVPCTTDRHSLHEEENNIFKRSRKKERQILPVLQVQLLAAGLLATKPGGHVVYSTC  285 (359)
T ss_dssp             --------------STTCEEEEEEECCCCCHHHHTTCCTTCTTSGGGHHHHHTHHHHHHHHHHHHHHTEEEEEEEEEEES
T ss_pred             --------------ccccCCEEEECCccCCCCCcccccChhhhhhCCHHHHHHHHHHHHHHHHHHHhcCCCCcEEEEEeC
Confidence                          12579999999999998  88899999999999999999999999999999999999999999999


Q ss_pred             cCCccccHHHHHHHHHhCC
Q 006372          153 SMNPVENEAVVAEILRKCE  171 (648)
Q Consensus       153 Sl~p~ENEaVV~~~L~~~~  171 (648)
                      |++|+|||+||++||++++
T Consensus       286 Sl~~~ENE~vV~~~L~~~~  304 (359)
T 4fzv_A          286 SLSHLQNEYVVQGAIELLA  304 (359)
T ss_dssp             CCCTTTTHHHHHHHHHHHH
T ss_pred             CCchhhCHHHHHHHHHhCC
Confidence            9999999999999999865
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>1sqw_A Saccharomyces cerevisiae NIP7P homolog; PUA, unknown function; 1.90A {Homo sapiens} SCOP: b.122.1.1 d.17.6.3 PDB: 1t5y_A Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 648
d1ixka_313 c.66.1.38 (A:) Hypothetical methyltransferase PH13 6e-20
d1ixka_313 c.66.1.38 (A:) Hypothetical methyltransferase PH13 6e-05
d1sqga2284 c.66.1.38 (A:145-428) Ribosomal RNA small subunit 1e-16
d1sqga2284 c.66.1.38 (A:145-428) Ribosomal RNA small subunit 3e-06
d2b9ea1293 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) 1e-13
d2b9ea1293 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) 1e-06
d1wxxa2318 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280 2e-05
d2as0a2324 c.66.1.51 (A:73-396) Hypothetical protein PH1915, 2e-04
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: NOL1/NOP2/sun
domain: Hypothetical methyltransferase PH1374
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

 Score = 88.9 bits (219), Expect = 6e-20
 Identities = 49/197 (24%), Positives = 82/197 (41%), Gaps = 29/197 (14%)

Query: 26  PNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDKGIESE 85
            +G++ A D+D  R         R+   N+I+ +  + H                     
Sbjct: 140 NDGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGELNVE-------------- 185

Query: 86  SNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGG 145
                  FD++L D PC+G GT+ K P+      +        LQ+++  +G+ +LK GG
Sbjct: 186 -------FDKILLDAPCTGSGTIHKNPERKWNRTMDDIKFCQGLQMRLLEKGLEVLKPGG 238

Query: 146 RIVYSTCSMNPVENEAVVAEILRKCEGSVELVDVSNEVPQLIHRPGLRKWKVRDKGIWLA 205
            +VYSTCS+ P ENE V+   L   +  VEL+ +    P L +  G+   +       L 
Sbjct: 239 ILVYSTCSLEPEENEFVIQWALDNFD--VELLPLKYGEPALTNPFGIELSEEIKNARRLY 296

Query: 206 SHKH------VRKFRRI 216
              H      + K R++
Sbjct: 297 PDVHETSGFFIAKIRKL 313
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 313 Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 284 Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 284 Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Length = 318 Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 324 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query648
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 100.0
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 100.0
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.67
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.48
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.4
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 98.91
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 98.84
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.77
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 98.74
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 98.67
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.65
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 98.62
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 98.62
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.58
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 98.32
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 98.16
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 98.1
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.09
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.06
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 97.97
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 97.97
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 97.96
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 97.94
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 97.93
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 97.84
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 97.78
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 97.74
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 97.67
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 97.66
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 97.65
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 97.63
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 97.61
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.51
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 97.49
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 97.47
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 97.38
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 97.37
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 97.31
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 97.3
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 97.21
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 97.13
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 97.08
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 97.02
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 97.01
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 96.97
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 96.94
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 96.89
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 96.88
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 96.88
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 96.86
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 96.79
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 96.67
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 96.67
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 96.66
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 96.63
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 96.5
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 96.38
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 96.34
d2h00a1250 Methyltransferase 10 domain containing protein MET 96.25
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 96.11
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 96.06
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 95.89
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 95.73
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 95.54
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 95.47
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 95.4
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 95.01
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 94.94
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 94.61
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 94.39
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 94.37
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 94.31
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 94.28
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 94.17
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 93.9
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 93.85
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 93.8
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 93.63
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 93.09
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 92.66
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 92.38
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 92.11
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 91.69
d2ar0a1524 M.EcoKI {Escherichia coli [TaxId: 562]} 91.47
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 90.88
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 90.43
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 90.24
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 89.87
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 88.83
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 86.65
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 83.37
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 82.62
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 82.07
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: NOL1/NOP2/sun
domain: Hypothetical methyltransferase PH1374
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

Probab=100.00  E-value=2.5e-48  Score=406.89  Aligned_cols=153  Identities=33%  Similarity=0.534  Sum_probs=132.0

Q ss_pred             CcccchHHHHHHHHHHhcCCCCCCCCCEEEEEEcCChHHHHHHHHHHHHhCCCcEEEeecccccCCCcccCCCCCCCCCc
Q 006372            1 MCAAPGSKTFQLLEIIHQSTNPGALPNGMVIANDLDVQRCNLLIHQTKRMCTANLIVTNHEAQHFPGCRANKNFSSASDK   80 (648)
Q Consensus         1 mCAAPGgKT~qlae~l~~~~~~~~~~~G~ViAnD~d~kR~~~L~~~lkRlg~~nv~vtn~Da~~~p~~~~~~~~~~~~~~   80 (648)
                      |||||||||+||++++.+        +|.|+|+|.+.+|++.|+++++|+|..|+.+++.|+..++..            
T Consensus       123 ~CAapGgKt~~l~~~~~~--------~~~i~a~d~~~~r~~~l~~~~~r~~~~~i~~~~~d~~~~~~~------------  182 (313)
T d1ixka_         123 MAAAPGGKTSYLAQLMRN--------DGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIGEL------------  182 (313)
T ss_dssp             CCSSCSHHHHHHHHHTTT--------CSEEEEECSCHHHHHHHHHHHHHHTCCSEEEESSCGGGGGGG------------
T ss_pred             cccchhhhhHhhhhhccc--------ccceeeeccCHHHHHHHHHHHHHHHhhccccccccccccccc------------
Confidence            899999999999999864        689999999999999999999999999999998887765321            


Q ss_pred             CcccccccccccccEEEEcCCCCCCCccccCcccccccCcchhhhhHHHHHHHHHHHhhccccCcEEEEecccCCccccH
Q 006372           81 GIESESNMGQLLFDRVLCDVPCSGDGTLRKAPDIWRKWNVGLGNGLHSLQVQIAMRGISLLKVGGRIVYSTCSMNPVENE  160 (648)
Q Consensus        81 ~~~~~~~~~~~~FDrILlDvPCSGdGtlrk~p~i~~kws~~~~~~L~~lQ~~IL~~Al~lLk~GG~LVYSTCSl~p~ENE  160 (648)
                               ...||+|||||||||+|++||+|+++++|++.++..|+.+|++||.+|+++|||||+|||||||++|+|||
T Consensus       183 ---------~~~fD~ILvDaPCSg~G~~~r~p~~~~~~~~~~~~~l~~~Q~~iL~~a~~~lk~gG~lVYsTCSl~~eENE  253 (313)
T d1ixka_         183 ---------NVEFDKILLDAPCTGSGTIHKNPERKWNRTMDDIKFCQGLQMRLLEKGLEVLKPGGILVYSTCSLEPEENE  253 (313)
T ss_dssp             ---------CCCEEEEEEECCTTSTTTCC--------CCHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEESCCCGGGTH
T ss_pred             ---------cccccEEEEccccccCCceeeccchhhhhhhhHHHHHHHHHHHHHHhhhheeCCCcEEEEeeccCChHhHH
Confidence                     25799999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCceEEEeCCCcCC
Q 006372          161 AVVAEILRKCEGSVELVDVSNEVP  184 (648)
Q Consensus       161 aVV~~~L~~~~g~veLvd~s~~lP  184 (648)
                      +||.++|++++  ++++++....|
T Consensus       254 ~VV~~~L~~~~--~~~~~~~~~~~  275 (313)
T d1ixka_         254 FVIQWALDNFD--VELLPLKYGEP  275 (313)
T ss_dssp             HHHHHHHHHSS--EEEECCCSSEE
T ss_pred             HHHHHHHhcCC--CEEeecccCCc
Confidence            99999999874  78887754433
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure