Citrus Sinensis ID: 006398

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------
MDFDEYEYLEKMVENPEPAKEKETANGDGNVKSEDRVRSRSSKCKSDEKVEDYDDDGHRSRGSKSRDESRNHDRRKERDSSCHRSWSRDGGRDRPRSSWEHRDRDTERDRDRDREERNGRDRNRDRGRDRDRRERDHDTDRDREKDKEKEREKSHRSGSQSERYRSDRDERERSRDREVIERERSRDREVIERERSRDREVIERERSRDRELKEREKERESRDNDKESRDNVMAICRRPKEKKEQVEPEVDPERDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMSVPMAIALSGQPLLGQPVMVKPSEAEKNLVQSNSSIAGASGGGTGPYSGGARRLYVGNLHFNMTEDQLRQVFEPFGTVELVQLPLDETGHCKGFGFVQFARLEDARNALNLNGQLEIVGRAIKVSAVTDQSGLQDLGANTTGDFDDDEGGGLSLNARSRALLMQKLDRSGSATTIAGSAVTPAVNSTALPLPTAPLLGAASAVSTLVPPLVQGTVPTHPGQLGTALQVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKFPDSI
ccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccHHHHHcccHHHHHHHHccccHHHHccccccccHHHHHHcccHHHHHHHHHHHcccccccccHHHHHHHcccccccccccccccccccccccEEEEcccccccHHHHHHHHHHcccccEEEEEEcccccccccEEEEEEcccccHHHHHHcccccccccEEEEcccHHHHcccccccccccccccccccccccccEEEEEcccccccHHHHHHHHcccccEEEEEEEcccccccccEEEEEEccHHHHHHHHHHccccEEcccEEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEcccccccEEEEEccHHHHHHHHHHHccccccccEEEEEEcccHHHHccccccc
ccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccHHHHHHHHcccccccccccEEEEEEccccccccccccccHHHHHHHHHHccccEcccccccccccccccccccccccEEEEEcccccccHHHHHHHHcccccEEEEEEEEEcccccccEEEEEEEccHHHHHHHHHHcccHHcccEEEEEccccHHHHHHHHHHHHHHHcccccccccccEEEEEEcccccccHHHHHHHHcccccEEEEEEEEccccccccEEEEEcccHHHHHHHHHHHcccEcccccEEEEEEcccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHccHccccccHHHHHHHHHHHcHHHHccccccccccccEEEEEEcccccccccccHHHHHHHHHHHHHHccccEEEEEEccccccEEEEEcccHHHHHHHHHHHcccEEcccEEEEEEcccHHHHHHccccc
MDFDEYEYLEKMvenpepakeketangdgnvksedrvrsrsskcksdekvedydddghrsrgsksrdesrnhdrrkerdsschrswsrdggrdrprsswehrdrdterdrdrdreerngrdrnrdrgrdrdrrerdhdtdrdrekdkekerekshrsgsqseryrsdrderersrdREVIERERSRDREVIERERSRDREVIERERSRDRELKEREKeresrdndkesRDNVMAIcrrpkekkeqvepevdperdqRTVFAYQICLKADERDVYEFFSragkvrdvrlimdrnsrrskgvgyvefYDVMSVPMAIalsgqpllgqpvmvkpseaeknlvqsnssiagasgggtgpysggarrLYVGNLHFNMTEDQLRQVfepfgtvelvqlpldetghckgfgfvQFARLEDARNALNLNGQLEIVGRAIKVSAvtdqsglqdlganttgdfdddeggglsLNARSRALLMQKLdrsgsattiagsavtpavnstalplptapllgaasavstlvpplvqgtvpthpgqlgtalqvptasvpifdtigvpseclllknmfdpknetyeEFDMDIKEDVEgecskfgklkHIFVEKDSAGFVYLRFENTQSAFAAQRALHGRWfagkmitatfmvpqtyeakfpdsi
MDFDEYEYLEKmvenpepakeketangdgnvksedrvrsrsskcksdekvedydddghrsrgsksrdesrnhdrrkerdsschrswsrdggrdrprsswehrdrdterdrdrdreerngrdrnrdrgrdrdrrerdhdtdrdrekdkekerekshrsgsqseryrsdrderersrdrevierersrdrevierersrdrevierersrdrelkerekeresrdndkesrdnvmaicrrpkekkeqvepevdperdqrtVFAYQIClkaderdvyeffsragkvrdvrlimdrnsrrskgvgyVEFYDVMSVPMAIALSGQPLLGQPVMVKPSEAEKNLVQsnssiagasgggtgpySGGARRLYVGNLHFNMTEDQLRQVFEPFGTVELVQLPLDETGHCKGFGFVQFARLEDARNALNLNGQLEIVGRAIKVSAVTDQSGLQDLGANTTGDFDDDEGGGLSLNARSRALLMQKLDRSGSATTIAGSAVTPAVNSTALPLPTAPLLGAASAVSTLVPPLVQGTVPTHPGQLGTALQVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTyeakfpdsi
MDFDEYEYLEKMVENPEPAKEKETANGDGNVKSEDRVRSRSSKCKSDEKVEDYDDDGHRSRGSKSRDESRNHDRRKERDSSCHrswsrdggrdrprsswehrdrdterdrdrdreerngrdrnrdrgrdrdrrerdhdtdrdrekdkekerekSHRSGSQseryrsdrderersrdrevierersrdrevierersrdrevierersrdrelkerekeresrdNDKESRDNVMAICRRpkekkeqvepevdpeRDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMSVPMAIALSGQPLLGQPVMVKPSEAEKNLVQsnssiagasgggtgpysggaRRLYVGNLHFNMTEDQLRQVFEPFGTVELVQLPLDETGHCKGFGFVQFARLEDARNALNLNGQLEIVGRAIKVSAVTDQSGLQDLGANTTgdfdddegggLSLNARSRALLMQKLDRSGSATTIAGSAVTPAVNstalplptapllgaasaVSTLVPPLVQGTVPTHPGQLGTALQVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKFPDSI
*****************************************************************************************************************************************************************************************************************************************************************TVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMSVPMAIALSGQPLLG*********************************GGARRLYVGNLHFNMTEDQLRQVFEPFGTVELVQLPLDETGHCKGFGFVQFARLEDARNALNLNGQLEIVGRAIKVSAVTD*****************************************************AVNSTALPLPTAPLLGAASAVSTLVPPLVQGTVPTHPGQLGTALQVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTY********
*DFDEYE**********************************************************************************************************************************************************************************************************************************************************TVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMSVPMAIALSGQPLLGQPVMVK*******************************RLYVGNLHFNMTEDQLRQVFEPFGTVELVQLPLDETGHCKGFGFVQFARLEDARNALNLNGQLEIVGRAIKV************************************************************************************************************************CLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKFPDS*
MDFDEYEYLEKMVENP********************************************************************************************************************************************************************************************************************RDNVMAICRRP**************RDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMSVPMAIALSGQPLLGQPVMVKPSEAEKNLVQSNSSIAGASGGGTGPYSGGARRLYVGNLHFNMTEDQLRQVFEPFGTVELVQLPLDETGHCKGFGFVQFARLEDARNALNLNGQLEIVGRAIKVSAVTDQSGLQDLGANTTGDFDDDEGGGLSLNARSRALLMQKLDRSGSATTIAGSAVTPAVNSTALPLPTAPLLGAASAVSTLVPPLVQGTVPTHPGQLGTALQVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKFPDSI
*DFDEYEYLEKMVEN*************************************************************************************************************************************************************************************RDREVIERERSRDRELKEREKERESRDNDKESRDNVMAICR****************RDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMSVPMAIALSGQPLLGQPVMVKPSEAEKNLVQSNSSIAGASGGGTGPYSGGARRLYVGNLHFNMTEDQLRQVFEPFGTVELVQLPLDETGHCKGFGFVQFARLEDARNALNLNGQLEIVGRAIKVSAVTDQSGLQDLGANTTGDFDDDEGGGLSLNARSRALLMQKLDRSGSATTIAGSAVTPAVNSTALPLPTAPLLGAASAVSTLVPPLVQGTVPTHPGQLGTALQVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKFPD**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFDEYEYLEKMVENPEPAKEKETANGDGNVKSEDRVRSRSSKCKSDEKVEDYDDDGHRSRGSKSRDESRNHDRRKERDSSCHRSWSRDGGRDRPRSSWEHRDRDTERDRDRDREERNGRDRNRDRGRDRDRRERDHDTDRDREKDKEKEREKSHRSGSQSERYRSDRDERERSRDREVIERERSRDREVIERERSRDREVIERERSRDRELKEREKERESRDNDKESRDNVMAICRRPKEKKEQVEPEVDPERDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMSVPMAIALSGQPLLGQPVMVKPSEAEKNLVQSNSSIAGASGGGTGPYSGGARRLYVGNLHFNMTEDQLRQVFEPFGTVELVQLPLDETGHCKGFGFVQFARLEDARNALNLNGQLEIVGRAIKVSAVTDQSGLQDLGANTTGDFDDDEGGGLSLNARSRALLMQKLDRSGSATTIAGSAVTPAVNSTALPLPTAPLLGAASAVSTLVPPLVQGTVPTHPGQLGTALQVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEKDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKFPDSI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query647 2.2.26 [Sep-21-2011]
Q8VH51530 RNA-binding protein 39 OS yes no 0.582 0.711 0.432 5e-73
Q14498530 RNA-binding protein 39 OS yes no 0.582 0.711 0.432 6e-73
Q5RC80524 RNA-binding protein 39 OS yes no 0.574 0.709 0.428 2e-72
O13845603 RNA-binding protein rsd1 yes no 0.559 0.600 0.335 3e-52
Q86U06439 Probable RNA-binding prot no no 0.421 0.621 0.424 3e-46
P27476414 Nuclear localization sequ yes no 0.242 0.379 0.333 1e-13
Q5RF26712 Nucleolin OS=Pongo abelii no no 0.256 0.233 0.302 2e-13
P19338710 Nucleolin OS=Homo sapiens no no 0.256 0.233 0.302 2e-13
Q4R4J7711 Nucleolin OS=Macaca fasci N/A no 0.256 0.233 0.302 2e-13
P20397651 Nucleolin OS=Xenopus laev N/A no 0.248 0.247 0.311 3e-13
>sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 Back     alignment and function desciption
 Score =  276 bits (705), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 178/412 (43%), Positives = 240/412 (58%), Gaps = 35/412 (8%)

Query: 240 KEKKEQVEPEVDPERDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKG 299
           +E  + + PE   ERD RTVF  Q+  +   RD+ EFFS  GKVRDVR+I DRNSRRSKG
Sbjct: 139 REPIDNLTPE---ERDARTVFCMQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKG 195

Query: 300 VGYVEFYDVMSVPMAIALSGQPLLGQPVMVKPSEAEKNLVQSNSSIAGASGGGTGPYSGG 359
           + YVEF DV SVP+AI L+GQ +LG P++V+ S+AEKN        A A        S G
Sbjct: 196 IAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNR-------AAAMANNLQKGSAG 248

Query: 360 ARRLYVGNLHFNMTEDQLRQVFEPFGTVELVQLPLD-ETGHCKGFGFVQFARLEDARNAL 418
             RLYVG+LHFN+TED LR +FEPFG +E +QL +D ETG  KG+GF+ F+  E A+ AL
Sbjct: 249 PMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSDSECAKKAL 308

Query: 419 -NLNGQLEIVGRAIKVSAVTDQSGLQDLGANTTGDFDDDEGGGLSLNARSRALLMQKLDR 477
             LNG  E+ GR +KV  VT+++      A++  D D+ E  G+ L    R  LM +L  
Sbjct: 309 EQLNG-FELAGRPMKVGHVTERTDASS--ASSFLDSDELERTGIDLGTTGRLQLMARLAE 365

Query: 478 SGSATTIAGSAVTPAVNSTALPLPTAPLLGAASAVSTLVPPLVQGTVPTHPGQLGTALQV 537
                   G  + PA    AL +  +   GA +  S ++    + +  T    L  A  V
Sbjct: 366 G------TGLQIPPAAQQ-ALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASV 418

Query: 538 -PTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVEK 596
            P A           ++C  L NMF+P+ E    +D +IK+DV  EC+K G + HI+V+K
Sbjct: 419 QPLA-----------TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDK 467

Query: 597 DSA-GFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKFPDSI 647
           +SA G VY++  +  +A AA  ALHGRWFAGKMITA ++   TY   FPDS+
Sbjct: 468 NSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSM 519
Transcriptional coactivator for steroid nuclear receptors ESR1/ER-alpha and ESR2/ER-beta, and JUN/AP-1. May be involved in pre-mRNA splicing process.
Mus musculus (taxid: 10090)
>sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 Back     alignment and function description
>sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 Back     alignment and function description
>sp|O13845|RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsd1 PE=1 SV=2 Back     alignment and function description
>sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 Back     alignment and function description
>sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 Back     alignment and function description
>sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 Back     alignment and function description
>sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 Back     alignment and function description
>sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query647
359475014609 PREDICTED: RNA-binding protein rsd1-like 0.924 0.981 0.626 0.0
356536386597 PREDICTED: RNA-binding protein 39-like [ 0.918 0.994 0.609 0.0
356575464600 PREDICTED: RNA-binding protein 39-like [ 0.925 0.998 0.609 0.0
297744588427 unnamed protein product [Vitis vinifera] 0.633 0.960 0.796 0.0
255550678609 splicing factor, putative [Ricinus commu 0.596 0.633 0.786 1e-178
334184263610 splicing factor, CC1-like protein [Arabi 0.924 0.980 0.596 1e-168
334184261599 splicing factor, CC1-like protein [Arabi 0.901 0.973 0.590 1e-166
449454219562 PREDICTED: RNA-binding protein 39-like [ 0.859 0.989 0.594 1e-159
326504734592 predicted protein [Hordeum vulgare subsp 0.871 0.952 0.547 1e-157
326523595592 predicted protein [Hordeum vulgare subsp 0.871 0.952 0.547 1e-157
>gi|359475014|ref|XP_002279887.2| PREDICTED: RNA-binding protein rsd1-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/656 (62%), Positives = 464/656 (70%), Gaps = 58/656 (8%)

Query: 1   MDFDEYEYLEKMVENPEPAKEKETANG-DGNVKSEDRVRSRSSKCKSDEKVEDYDDDGHR 59
           MDFDEY+YLEK VENPE  K KET NG D  VKS ++                      R
Sbjct: 1   MDFDEYDYLEKTVENPESQKVKETVNGGDETVKSGEK---------------------ER 39

Query: 60  SRGSKSRDESRNHDRRKERDSSCHRSWSRDGGRDRPRSSWEHRDRDTERDRDRDREERNG 119
           SR SK + E  +     + D    RS S D  RD               DR ++R   + 
Sbjct: 40  SRSSKHKSEDND----DDLDRRLKRSKSGDDSRDH--------------DRRKERGSSHP 81

Query: 120 RDRNRDRGRDRDRRERDHDTDRDRE-------KDKEKEREKSHRSGSQSERYRSDRDERE 172
           R  +RD  RDR R  R+H                KE++REK        +R R +RD   
Sbjct: 82  RSSSRDGERDRHRSSREHRERDRDRDRDREERNGKERDREKDRNRERDRDRDRRERDRES 141

Query: 173 RSRDREVIERERSRDREVIERERSRDREVIERERSRDRELKEREKERESRDNDKESRDNV 232
                   ERERSR       +   +R+  +RERSRDRE KERE+ERE R+ D+E+R + 
Sbjct: 142 ERERERERERERSRRSRSRSEKHLSERDEKDRERSRDRENKEREREREIRERDRETRRH- 200

Query: 233 MAICRRPKEKKEQV-EPEVDPERDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMD 291
                  K+KKE+V EPE DPERDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMD
Sbjct: 201 -------KDKKEEVAEPEADPERDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMD 253

Query: 292 RNSRRSKGVGYVEFYDVMSVPMAIALSGQPLLGQPVMVKPSEAEKNLVQSNSSIAGASGG 351
           RNSRRSKGVGY+EFYD MSVPMAIALSGQPLLGQPVMVKPSEAEKNLVQS ++ AG  GG
Sbjct: 254 RNSRRSKGVGYIEFYDAMSVPMAIALSGQPLLGQPVMVKPSEAEKNLVQSTTAAAGGPGG 313

Query: 352 GTGPYSGGARRLYVGNLHFNMTEDQLRQVFEPFGTVELVQLPLD-ETGHCKGFGFVQFAR 410
             GPYSGGARRLYVGNLHFN+TEDQLRQVFEPFGTVELVQLP D ETGHCKGFGFVQFAR
Sbjct: 314 LIGPYSGGARRLYVGNLHFNITEDQLRQVFEPFGTVELVQLPTDLETGHCKGFGFVQFAR 373

Query: 411 LEDARNALNLNGQLEIVGRAIKVSAVTDQSGLQDLGANTTGDFDDDEGGGLSLNARSRAL 470
           LEDAR A +LNGQL+I GR IKVS VTDQ+GLQD+GAN     DDDEGGGLSLNARSRA+
Sbjct: 374 LEDARAAQSLNGQLDIAGRTIKVSVVTDQAGLQDIGANAGDF-DDDEGGGLSLNARSRAI 432

Query: 471 LMQKLDRSGSATTIAGSAVTPAVNSTALPLPTAPLLGAASAVSTLVPPLVQGTVPTHPGQ 530
           LMQKLDRSG+   IAGS  +P +N+  LPL TAP+LGAA  VS LV PLVQ  VP   G 
Sbjct: 433 LMQKLDRSGTTPGIAGSLGSPVLNNPGLPLSTAPILGAAPVVSPLVAPLVQAPVPGLAGL 492

Query: 531 LGTALQVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLK 590
            G  LQVP  +VP  DTIGVPSECL+LKNMFDPK ET  +FD+DIKEDV+ ECSKFG +K
Sbjct: 493 PGAGLQVPAVTVPSIDTIGVPSECLMLKNMFDPKLETEPDFDLDIKEDVQDECSKFGTVK 552

Query: 591 HIFVEKDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKFPDS 646
           HI+V+K+SAGFV+LRFENTQ+A +AQRALHGRWFAGKMITATFM+PQ YEAKFPDS
Sbjct: 553 HIYVDKNSAGFVFLRFENTQAAISAQRALHGRWFAGKMITATFMLPQNYEAKFPDS 608

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356536386|ref|XP_003536719.1| PREDICTED: RNA-binding protein 39-like [Glycine max] Back     alignment and taxonomy information
>gi|356575464|ref|XP_003555861.1| PREDICTED: RNA-binding protein 39-like [Glycine max] Back     alignment and taxonomy information
>gi|297744588|emb|CBI37850.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255550678|ref|XP_002516388.1| splicing factor, putative [Ricinus communis] gi|223544486|gb|EEF46005.1| splicing factor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|334184263|ref|NP_001189538.1| splicing factor, CC1-like protein [Arabidopsis thaliana] gi|330251466|gb|AEC06560.1| splicing factor, CC1-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334184261|ref|NP_001189537.1| splicing factor, CC1-like protein [Arabidopsis thaliana] gi|330251465|gb|AEC06559.1| splicing factor, CC1-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449454219|ref|XP_004144853.1| PREDICTED: RNA-binding protein 39-like [Cucumis sativus] gi|449506986|ref|XP_004162902.1| PREDICTED: RNA-binding protein 39-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|326504734|dbj|BAK06658.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|326523595|dbj|BAJ92968.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query647
TAIR|locus:2178198527 AT5G09880 [Arabidopsis thalian 0.468 0.574 0.554 2.4e-85
UNIPROTKB|E1BRU3529 LOC100858247 "Uncharacterized 0.346 0.423 0.451 7.9e-75
UNIPROTKB|E2R4L0530 RBM39 "Uncharacterized protein 0.346 0.422 0.451 2.1e-74
UNIPROTKB|Q14498530 RBM39 "RNA-binding protein 39" 0.346 0.422 0.451 2.1e-74
MGI|MGI:2157953530 Rbm39 "RNA binding motif prote 0.346 0.422 0.451 3.3e-74
RGD|1310071524 Rbm39 "RNA binding motif prote 0.346 0.427 0.451 3.3e-74
UNIPROTKB|F1MA64530 Rbm39 "Protein Rbm39" [Rattus 0.346 0.422 0.451 3.3e-74
ZFIN|ZDB-GENE-040426-2852523 rbm39a "RNA binding motif prot 0.346 0.428 0.447 1.4e-73
UNIPROTKB|F6QIA5525 RBM39 "Uncharacterized protein 0.346 0.426 0.451 1.8e-73
UNIPROTKB|F2Z5I2525 RBM39 "Uncharacterized protein 0.346 0.426 0.451 1.8e-73
TAIR|locus:2178198 AT5G09880 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 764 (274.0 bits), Expect = 2.4e-85, Sum P(2) = 2.4e-85
 Identities = 179/323 (55%), Positives = 206/323 (63%)

Query:   254 RDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMSVPM 313
             RDQRTVFAYQ+ LKA ERDVYEFFS+AGKVRDVRLIMDRNSRRSKGVGY+EFYDVMSVPM
Sbjct:   165 RDQRTVFAYQMPLKATERDVYEFFSKAGKVRDVRLIMDRNSRRSKGVGYIEFYDVMSVPM 224

Query:   314 AIALSGQPLLGQPVMVKPSEAEKNLVQXXXXXXXXXXXXXXXXXXXXRRLYVGNLHFNMT 373
             AIALSGQ  LGQPVMVKPSEAEKNL Q                    R+LYVGNLHFNM+
Sbjct:   225 AIALSGQLFLGQPVMVKPSEAEKNLAQSNSTTVGGTGPAD-------RKLYVGNLHFNMS 277

Query:   374 EDQLRQVFEPFGTVELVQLPLD-ETGHCKGFGFVQFARLEDARNA-LNLNGQLEIVGRAI 431
             E QLRQ+FE FG VELVQLPLD ETG CKGFGF+QF +LE ++ A + LNG+LEI GR I
Sbjct:   278 ELQLRQIFEAFGPVELVQLPLDPETGQCKGFGFIQFVQLEHSKAAQIALNGKLEIAGRTI 337

Query:   432 KVSAVTDQSGLQDLGANTTXXXXXXXXXXLSLNARSRALLMQKLDRSGSATTIAGSAVTP 491
             KVS+V+D  G QD  A  +          L+LNA+SRA+LMQKLDRSG AT+I GS   P
Sbjct:   338 KVSSVSDHIGTQD-SAPKSADFDDDDGGGLALNAQSRAMLMQKLDRSGIATSIVGSLGVP 396

Query:   492 AVNXXXXXXXXXXXXXXXXXV-STLVPPLVQGTV--PTHPGQLGTALQVPTASVPIFDTI 548
              +N                 + +T +P  V   V  P+    L       T + P FD  
Sbjct:   397 GLNGAAFNQPGMNPSFPTSVLPTTAIPSFVNEHVGLPSECLLLKNMFDPATETEPNFDLE 456

Query:   549 ---GVPSECLLLKNMFDPKNETY 568
                 V  EC    + + P N  Y
Sbjct:   457 IRDDVADEC----SKYGPVNHIY 475
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0003723 "RNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA
GO:0006397 "mRNA processing" evidence=IEA
UNIPROTKB|E1BRU3 LOC100858247 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4L0 RBM39 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q14498 RBM39 "RNA-binding protein 39" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2157953 Rbm39 "RNA binding motif protein 39" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310071 Rbm39 "RNA binding motif protein 39" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MA64 Rbm39 "Protein Rbm39" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2852 rbm39a "RNA binding motif protein 39a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F6QIA5 RBM39 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5I2 RBM39 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00036145001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (577 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query647
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-140
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 9e-42
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 4e-35
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 3e-34
cd1253685 cd12536, RRM1_RBM39, RNA recognition motif 1 in ve 1e-25
cd1253785 cd12537, RRM1_RBM23, RNA recognition motif 1 in ve 2e-25
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 3e-25
smart0036073 smart00360, RRM, RNA recognition motif 1e-21
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-20
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-19
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 9e-18
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-16
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 1e-16
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 1e-15
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 3e-15
cd1228692 cd12286, RRM_Man1, RNA recognition motif in inner 4e-15
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 4e-15
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 5e-15
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 6e-15
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-14
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 3e-14
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 3e-14
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 4e-14
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 8e-14
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 9e-14
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 2e-13
PRK12678672 PRK12678, PRK12678, transcription termination fact 2e-13
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 5e-13
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 5e-13
PRK12678672 PRK12678, PRK12678, transcription termination fact 6e-13
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 6e-13
smart0036073 smart00360, RRM, RNA recognition motif 7e-13
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 8e-13
PRK12678672 PRK12678, PRK12678, transcription termination fact 1e-12
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 1e-12
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 1e-12
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 1e-12
PRK12678672 PRK12678, PRK12678, transcription termination fact 4e-12
PRK12678672 PRK12678, PRK12678, transcription termination fact 4e-12
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 4e-12
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 4e-12
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 6e-12
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 7e-12
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 7e-12
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 1e-11
PRK12678672 PRK12678, PRK12678, transcription termination fact 1e-11
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 1e-11
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-11
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 2e-11
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 2e-11
cd1228291 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 6e-11
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 6e-11
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 8e-11
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 8e-11
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-10
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 1e-10
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 1e-10
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 1e-10
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-10
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 2e-10
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 2e-10
cd12287102 cd12287, RRM_U2AF35_like, RNA recognition motif in 3e-10
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 3e-10
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 5e-10
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 6e-10
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 7e-10
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 7e-10
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 7e-10
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 8e-10
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 9e-10
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 9e-10
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-09
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-09
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 1e-09
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 1e-09
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 1e-09
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 1e-09
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 2e-09
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 2e-09
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2e-09
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 2e-09
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 2e-09
cd1223082 cd12230, RRM1_U2AF65, RNA recognition motif 1 foun 2e-09
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 3e-09
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 3e-09
cd1246588 cd12465, RRM_UHMK1, RNA recognition motif found in 3e-09
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 3e-09
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 3e-09
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 3e-09
pfam1389356 pfam13893, RRM_5, RNA recognition motif 3e-09
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 4e-09
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 4e-09
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 4e-09
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 5e-09
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 5e-09
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 5e-09
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 5e-09
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 8e-09
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 9e-09
cd12540105 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 1e-08
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 1e-08
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 1e-08
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 1e-08
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-08
PRK12678672 PRK12678, PRK12678, transcription termination fact 2e-08
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-08
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 2e-08
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 2e-08
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 2e-08
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 2e-08
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 2e-08
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 3e-08
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 3e-08
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 3e-08
cd1264898 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 i 3e-08
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 3e-08
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 3e-08
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 5e-08
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 5e-08
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 5e-08
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 5e-08
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 6e-08
cd1264796 cd12647, RRM_UHM_SPF45, RNA recognition motif in U 7e-08
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 7e-08
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 9e-08
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-07
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 1e-07
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 2e-07
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 2e-07
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 2e-07
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 2e-07
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 2e-07
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 3e-07
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 3e-07
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 3e-07
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 3e-07
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 3e-07
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 3e-07
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 3e-07
smart0036073 smart00360, RRM, RNA recognition motif 4e-07
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 4e-07
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 4e-07
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 4e-07
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 4e-07
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 4e-07
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 5e-07
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 5e-07
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 6e-07
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 6e-07
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 8e-07
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 8e-07
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 8e-07
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 9e-07
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 9e-07
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 9e-07
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 9e-07
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 1e-06
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 1e-06
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 1e-06
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 1e-06
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 1e-06
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 1e-06
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 1e-06
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 2e-06
pfam1389356 pfam13893, RRM_5, RNA recognition motif 2e-06
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 2e-06
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 2e-06
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-06
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 2e-06
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 2e-06
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 2e-06
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 3e-06
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 3e-06
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 3e-06
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 3e-06
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 3e-06
PLN03121243 PLN03121, PLN03121, nucleic acid binding protein; 3e-06
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 3e-06
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 3e-06
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 3e-06
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 4e-06
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 4e-06
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 4e-06
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 4e-06
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 4e-06
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 4e-06
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 4e-06
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 5e-06
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 5e-06
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 5e-06
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 6e-06
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 6e-06
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 6e-06
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 6e-06
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 6e-06
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 6e-06
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 6e-06
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 6e-06
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 7e-06
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 8e-06
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 9e-06
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 9e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-05
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 1e-05
cd1240375 cd12403, RRM1_NCL, RNA recognition motif 1 in vert 1e-05
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 1e-05
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 1e-05
PLN03120260 PLN03120, PLN03120, nucleic acid binding protein; 1e-05
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 1e-05
cd1226969 cd12269, RRM_Vip1_like, RNA recognition motif in a 1e-05
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 1e-05
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 1e-05
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 2e-05
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 2e-05
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 2e-05
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 2e-05
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 2e-05
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 2e-05
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 2e-05
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 2e-05
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 2e-05
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 2e-05
cd1238576 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 2e-05
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 2e-05
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 2e-05
cd12539103 cd12539, RRM_U2AF35B, RNA recognition motif in spl 2e-05
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 2e-05
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 3e-05
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 3e-05
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 3e-05
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 3e-05
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 3e-05
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 3e-05
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 3e-05
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 3e-05
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 3e-05
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 3e-05
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 3e-05
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 3e-05
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 4e-05
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 4e-05
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 4e-05
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 4e-05
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 4e-05
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 5e-05
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 5e-05
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 5e-05
cd1261181 cd12611, RRM1_NGR1_NAM8_like, RNA recognition moti 5e-05
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 6e-05
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 6e-05
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 6e-05
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 6e-05
smart0036170 smart00361, RRM_1, RNA recognition motif 6e-05
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 7e-05
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 7e-05
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 7e-05
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 8e-05
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 8e-05
cd1246082 cd12460, RRM2_CID8_like, RNA recognition motif 2 i 8e-05
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 8e-05
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 8e-05
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 8e-05
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 8e-05
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 9e-05
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 9e-05
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 1e-04
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 1e-04
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 1e-04
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 1e-04
cd1245980 cd12459, RRM1_CID8_like, RNA recognition motif 1 i 1e-04
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 1e-04
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 1e-04
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 1e-04
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 1e-04
pfam08017393 pfam08017, Fibrinogen_BP, Fibrinogen binding prote 1e-04
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-04
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 2e-04
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 2e-04
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 2e-04
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 2e-04
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 2e-04
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 2e-04
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 2e-04
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 2e-04
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 3e-04
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 3e-04
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 3e-04
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 3e-04
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 3e-04
cd1249774 cd12497, RRM3_RBM47, RNA recognition motif 3 in ve 3e-04
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 3e-04
PTZ002661021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 3e-04
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 3e-04
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 3e-04
pfam0007670 pfam00076, RRM_1, RNA recognition motif 4e-04
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 4e-04
pfam08648158 pfam08648, DUF1777, Protein of unknown function (D 4e-04
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 4e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 4e-04
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 4e-04
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 4e-04
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 4e-04
PRK108111068 PRK10811, rne, ribonuclease E; Reviewed 5e-04
PTZ001212084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-04
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 5e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 5e-04
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 5e-04
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 5e-04
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 6e-04
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 6e-04
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 6e-04
cd1256872 cd12568, RRM3_MRD1, RNA recognition motif 3 in yea 6e-04
pfam1389356 pfam13893, RRM_5, RNA recognition motif 7e-04
cd1234271 cd12342, RRM_Nab3p, RNA recognition motif in yeast 7e-04
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 8e-04
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 8e-04
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 8e-04
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 8e-04
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 9e-04
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 0.001
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 0.001
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 0.001
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 0.001
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 0.001
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 0.001
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 0.001
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 0.001
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 0.001
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 0.001
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 0.001
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 0.001
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 0.001
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 0.001
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 0.001
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 0.002
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 0.002
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 0.002
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 0.002
pfam08017393 pfam08017, Fibrinogen_BP, Fibrinogen binding prote 0.002
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 0.002
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 0.002
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 0.002
cd1226282 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 0.002
cd1266277 cd12662, RRM3_MYEF2, RNA recognition motif 3 in ve 0.002
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 0.002
cd1229172 cd12291, RRM1_La, RNA recognition motif 1 in La au 0.002
cd1224772 cd12247, RRM2_U1A_like, RNA recognition motif 2 in 0.002
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 0.002
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 0.002
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 0.002
cd1258980 cd12589, RRM2_PSP1, RNA recognition motif 2 in ver 0.002
cd1266076 cd12660, RRM2_MYEF2, RNA recognition motif 2 in ve 0.002
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 0.003
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 0.003
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 0.003
pfam10243506 pfam10243, MIP-T3, Microtubule-binding protein MIP 0.003
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 0.003
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 0.003
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 0.003
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 0.003
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 0.003
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 0.003
cd1274988 cd12749, RRM4_RBM12, RNA recognition motif 4 in RN 0.003
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 0.004
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 0.004
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 0.004
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 0.004
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 0.004
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 0.004
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 0.004
cd1227471 cd12274, RRM2_NEFsp, RNA recognition motif 2 in ve 0.004
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information 
 Score =  415 bits (1068), Expect = e-140
 Identities = 208/514 (40%), Positives = 274/514 (53%), Gaps = 59/514 (11%)

Query: 135 RDHDTDRDREKDKEKEREKSHRSGSQSERYRSDRDERERSRDREVIERERSRDREVIERE 194
           R  D +R R ++  +  +K                 RERSR R    R R R R   +R+
Sbjct: 1   RYRDRERGRLRNDTRRSDKG----------------RERSRRRS---RSRDRSRRRRDRD 41

Query: 195 RSRDREVIERERSRDRELKEREKERESRDNDKESRDNVMAICRRPKEKKEQVEPEVDPER 254
             R R    R RS +R       +R  R +D+ S  N               EP  + ER
Sbjct: 42  YYRGRRGRSRSRSPNR-YYRPRGDRSYRRDDRRSGRN-------------TKEPLTEAER 87

Query: 255 DQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMSVPMA 314
           D RTVF  Q+ LKA ERD+YEFFS+ GKVRDV+ I DRNSRRSKGV YVEFYDV SV  A
Sbjct: 88  DDRTVFVLQLALKARERDLYEFFSKVGKVRDVQCIKDRNSRRSKGVAYVEFYDVESVIKA 147

Query: 315 IALSGQPLLGQPVMVKPSEAEKNLVQSNSSIAGASGGGTGPYSGGARRLYVGNLHFNMTE 374
           +AL+GQ LLG+P++V+ S+AEKN     ++       G  P      +LYVGNLHFN+TE
Sbjct: 148 LALTGQMLLGRPIIVQSSQAEKNRAAKAAT----HQPGDIP---NFLKLYVGNLHFNITE 200

Query: 375 DQLRQVFEPFGTVELVQLPLD-ETGHCKGFGFVQFARLEDARNALNLNGQLEIVGRAIKV 433
            +LRQ+FEPFG +E VQL  D ETG  KGFGF+QF   E+A+ AL +    E+ GR IKV
Sbjct: 201 QELRQIFEPFGDIEDVQLHRDPETGRSKGFGFIQFHDAEEAKEALEVMNGFELAGRPIKV 260

Query: 434 SAVTDQSGLQDLGANTTGDFDDDEGGGLSLNARSRALLMQKLDRSGSATTIAGSAVTPAV 493
               D + L D  ANT  D D  +  G +LN   R  LM+KLDR        G  + P  
Sbjct: 261 GYAQDSTYLLD-AANTFEDIDKQQQMGKNLNTEEREQLMEKLDRDD----GDGGLLIPGT 315

Query: 494 NSTALPLPTAPLLGAASAVSTLVPPLVQGTVPTHPGQLGTALQVPTASVPIFDTIGVPSE 553
            S          L        ++ P     +P+       A+    + VP      + + 
Sbjct: 316 GSKI-------ALMQKLQRDGIIDPN----IPSRYATGALAIMARNSFVPS-TNNNLATT 363

Query: 554 CLLLKNMFDPKNETYEEFDMDIKEDVEGECSKFGKLKHIFVE-KDSAGFVYLRFENTQSA 612
           CL+L NMFDP  E    FD +I +DV+ ECSK+G + HI+V+ K+SAG +YL+F +  +A
Sbjct: 364 CLVLSNMFDPATEEEPNFDNEILDDVKEECSKYGGVVHIYVDTKNSAGKIYLKFSSVDAA 423

Query: 613 FAAQRALHGRWFAGKMITATFMVPQTYEAKFPDS 646
            AA +AL+GR+F GKMITA F+V   Y+      
Sbjct: 424 LAAFQALNGRYFGGKMITAAFVVNDVYDMSCLPK 457

This model represents a subfamily of RNA splicing factors including the Pad-1 protein (N. crassa), CAPER (M. musculus) and CC1.3 (H.sapiens). These proteins are characterized by an N-terminal arginine-rich, low complexity domain followed by three (or in the case of 4 H. sapiens paralogs, two) RNA recognition domains (rrm: pfam00706). These splicing factors are closely related to the U2AF splicing factor family (TIGR01642). A homologous gene from Plasmodium falciparum was identified in the course of the analysis of that genome at TIGR and was included in the seed. Length = 457
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240980 cd12536, RRM1_RBM39, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) Back     alignment and domain information
>gnl|CDD|240981 cd12537, RRM1_RBM23, RNA recognition motif 1 in vertebrate probable RNA-binding protein 23 (RBM23) Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240732 cd12286, RRM_Man1, RNA recognition motif in inner nuclear membrane protein Man1 (Man1) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240728 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240733 cd12287, RRM_U2AF35_like, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor U2AF 35 kDa subunit (U2AF35) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240676 cd12230, RRM1_U2AF65, RNA recognition motif 1 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240911 cd12465, RRM_UHMK1, RNA recognition motif found in U2AF homology motif kinase 1 (UHMK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240984 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 (U2AFBPL) and similar proteins Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241092 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 in UHM domain of poly(U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241091 cd12647, RRM_UHM_SPF45, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|215589 PLN03121, PLN03121, nucleic acid binding protein; Provisional Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240849 cd12403, RRM1_NCL, RNA recognition motif 1 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|215588 PLN03120, PLN03120, nucleic acid binding protein; Provisional Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240715 cd12269, RRM_Vip1_like, RNA recognition motif in a group of uncharacterized plant proteins similar to fission yeast Vip1 Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240831 cd12385, RRM1_hnRNPM_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240983 cd12539, RRM_U2AF35B, RNA recognition motif in splicing factor U2AF 35 kDa subunit B (U2AF35B) Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|241055 cd12611, RRM1_NGR1_NAM8_like, RNA recognition motif 1 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|214637 smart00361, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240906 cd12460, RRM2_CID8_like, RNA recognition motif 2 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|116627 pfam08017, Fibrinogen_BP, Fibrinogen binding protein Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|219953 pfam08648, DUF1777, Protein of unknown function (DUF1777) Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241012 cd12568, RRM3_MRD1, RNA recognition motif 3 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|116627 pfam08017, Fibrinogen_BP, Fibrinogen binding protein Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241106 cd12662, RRM3_MYEF2, RNA recognition motif 3 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|240693 cd12247, RRM2_U1A_like, RNA recognition motif 2 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241033 cd12589, RRM2_PSP1, RNA recognition motif 2 in vertebrate paraspeckle protein 1 (PSP1 or PSPC1) Back     alignment and domain information
>gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|241193 cd12749, RRM4_RBM12, RNA recognition motif 4 in RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240720 cd12274, RRM2_NEFsp, RNA recognition motif 2 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 647
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 100.0
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 100.0
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 100.0
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 100.0
KOG0144510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 100.0
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 100.0
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 100.0
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 100.0
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 100.0
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.97
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.96
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.96
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.95
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.95
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.95
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.94
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.93
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.93
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.93
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.92
KOG1190 492 consensus Polypyrimidine tract-binding protein [RN 99.92
KOG0127678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.92
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.9
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.9
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.88
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 99.88
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.88
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.88
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.86
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.86
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.85
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.83
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 99.82
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.82
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.8
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 99.8
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 99.78
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.76
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 99.74
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.74
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 99.73
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.72
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.72
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 99.68
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.67
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.65
KOG1548382 consensus Transcription elongation factor TAT-SF1 99.62
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 99.6
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.57
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.57
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.54
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.53
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 99.49
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.48
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.43
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.43
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.42
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 99.41
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.41
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 99.4
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 99.4
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.38
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.38
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.38
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 99.38
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.36
PLN03120260 nucleic acid binding protein; Provisional 99.36
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.35
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.32
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.32
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.32
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.32
KOG0122270 consensus Translation initiation factor 3, subunit 99.31
KOG4207256 consensus Predicted splicing factor, SR protein su 99.3
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.3
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.3
PLN03121243 nucleic acid binding protein; Provisional 99.3
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.29
KOG4207256 consensus Predicted splicing factor, SR protein su 99.25
PLN03213 759 repressor of silencing 3; Provisional 99.25
KOG4660549 consensus Protein Mei2, essential for commitment t 99.25
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.24
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.24
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.22
PLN03120260 nucleic acid binding protein; Provisional 99.22
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.2
KOG0122270 consensus Translation initiation factor 3, subunit 99.2
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.2
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.18
smart0036272 RRM_2 RNA recognition motif. 99.17
KOG0132894 consensus RNA polymerase II C-terminal domain-bind 99.16
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.15
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 99.14
PLN03121243 nucleic acid binding protein; Provisional 99.14
smart0036071 RRM RNA recognition motif. 99.14
smart0036272 RRM_2 RNA recognition motif. 99.12
PLN03213 759 repressor of silencing 3; Provisional 99.1
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.1
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.05
KOG0108435 consensus mRNA cleavage and polyadenylation factor 99.03
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.03
smart0036071 RRM RNA recognition motif. 99.03
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.03
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.03
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 99.0
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.0
smart0036170 RRM_1 RNA recognition motif. 98.98
KOG0129520 consensus Predicted RNA-binding protein (RRM super 98.96
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 98.96
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.92
smart0036170 RRM_1 RNA recognition motif. 98.89
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 98.87
KOG1996378 consensus mRNA splicing factor [RNA processing and 98.83
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 98.82
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 98.81
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.77
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.76
KOG4210285 consensus Nuclear localization sequence binding pr 98.76
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.74
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 98.72
KOG0129520 consensus Predicted RNA-binding protein (RRM super 98.65
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.64
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 98.62
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.6
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 98.55
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.52
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.49
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.48
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 98.47
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 98.47
KOG2202 260 consensus U2 snRNP splicing factor, small subunit, 98.45
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.43
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.39
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.39
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.38
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.34
KOG0226290 consensus RNA-binding proteins [General function p 98.28
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 98.27
KOG4210285 consensus Nuclear localization sequence binding pr 98.27
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.16
KOG0226290 consensus RNA-binding proteins [General function p 98.1
KOG0151 877 consensus Predicted splicing regulator, contains R 98.09
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 98.09
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.08
KOG0151 877 consensus Predicted splicing regulator, contains R 98.04
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.97
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.95
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.87
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.85
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.77
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.72
KOG2416 718 consensus Acinus (induces apoptotic chromatin cond 97.66
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 97.65
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.6
KOG2314 698 consensus Translation initiation factor 3, subunit 97.54
KOG1995351 consensus Conserved Zn-finger protein [General fun 97.47
KOG1855 484 consensus Predicted RNA-binding protein [General f 97.46
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.29
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.29
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.25
KOG4849498 consensus mRNA cleavage factor I subunit/CPSF subu 97.23
KOG1996378 consensus mRNA splicing factor [RNA processing and 96.99
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 96.95
KOG2314 698 consensus Translation initiation factor 3, subunit 96.91
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.82
COG5175480 MOT2 Transcriptional repressor [Transcription] 96.77
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 96.73
KOG3152278 consensus TBP-binding protein, activator of basal 96.69
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.6
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 96.49
KOG1855484 consensus Predicted RNA-binding protein [General f 96.03
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 96.0
KOG3152278 consensus TBP-binding protein, activator of basal 95.98
PF04847 184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.89
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 95.61
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.41
KOG2135526 consensus Proteins containing the RNA recognition 95.4
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.29
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.15
PF1551973 RBM39linker: linker between RRM2 and RRM3 domains 94.96
PF08648180 DUF1777: Protein of unknown function (DUF1777); In 94.63
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 94.49
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 94.31
KOG2548653 consensus SWAP mRNA splicing regulator [RNA proces 94.2
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 94.18
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 94.15
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 92.82
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 92.72
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 92.62
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 92.45
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 92.36
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 92.33
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 92.17
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 92.02
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 92.02
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 91.71
PF15023166 DUF4523: Protein of unknown function (DUF4523) 90.73
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 90.72
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 90.01
KOG2318 650 consensus Uncharacterized conserved protein [Funct 89.38
KOG2135526 consensus Proteins containing the RNA recognition 89.18
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 89.09
KOG2068327 consensus MOT2 transcription factor [Transcription 89.01
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 88.12
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 88.07
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 87.89
KOG2591 684 consensus c-Mpl binding protein, contains La domai 87.7
KOG4019193 consensus Calcineurin-mediated signaling pathway i 87.29
KOG1847878 consensus mRNA splicing factor [RNA processing and 87.01
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 85.87
KOG2068 327 consensus MOT2 transcription factor [Transcription 85.17
KOG4246 1194 consensus Predicted DNA-binding protein, contains 83.06
KOG2591 684 consensus c-Mpl binding protein, contains La domai 82.28
KOG2318 650 consensus Uncharacterized conserved protein [Funct 82.23
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 81.27
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 80.07
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information 
Probab=100.00  E-value=2.7e-52  Score=453.75  Aligned_cols=369  Identities=48%  Similarity=0.749  Sum_probs=270.2

Q ss_pred             CCCCCeEEEecCCCCCCHHHHHHHHHhcCCeeEEEEeeeCCCCCcccEEEEEecccccHHHHHHhcCCccCCceEEEccC
Q 006398          253 ERDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMSVPMAIALSGQPLLGQPVMVKPS  332 (647)
Q Consensus       253 ~~~~~~v~v~~Lp~~~t~~~l~~~f~~~G~i~~v~~~~~~~tg~~~g~afV~f~~~~~a~~al~~~g~~~~g~~i~v~~~  332 (647)
                      ....++|||+|||+.+++++|.++|.+||.|..|.|+.++.+|.++|||||+|.+.++|.+||+|+|..|.|++|.|.++
T Consensus        86 ~~~~~~l~V~nlp~~~~~~~l~~~F~~~G~v~~v~i~~d~~~~~skg~afVeF~~~e~A~~Al~l~g~~~~g~~i~v~~~  165 (457)
T TIGR01622        86 ERDDRTVFVLQLALKARERDLYEFFSKVGKVRDVQCIKDRNSRRSKGVAYVEFYDVESVIKALALTGQMLLGRPIIVQSS  165 (457)
T ss_pred             ccCCcEEEEeCCCCCCCHHHHHHHHHhcCCeeEEEEeecCCCCCcceEEEEEECCHHHHHHHHHhCCCEECCeeeEEeec
Confidence            44568999999999999999999999999999999999999999999999999999999999999999999999999876


Q ss_pred             cchhhhcccccccCCCCCCCCCCCCCCCcEEEEcCCCCCCCHHHHHHhhccCCcEEEEEeccC-CCCCcceEEEEEeCCH
Q 006398          333 EAEKNLVQSNSSIAGASGGGTGPYSGGARRLYVGNLHFNMTEDQLRQVFEPFGTVELVQLPLD-ETGHCKGFGFVQFARL  411 (647)
Q Consensus       333 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nLp~~~~e~~l~~~f~~~G~v~~v~i~~~-~~g~~~g~afVef~~~  411 (647)
                      .............       .........+|||+|||..+++++|+++|++||.|..|.|+.+ .+|.++|||||+|.+.
T Consensus       166 ~~~~~~~~~~~~~-------~~~~~p~~~~l~v~nl~~~~te~~l~~~f~~~G~i~~v~~~~d~~~g~~~g~afV~f~~~  238 (457)
T TIGR01622       166 QAEKNRAAKAATH-------QPGDIPNFLKLYVGNLHFNITEQELRQIFEPFGDIEDVQLHRDPETGRSKGFGFIQFHDA  238 (457)
T ss_pred             chhhhhhhhcccc-------cCCCCCCCCEEEEcCCCCCCCHHHHHHHHHhcCCeEEEEEEEcCCCCccceEEEEEECCH
Confidence            5443322111110       0011223789999999999999999999999999999999988 4778999999999999


Q ss_pred             HHHHHHHHHcCCceecCeEEEEEEeecCCCCCCCCCCCCCCCCCCCCCCccCChHHHHHHHHHhccCCCCcccCCCCCCC
Q 006398          412 EDARNALNLNGQLEIVGRAIKVSAVTDQSGLQDLGANTTGDFDDDEGGGLSLNARSRALLMQKLDRSGSATTIAGSAVTP  491 (647)
Q Consensus       412 ~~A~~Al~~l~g~~~~g~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  491 (647)
                      ++|.+|+..|+|+.|.|+.|.|.|+.+....... .............+...+......++..+...+..    +....|
T Consensus       239 e~A~~A~~~l~g~~i~g~~i~v~~a~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~  313 (457)
T TIGR01622       239 EEAKEALEVMNGFELAGRPIKVGYAQDSTYLLDA-ANTFEDIDKQQQMGKNLNTEEREQLMEKLDRDDGD----GGLLIP  313 (457)
T ss_pred             HHHHHHHHhcCCcEECCEEEEEEEccCCCccccc-hhhhccccccccCCcCCCccchHHHHHhhccCCCC----ccccCC
Confidence            9999999999999999999999998855433222 21222233333333444444455555554433321    111111


Q ss_pred             cccCCCCCCCCcccccccccccccCCCCCCCCCCCCCCCCCccccCCCCCcCccCCCCCCcceEEeccCCCCCCCCchhh
Q 006398          492 AVNSTALPLPTAPLLGAASAVSTLVPPLVQGTVPTHPGQLGTALQVPTASVPIFDTIGVPSECLLLKNMFDPKNETYEEF  571 (647)
Q Consensus       492 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~V~nl~~p~~~~d~~~  571 (647)
                      ........+..   +.....+...++.......        .........++ ......++.||+|.||+.+.+..++.+
T Consensus       314 ~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~-~~~~~~~~~~l~l~n~~~~~~~~~~~~  381 (457)
T TIGR01622       314 GTGSKIALMQK---LQRDGIIDPNIPSRYATGA--------LAIMARNSFVP-STNNNLATTCLVLSNMFDPATEEEPNF  381 (457)
T ss_pred             Cccchhhhhcc---ccccccccccccccccccc--------cccccCCCCCC-cccCCCCCcEEEEecCCCCcccccchH
Confidence            11111111111   1111111111110000000        00000000000 011345788999999999999999999


Q ss_pred             hhhHHHHHHHHhhhcCCeEEEEEe-eCCCccEEEEeCChHHHHHHHHHHcCceeCCeEEEEEEeCchhhhccCCC
Q 006398          572 DMDIKEDVEGECSKFGKLKHIFVE-KDSAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQTYEAKFPD  645 (647)
Q Consensus       572 ~~~~~~dl~~~F~~fG~V~~v~i~-~~~~G~afV~F~~~e~A~~A~~~lnG~~~~gr~i~v~~~~~~~~~~~~~~  645 (647)
                      +++|++||+++|++||.|+.|.|. ..+.|+|||+|.++++|..|++.|||+.|+|+.|.|.|++++.|.+.||.
T Consensus       382 ~~~~~~dv~~e~~k~G~v~~v~v~~~~~~G~~fV~F~~~e~A~~A~~~lnGr~f~gr~i~~~~~~~~~~~~~~~~  456 (457)
T TIGR01622       382 DNEILDDVKEECSKYGGVVHIYVDTKNSAGKIYLKFSSVDAALAAFQALNGRYFGGKMITAAFVVNDVYDMSCLP  456 (457)
T ss_pred             HHHHHHHHHHHHHhcCCeeEEEEeCCCCceeEEEEECCHHHHHHHHHHhcCcccCCeEEEEEEEcHHHHHhhcCC
Confidence            999999999999999999999997 55789999999999999999999999999999999999999999999986

A homologous gene from Plasmodium falciparum was identified in the course of the analysis of that genome at TIGR and was included in the model.
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>PF15519 RBM39linker: linker between RRM2 and RRM3 domains in RBM39 protein; PDB: 3S6E_A 2LQ5_A Back     alignment and domain information
>PF08648 DUF1777: Protein of unknown function (DUF1777); InterPro: IPR013957 This entry shows eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG2548 consensus SWAP mRNA splicing regulator [RNA processing and modification] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4019 consensus Calcineurin-mediated signaling pathway inhibitor DSCR1 [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG1847 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG4246 consensus Predicted DNA-binding protein, contains SAP domain [General function prediction only] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query647
2cq4_A114 Solution Structure Of Rna Binding Domain In Rna Bin 6e-24
2lq5_A113 Nmr Structure Of The Rna Binding Motif 39 (Rbm39) F 2e-19
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 1e-17
3s6e_A114 Crystal Structure Of A Rna Binding Motif Protein 39 3e-17
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 1e-14
2fc9_A101 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 1e-09
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 6e-09
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 7e-09
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 1e-08
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 3e-08
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 3e-08
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 4e-08
2ku7_A140 Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric 5e-08
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 5e-08
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 5e-08
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 6e-08
3mdf_A85 Crystal Structure Of The Rrm Domain Of Cyclophilin 1e-07
3lpy_A79 Crystal Structure Of The Rrm Domain Of Cyp33 Length 1e-07
2kyx_A83 Solution Structure Of The Rrm Domain Of Cyp33 Lengt 1e-07
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 2e-07
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 2e-07
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 3e-07
2dny_A119 Solution Structure Of The Third Rna Binding Domain 5e-07
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 6e-07
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 7e-07
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 8e-07
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 7e-06
2dit_A112 Solution Structure Of The Rrm_1 Domain Of Hiv Tat S 8e-07
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 8e-07
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 7e-06
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 9e-07
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 7e-06
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 1e-06
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 8e-06
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-06
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 9e-06
3dxb_A222 Structure Of The Uhm Domain Of Puf60 Fused To Thior 1e-06
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 1e-06
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 1e-05
1fje_B175 Solution Structure Of Nucleolin Rbd12 In Complex Wi 1e-06
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 2e-06
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 2e-06
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 6e-04
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 2e-06
2cph_A107 Solution Structure Of The C-Terminal Rna Recognitio 4e-06
3b4d_A96 Crystal Structure Of Human Pabpn1 Rrm Length = 96 5e-06
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 5e-06
1opi_A104 Solution Structure Of The Third Rna Recognition Mot 6e-06
1o0p_A104 Solution Structure Of The Third Rna Recognition Mot 6e-06
2pe8_A105 Crystal Structure Of The Uhm Domain Of Human Spf45 8e-06
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 1e-05
3ue2_A118 Crystal Structure Of A Rna Binding Domain Of Poly-U 1e-05
3ucg_A89 Crystal Structure Of A Rna Binding Domain Of Hypoth 1e-05
1fjc_A96 Solution Structure Of Nucleolin Rbd2 Length = 96 1e-05
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 2e-05
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 2e-05
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 3e-05
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 1e-04
2xs2_A102 Crystal Structure Of The Rrm Domain Of Mouse Delete 3e-05
2xs2_A102 Crystal Structure Of The Rrm Domain Of Mouse Delete 2e-04
2dnk_A105 Solution Structure Of Rna Binding Domain In Bruno-L 3e-05
2cq3_A103 Solution Structure Of Rna Binding Domain In Rna Bin 3e-05
2err_A109 Nmr Structure Of The Rna Binding Domain Of Human Fo 4e-05
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 4e-05
3v4m_A105 Crystal Structure Of A Rna Binding Domain Of A U2 S 4e-05
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 4e-05
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 1e-04
2dno_A102 Solution Structure Of Rna Binding Domain In Trinucl 4e-05
2cqg_A103 Solution Structure Of The Rna Binding Domain Of Tar 4e-05
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 6e-05
1x5u_A105 Solution Structure Of Rrm Domain In Splicing Factor 7e-05
2xsf_A89 Crystal Structure Of The Rrm Domain Of Mouse Delete 8e-05
2xsf_A89 Crystal Structure Of The Rrm Domain Of Mouse Delete 3e-04
1h6k_Z98 Nuclear Cap Binding Complex Length = 98 8e-05
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 9e-05
2xs5_A87 Crystal Structure Of The Rrm Domain Of Mouse Delete 9e-05
2xs5_A87 Crystal Structure Of The Rrm Domain Of Mouse Delete 1e-04
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 1e-04
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 1e-04
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 1e-04
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 1e-04
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 2e-04
2krr_A180 Solution Structure Of The Rbd1,2 Domains From Human 2e-04
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 2e-04
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 2e-04
2dgs_A99 Solution Structure Of The Second Rna Binding Domain 2e-04
2dgs_A99 Solution Structure Of The Second Rna Binding Domain 9e-04
4a8x_A88 Structure Of The Core Asap Complex Length = 88 5e-04
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 6e-04
2j0q_D109 The Crystal Structure Of The Exon Junction Complex 6e-04
2j0q_D109 The Crystal Structure Of The Exon Junction Complex 8e-04
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 6e-04
2jwn_A124 Solution Nmr Structure Of The Protease-Resistent Do 7e-04
2x1a_A97 Structure Of Rna15 Rrm With Rna Bound (G) Length = 7e-04
4fxw_A106 Structure Of Phosphorylated Sf1 Complex With U2af65 7e-04
2x1f_A96 Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 7e-04
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 7e-04
2xb2_D90 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 8e-04
2j0s_D89 The Crystal Structure Of The Exon Junction Complex 8e-04
2hyi_B91 Structure Of The Human Exon Junction Complex With A 8e-04
2ywk_A95 Crystal Structure Of Rrm-Domain Derived From Human 8e-04
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 8e-04
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 9e-04
>pdb|2CQ4|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 23 Length = 114 Back     alignment and structure 
Iteration: 1

 Score =  109 bits (272), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 51/84 (60%), Positives = 65/84 (77%)
Query: 254 RDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMSVPM 313
           RD RTVF  Q+  +   RD+ +FFS  GKVRDVR+I DRNSRRSKG+ YVEF ++ SVP+
Sbjct: 23  RDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSVPL 82
Query: 314 AIALSGQPLLGQPVMVKPSEAEKN 337
           AI L+GQ LLG P++V+ S+AEKN
Sbjct: 83  AIGLTGQRLLGVPIIVQASQAEKN 106
>pdb|2LQ5|A Chain A, Nmr Structure Of The Rna Binding Motif 39 (Rbm39) From Mus Musculus Length = 113 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|3S6E|A Chain A, Crystal Structure Of A Rna Binding Motif Protein 39 (Rbm39) From Mus Musculus At 0.95 A Resolution Length = 114 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2FC9|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 101 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2KU7|A Chain A, Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric Protein Length = 140 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|3MDF|A Chain A, Crystal Structure Of The Rrm Domain Of Cyclophilin 33 Length = 85 Back     alignment and structure
>pdb|3LPY|A Chain A, Crystal Structure Of The Rrm Domain Of Cyp33 Length = 79 Back     alignment and structure
>pdb|2KYX|A Chain A, Solution Structure Of The Rrm Domain Of Cyp33 Length = 83 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|2DNY|A Chain A, Solution Structure Of The Third Rna Binding Domain Of Fbp- Interacting Repressor, Siahbp1 Length = 119 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|2DIT|A Chain A, Solution Structure Of The Rrm_1 Domain Of Hiv Tat Specific Factor 1 Variant Length = 112 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|3DXB|A Chain A, Structure Of The Uhm Domain Of Puf60 Fused To Thioredoxin Length = 222 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|1FJE|B Chain B, Solution Structure Of Nucleolin Rbd12 In Complex With Snre Rna Length = 175 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|2CPH|A Chain A, Solution Structure Of The C-Terminal Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 107 Back     alignment and structure
>pdb|3B4D|A Chain A, Crystal Structure Of Human Pabpn1 Rrm Length = 96 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|1OPI|A Chain A, Solution Structure Of The Third Rna Recognition Motif (Rrm) Of U2af65 In Complex With An N-Terminal Sf1 Peptide Length = 104 Back     alignment and structure
>pdb|1O0P|A Chain A, Solution Structure Of The Third Rna Recognition Motif (Rrm) Of U2af65 In Complex With An N-Terminal Sf1 Peptide Length = 104 Back     alignment and structure
>pdb|2PE8|A Chain A, Crystal Structure Of The Uhm Domain Of Human Spf45 (free Form) Length = 105 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|3UE2|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 1.23 A Resolution Length = 118 Back     alignment and structure
>pdb|3UCG|A Chain A, Crystal Structure Of A Rna Binding Domain Of Hypothetical Polyadenylate-Binding Protein (Pabpn1) From Homo Sapiens At 1.95 A Resolution Length = 89 Back     alignment and structure
>pdb|1FJC|A Chain A, Solution Structure Of Nucleolin Rbd2 Length = 96 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 Back     alignment and structure
>pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 Back     alignment and structure
>pdb|2DNK|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 4 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 Back     alignment and structure
>pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|3V4M|A Chain A, Crystal Structure Of A Rna Binding Domain Of A U2 Small Nuclear Ribonucleoprotein Auxiliary Factor 2 (U2af) From Mus Musculus At 1.80 A Resolution Length = 105 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|2DNO|A Chain A, Solution Structure Of Rna Binding Domain In Trinucleotide Repeat Containing 4 Variant Length = 102 Back     alignment and structure
>pdb|2CQG|A Chain A, Solution Structure Of The Rna Binding Domain Of Tar Dna- Binding Protein-43 Length = 103 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|1X5U|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor 3b Length = 105 Back     alignment and structure
>pdb|2XSF|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like Length = 89 Back     alignment and structure
>pdb|2XSF|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like Length = 89 Back     alignment and structure
>pdb|1H6K|Z Chain Z, Nuclear Cap Binding Complex Length = 98 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|2XS5|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Mvh Rna, Uguuc Length = 87 Back     alignment and structure
>pdb|2XS5|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Mvh Rna, Uguuc Length = 87 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|2KRR|A Chain A, Solution Structure Of The Rbd1,2 Domains From Human Nucleoli Length = 180 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|2DGS|A Chain A, Solution Structure Of The Second Rna Binding Domain In Daz- Associated Protein 1 Length = 99 Back     alignment and structure
>pdb|2DGS|A Chain A, Solution Structure Of The Second Rna Binding Domain In Daz- Associated Protein 1 Length = 99 Back     alignment and structure
>pdb|4A8X|A Chain A, Structure Of The Core Asap Complex Length = 88 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2J0Q|D Chain D, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 109 Back     alignment and structure
>pdb|2J0Q|D Chain D, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 109 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|2JWN|A Chain A, Solution Nmr Structure Of The Protease-Resistent Domain Of Xenopus Laevis Epabp2 Length = 124 Back     alignment and structure
>pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 Back     alignment and structure
>pdb|4FXW|A Chain A, Structure Of Phosphorylated Sf1 Complex With U2af65-uhm Domain Length = 106 Back     alignment and structure
>pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|2XB2|D Chain D, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 90 Back     alignment and structure
>pdb|2J0S|D Chain D, The Crystal Structure Of The Exon Junction Complex At 2.2 A Resolution Length = 89 Back     alignment and structure
>pdb|2HYI|B Chain B, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 91 Back     alignment and structure
>pdb|2YWK|A Chain A, Crystal Structure Of Rrm-Domain Derived From Human Putative Rna-Binding Protein 11 Length = 95 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query647
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-49
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 6e-19
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-04
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-47
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-43
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 5e-42
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-39
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 5e-18
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 1e-36
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 3e-34
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 5e-10
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-33
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-27
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-04
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 7e-33
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 6e-21
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 8e-33
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 5e-20
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-32
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-30
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-14
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 1e-32
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-19
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 5e-31
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-18
2dit_A112 HIV TAT specific factor 1 variant; structural geno 2e-30
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-30
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-20
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-10
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 3e-29
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 4e-09
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 1e-28
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-28
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-10
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-28
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-10
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 3e-27
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 5e-11
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 5e-27
2kt5_A124 RNA and export factor-binding protein 2; chaperone 7e-26
2kt5_A124 RNA and export factor-binding protein 2; chaperone 3e-07
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 7e-26
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 4e-12
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 9e-04
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-25
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-10
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 4e-25
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 4e-07
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 4e-25
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-10
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 7e-25
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-11
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-24
1x4e_A85 RNA binding motif, single-stranded interacting pro 4e-10
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-24
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 3e-16
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 2e-24
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-09
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-24
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 4e-14
2cph_A107 RNA binding motif protein 19; RNA recognition moti 4e-24
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-08
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 7e-24
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-10
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 8e-24
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 3e-11
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-23
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 5e-04
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-23
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 4e-04
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 6e-04
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-23
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 2e-08
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-23
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-07
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 8e-04
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-23
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-11
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 7e-05
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-23
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 4e-12
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-23
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 5e-07
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 2e-23
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 3e-23
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 6e-11
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 8e-04
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 5e-23
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-10
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 6e-23
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 3e-10
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 8e-23
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-11
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 5e-05
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-22
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-09
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-05
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-04
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-22
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-07
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 7e-04
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 2e-22
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 9e-12
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-22
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-14
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 3e-22
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 4e-10
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-22
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 1e-12
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-06
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-21
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 2e-10
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 1e-21
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 2e-04
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 2e-21
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 2e-10
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 3e-21
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 3e-12
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 5e-21
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 4e-09
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 5e-21
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 7e-08
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 6e-21
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 1e-06
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 7e-04
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 7e-21
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 2e-08
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 7e-21
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 9e-08
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 8e-21
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 9e-11
2cpj_A99 Non-POU domain-containing octamer-binding protein; 9e-21
2cpj_A99 Non-POU domain-containing octamer-binding protein; 3e-05
2cpj_A99 Non-POU domain-containing octamer-binding protein; 5e-05
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 9e-21
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-11
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 9e-21
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-08
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-20
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 9e-07
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-20
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-12
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 3e-20
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-08
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 4e-20
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-11
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 5e-20
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 1e-10
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 6e-20
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-11
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-20
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-05
2f3j_A177 RNA and export factor binding protein 2; RRM domai 7e-20
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-05
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 8e-20
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 3e-11
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 9e-20
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-07
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 9e-20
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-07
1x5o_A114 RNA binding motif, single-stranded interacting pro 1e-19
1x5o_A114 RNA binding motif, single-stranded interacting pro 2e-07
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-19
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 5e-09
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-19
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 3e-19
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 1e-09
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-19
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-07
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 4e-19
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-08
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 4e-19
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-07
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 4e-19
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 5e-07
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 4e-19
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-12
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 5e-19
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-10
3q2s_C229 Cleavage and polyadenylation specificity factor S; 5e-19
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-09
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 8e-19
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 5e-04
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 8e-19
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 1e-07
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 9e-19
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 1e-10
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-18
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 3e-18
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-13
1x5p_A97 Negative elongation factor E; structure genomics, 3e-18
1x5p_A97 Negative elongation factor E; structure genomics, 1e-04
1x5p_A97 Negative elongation factor E; structure genomics, 8e-04
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 3e-18
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 1e-08
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-18
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 2e-07
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 4e-18
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 8e-13
3n9u_C156 Cleavage and polyadenylation specificity factor S; 4e-18
3n9u_C156 Cleavage and polyadenylation specificity factor S; 6e-08
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 4e-18
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 6e-12
2div_A99 TRNA selenocysteine associated protein; structural 5e-18
2div_A99 TRNA selenocysteine associated protein; structural 1e-09
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 7e-18
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 3e-05
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 1e-17
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 3e-08
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 1e-17
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 6e-11
3p5t_L90 Cleavage and polyadenylation specificity factor S; 2e-17
3p5t_L90 Cleavage and polyadenylation specificity factor S; 4e-09
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 2e-17
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 8e-06
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 3e-17
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 3e-17
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 5e-17
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 6e-09
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-04
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 8e-17
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 8e-13
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 9e-17
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 2e-05
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 2e-16
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 3e-16
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 2e-10
2la6_A99 RNA-binding protein FUS; structural genomics, nort 3e-16
2la6_A99 RNA-binding protein FUS; structural genomics, nort 3e-10
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 4e-16
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-08
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 5e-16
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 4e-08
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 5e-16
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 5e-16
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-08
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 8e-16
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 5e-09
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 9e-16
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 6e-06
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 1e-15
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 5e-08
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-15
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-09
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-15
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 2e-04
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-15
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 5e-07
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 3e-15
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 1e-09
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 3e-15
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 7e-09
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 4e-15
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 3e-06
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 5e-05
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 4e-15
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-14
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-04
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 1e-14
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 9e-11
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 1e-14
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-07
2dis_A109 Unnamed protein product; structural genomics, RRM 1e-14
2dis_A109 Unnamed protein product; structural genomics, RRM 7e-07
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-14
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 7e-05
2cqd_A116 RNA-binding region containing protein 1; RNA recog 2e-14
2cqd_A116 RNA-binding region containing protein 1; RNA recog 8e-09
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 4e-14
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 7e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-14
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 6e-14
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-13
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-11
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 3e-11
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 7e-08
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-07
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 8e-06
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 5e-05
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 6e-14
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 2e-07
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 6e-14
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 9e-06
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-04
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 1e-13
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 2e-07
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 3e-13
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 2e-08
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 8e-13
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 2e-06
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 8e-13
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 3e-07
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 9e-13
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-05
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 5e-05
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 1e-12
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 1e-12
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 1e-08
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 1e-12
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-12
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 9e-05
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 2e-12
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-05
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 4e-05
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-12
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-04
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-12
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 4e-05
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 3e-12
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 1e-04
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-12
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-05
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 4e-12
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 3e-06
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 5e-12
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 2e-06
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 7e-12
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 7e-07
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 8e-12
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-06
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 9e-12
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 3e-06
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-11
2i2y_A150 Fusion protein consists of immunoglobin G- binding 2e-04
2i2y_A150 Fusion protein consists of immunoglobin G- binding 3e-04
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 1e-11
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 3e-07
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-11
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 1e-11
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 5e-05
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 2e-04
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 3e-11
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 4e-11
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 5e-07
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 4e-11
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 3e-05
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 3e-04
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 5e-11
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 7e-05
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 1e-04
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 7e-11
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-08
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 7e-11
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 8e-10
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 3e-05
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 1e-04
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 9e-10
2krb_A81 Eukaryotic translation initiation factor 3 subunit 1e-09
2krb_A81 Eukaryotic translation initiation factor 3 subunit 7e-05
2krb_A81 Eukaryotic translation initiation factor 3 subunit 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 2e-09
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-09
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 1e-08
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-08
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 8e-08
2dnl_A114 Cytoplasmic polyadenylation element binding protei 1e-07
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 2e-07
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 5e-07
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 1e-06
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 6e-06
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 8e-06
2zuo_A861 MVP, major vault protein; repeat domains, protein- 1e-05
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-04
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 3e-04
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
 Score =  170 bits (433), Expect = 1e-49
 Identities = 36/186 (19%), Positives = 76/186 (40%), Gaps = 9/186 (4%)

Query: 257 RTVFAYQICLKADERDVYEFFSRAGKVRDVRL-----IMDRNSRRSKGVGYVEFYDVMSV 311
           R ++   I     E  + +FF+   ++  +       ++     + K   ++EF  V   
Sbjct: 5   RRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDET 64

Query: 312 PMAIALSGQPLLGQPVMVKPSEAEKN-LVQSNSSIAGASGGGTGPYSGGARRLYVGNLHF 370
             A+A  G    GQ + ++     +     S +      G  +      A +L++G L  
Sbjct: 65  TQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHKLFIGGLPN 124

Query: 371 NMTEDQLRQVFEPFGTVELVQLPLD-ETGHCKGFGFVQFARLEDARNALN-LNGQLEIVG 428
            + +DQ++++   FG ++   L  D  TG  KG+ F ++  +     A+  LNG  ++  
Sbjct: 125 YLNDDQVKELLTSFGPLKAFNLVKDSATGLSKGYAFCEYVDINVTDQAIAGLNGM-QLGD 183

Query: 429 RAIKVS 434
           + + V 
Sbjct: 184 KKLLVQ 189
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, alternative splicing, FBP interacting repressor, RRM, electron transport; 2.20A {Escherichia coli O157} Length = 222 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query647
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.97
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.97
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.96
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.96
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.96
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.96
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.96
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.96
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.96
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.96
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.95
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.95
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.95
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.95
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.95
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.95
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.94
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.94
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.94
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.94
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.94
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.94
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.94
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.94
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.94
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.94
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.94
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.93
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.93
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.93
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.93
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.93
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.93
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.91
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.84
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.81
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.81
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.76
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.75
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.74
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.73
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.72
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.71
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.7
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.68
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.68
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.68
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.68
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.67
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.65
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.65
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.65
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.65
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.64
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.64
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.64
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.64
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.64
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.64
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.63
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.63
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.63
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.63
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.63
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.63
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.63
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.63
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.63
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.63
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.63
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.62
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.62
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.62
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.62
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.62
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.62
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.62
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.62
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.62
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.61
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.61
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.61
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.61
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.61
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.61
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.61
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.61
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.61
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.61
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.61
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.61
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.61
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.61
2div_A99 TRNA selenocysteine associated protein; structural 99.61
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.61
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.61
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.61
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.61
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.61
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.6
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.6
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.6
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.6
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.6
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.6
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.6
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.6
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.6
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.6
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.59
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.59
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.59
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.59
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.59
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.59
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.59
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.59
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.59
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.59
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.59
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.59
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.59
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.59
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.59
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.59
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.59
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.59
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.59
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.59
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.59
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.59
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.59
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.59
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.58
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.58
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.58
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.58
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.58
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.58
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.58
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.58
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.58
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.58
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.58
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.58
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.58
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.58
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.58
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.58
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.58
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.57
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.57
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.57
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.57
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.57
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.57
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.57
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.57
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.57
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.57
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.57
2dis_A109 Unnamed protein product; structural genomics, RRM 99.57
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.57
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.57
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.57
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.57
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.56
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.56
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.56
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.56
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.56
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.56
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.56
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.56
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.56
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.56
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.56
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.56
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.56
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.56
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.56
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.56
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.56
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.56
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.55
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.55
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.55
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.55
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.55
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.55
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.55
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.55
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.55
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.55
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.54
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.54
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.54
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.54
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.54
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.54
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.54
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.54
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.54
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.54
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.54
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.54
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.54
2div_A99 TRNA selenocysteine associated protein; structural 99.54
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.54
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.54
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.54
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.54
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.54
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.53
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.53
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.53
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.53
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.53
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.53
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.53
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.53
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.53
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.53
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.53
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.53
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.53
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.53
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.53
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.53
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.53
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.53
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.52
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.52
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.52
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.52
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.52
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.52
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.52
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.52
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.52
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.52
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.52
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.52
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.52
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.51
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.51
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.51
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.51
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.51
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.51
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.51
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.51
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.51
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.51
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.51
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.51
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.5
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.5
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.5
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.5
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.5
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.5
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.5
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.5
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.5
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.5
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.5
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.5
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.5
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.49
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.49
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.49
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.49
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.49
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.49
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.49
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.49
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.49
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.48
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.48
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.48
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.48
1x5p_A97 Negative elongation factor E; structure genomics, 99.48
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.48
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.48
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.48
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.48
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.48
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.48
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.48
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.48
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.48
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.48
2dis_A109 Unnamed protein product; structural genomics, RRM 99.48
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.48
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.48
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.21
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.47
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.47
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.47
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.47
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.47
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.46
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.46
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.46
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.46
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.46
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.46
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.46
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.45
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.45
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.45
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.45
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.45
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.45
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.44
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.44
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.44
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.44
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.44
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.44
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.43
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.43
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.43
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.43
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.43
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.43
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.43
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.42
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.42
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.42
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.41
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.41
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.41
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.41
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.41
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.41
1x5p_A97 Negative elongation factor E; structure genomics, 99.41
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.4
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.4
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.4
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.4
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.4
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.39
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.39
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.39
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.38
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.37
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.36
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.36
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.36
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.05
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.35
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.34
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.34
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.34
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.3
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.29
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.29
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.29
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.28
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.27
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.26
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.25
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.22
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.21
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.21
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.21
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.2
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.13
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.06
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.0
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 98.97
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.96
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.76
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 98.62
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.45
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.39
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.37
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.32
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.14
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.96
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 97.49
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.42
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.05
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.85
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.79
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 96.71
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 96.7
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.66
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.63
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.29
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 95.95
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 95.81
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 94.53
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 94.09
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 93.67
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 88.22
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
Probab=100.00  E-value=7.1e-40  Score=334.06  Aligned_cols=246  Identities=16%  Similarity=0.260  Sum_probs=209.6

Q ss_pred             CCCCCeEEEecCCCCCCHHHHHHHHHhcCCeeEEEEeeeCCCCCcccEEEEEecccccHHHHHHhcCCccCCceEEEccC
Q 006398          253 ERDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMSVPMAIALSGQPLLGQPVMVKPS  332 (647)
Q Consensus       253 ~~~~~~v~v~~Lp~~~t~~~l~~~f~~~G~i~~v~~~~~~~tg~~~g~afV~f~~~~~a~~al~~~g~~~~g~~i~v~~~  332 (647)
                      ....++|||+|||+.+|+++|.++|..||.|..|.|+.+..+  ++|||||+|.+.++|..||+++|..|.|+.|.|.++
T Consensus        38 ~~~~~~l~V~nLp~~~t~~~l~~~F~~~G~i~~v~i~~~~~~--~~g~afV~f~~~~~A~~A~~~~~~~~~g~~i~v~~~  115 (292)
T 2ghp_A           38 NRELTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADSLKK--NFRFARIEFARYDGALAAITKTHKVVGQNEIIVSHL  115 (292)
T ss_dssp             ----CEEEEEEECTTCCHHHHHHHHGGGSCEEEEEEEECTTS--SSEEEEEEESSHHHHHHHHTTTTCEETTEECEEEEC
T ss_pred             CCCCCEEEEeCCCCCCCHHHHHHHHHhcCCeEEEEEEECCCC--CcEEEEEEECCHHHHHHHHHhCCcEeCCcEEEEEEC
Confidence            446689999999999999999999999999999999998754  589999999999999999999999999999999764


Q ss_pred             cchhhhcccccccCCCCCCCCCCCCCCCcEEEEcCCCCCCCHHHHHHhhccCC-cEEEEEeccCCCCCcceEEEEEeCCH
Q 006398          333 EAEKNLVQSNSSIAGASGGGTGPYSGGARRLYVGNLHFNMTEDQLRQVFEPFG-TVELVQLPLDETGHCKGFGFVQFARL  411 (647)
Q Consensus       333 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nLp~~~~e~~l~~~f~~~G-~v~~v~i~~~~~g~~~g~afVef~~~  411 (647)
                                                ...+|||+|||+.+++++|.++|..|| .|..|.|+.+..|.++|||||+|.+.
T Consensus       116 --------------------------~~~~l~v~nlp~~~t~~~l~~~f~~~G~~i~~v~i~~~~~~~~~g~afV~f~~~  169 (292)
T 2ghp_A          116 --------------------------TECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFNTSRRFAYIDVTSK  169 (292)
T ss_dssp             --------------------------CSCEEEEECCCTTCCHHHHHHHHHHTTCCCCEEECC-------CCEEEEECSSH
T ss_pred             --------------------------CCCEEEEECCCCCCCHHHHHHHHHHhCCCeEEEEEEeCCCCCcceEEEEEECCH
Confidence                                      268999999999999999999999999 99999999987788899999999999


Q ss_pred             HHHHHHHHHcCCceecCeEEEEEEeecCCCCCCCCCCCCCCCCCCCCCCccCChHHHHHHHHHhccCCCCcccCCCCCCC
Q 006398          412 EDARNALNLNGQLEIVGRAIKVSAVTDQSGLQDLGANTTGDFDDDEGGGLSLNARSRALLMQKLDRSGSATTIAGSAVTP  491 (647)
Q Consensus       412 ~~A~~Al~~l~g~~~~g~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  491 (647)
                      ++|.+|+..|+|..|.|+.|.|.++.+.......                                              
T Consensus       170 ~~a~~A~~~l~g~~~~g~~l~v~~a~~~~~~~~~----------------------------------------------  203 (292)
T 2ghp_A          170 EDARYCVEKLNGLKIEGYTLVTKVSNPLEKSKRT----------------------------------------------  203 (292)
T ss_dssp             HHHHHHHHHHTTCEETTEECEEEECCCC----------------------------------------------------
T ss_pred             HHHHHHHHHhCCCEeCCcEEEEEECCCCcccccc----------------------------------------------
Confidence            9999999999999999999999997654310000                                              


Q ss_pred             cccCCCCCCCCcccccccccccccCCCCCCCCCCCCCCCCCccccCCCCCcCccCCCCCCcceEEeccCCCCCC-CCchh
Q 006398          492 AVNSTALPLPTAPLLGAASAVSTLVPPLVQGTVPTHPGQLGTALQVPTASVPIFDTIGVPSECLLLKNMFDPKN-ETYEE  570 (647)
Q Consensus       492 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~V~nl~~p~~-~~d~~  570 (647)
                                                                            .....+..+|||.||  |.. ++   
T Consensus       204 ------------------------------------------------------~~~~~~~~~l~v~nl--p~~~~t---  224 (292)
T 2ghp_A          204 ------------------------------------------------------DSATLEGREIMIRNL--STELLD---  224 (292)
T ss_dssp             ---------------------------------------------------------CCTTTEEEEEEE--CTTTCC---
T ss_pred             ------------------------------------------------------cccCCCCceEEEECC--CcccCC---
Confidence                                                                  000225669999999  777 66   


Q ss_pred             hhhhHHHHHHHHhhhcCCeEEEEEeeC------CCccEEEEeCChHHHHHHHHHHcCceeCCeEEEEEEeCch
Q 006398          571 FDMDIKEDVEGECSKFGKLKHIFVEKD------SAGFVYLRFENTQSAFAAQRALHGRWFAGKMITATFMVPQ  637 (647)
Q Consensus       571 ~~~~~~~dl~~~F~~fG~V~~v~i~~~------~~G~afV~F~~~e~A~~A~~~lnG~~~~gr~i~v~~~~~~  637 (647)
                           +++|.++|+.||.|..|.|+.+      ++|+|||+|.+.++|.+|+ .|||..|+|++|.|.|+.+.
T Consensus       225 -----~~~l~~~F~~~G~v~~v~i~~~~~~tg~~~g~afV~F~~~~~A~~A~-~l~g~~~~g~~i~V~~a~~k  291 (292)
T 2ghp_A          225 -----ENLLRESFEGFGSIEKINIPAGQKEHSFNNCCAFMVFENKDSAERAL-QMNRSLLGNREISVSLADKK  291 (292)
T ss_dssp             -----HHHHHHHHGGGSCEEEEECCSCCC---CCCEEEEEEESSHHHHHHHG-GGTTEEETTEEEEEEECCCC
T ss_pred             -----HHHHHHHHhccCCeeEEEEEecCCcCCCCceEEEEEeCCHHHHHHHH-HhcCCEECCcEEEEEEecCC
Confidence                 7999999999999999999643      4799999999999999999 99999999999999998764
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 647
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 8e-21
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 6e-07
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-20
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 4e-05
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 5e-17
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 4e-09
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 2e-16
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-08
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-16
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 5e-16
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-10
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-15
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-08
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 0.004
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 4e-15
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-05
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 5e-15
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 5e-07
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-15
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 6e-08
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-14
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 8e-07
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-14
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 5e-08
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 7e-14
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-07
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 1e-13
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 6e-05
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-13
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 2e-05
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 5e-13
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-06
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 0.001
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 9e-13
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 1e-12
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 9e-09
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-12
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-06
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-12
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 5e-06
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-12
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-06
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 3e-12
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 0.002
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-12
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 3e-12
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 4e-12
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 3e-05
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-12
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-05
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 7e-12
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 9e-05
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 8e-12
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 9e-12
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-05
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 1e-11
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 3e-05
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-11
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 5e-04
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-11
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-11
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 2e-10
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 7e-06
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-11
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 3e-11
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 1e-05
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 3e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-07
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 4e-11
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 9e-05
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 7e-11
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-06
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 7e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-10
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 7e-06
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 2e-10
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-10
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 4e-10
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 4e-10
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 6e-10
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 9e-10
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 9e-10
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 2e-09
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 3e-04
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 2e-09
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 6e-07
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-09
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 5e-04
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-09
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 5e-04
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 3e-09
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 3e-09
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 8e-09
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 5e-04
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 8e-09
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 9e-09
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-04
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-08
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-08
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 1e-08
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 3e-04
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-08
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 0.001
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-08
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-08
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 5e-08
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 6e-08
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 7e-08
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 7e-08
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-07
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 0.003
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-07
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 5e-06
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 3e-07
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 0.003
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 4e-07
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 5e-07
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-07
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 7e-07
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 0.001
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-06
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-06
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 8e-06
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 2e-05
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-05
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 4e-05
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 6e-05
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 9e-05
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 3e-04
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 5e-04
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 0.001
d2es4d1280 a.137.15.1 (D:53-332) Lipase chaperone LifO (LipB) 0.003
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 88.1 bits (217), Expect = 8e-21
 Identities = 38/185 (20%), Positives = 82/185 (44%), Gaps = 16/185 (8%)

Query: 251 DPERDQRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMS 310
           +PE+  R +F   +  +  +  +   F + G + D  ++ D N++RS+G G+V +  V  
Sbjct: 2   EPEQL-RKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEE 60

Query: 311 VPMAIALSGQPLLGQPVMVKPSEAEKNLVQSNSSIAGASGGGTGPYSGGARRLYVGNLHF 370
           V  A+      + G+ V  K + + ++  +  + +               ++++VG +  
Sbjct: 61  VDAAMNARPHKVDGRVVEPKRAVSREDSQRPGAHL-------------TVKKIFVGGIKE 107

Query: 371 NMTEDQLRQVFEPFGTVELVQLPLD-ETGHCKGFGFVQFARLEDARNALNLNGQLEIVGR 429
           +  E  LR  FE +G +E++++  D  +G  +GF FV F   +     +       + G 
Sbjct: 108 DTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYH-TVNGH 166

Query: 430 AIKVS 434
             +V 
Sbjct: 167 NCEVR 171
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query647
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.95
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.91
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.78
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.74
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.73
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.72
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.72
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.72
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.71
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.71
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.71
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.71
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.71
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.71
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.71
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.7
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.7
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.7
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.7
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.69
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.69
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.69
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.69
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.69
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.69
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.69
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.68
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.68
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.68
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.67
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.67
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.67
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.67
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.67
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.67
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.67
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.66
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.66
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.66
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.66
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.66
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.66
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.66
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.66
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.65
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.65
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.65
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.65
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.65
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.64
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.64
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.64
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.64
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.63
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.63
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.63
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.63
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.62
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.62
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.62
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.62
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.62
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.62
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.61
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.61
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.61
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.61
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.61
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.61
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.61
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.61
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.6
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.6
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.6
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.6
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.6
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.6
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.6
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.59
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.59
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.59
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.58
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.58
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.58
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.58
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.58
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.58
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.58
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.58
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.58
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.58
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.58
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.58
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.58
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.58
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.58
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.57
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.57
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.57
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.57
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.57
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.57
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.57
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.57
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.57
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.56
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.56
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.56
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.56
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.56
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.55
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.55
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.55
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.55
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.55
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.55
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.54
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.54
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.54
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.54
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.53
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.53
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.53
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.53
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.53
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.53
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.53
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.52
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.52
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.52
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.52
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.52
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.51
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.51
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.51
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.51
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.51
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.5
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.5
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.5
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.5
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.5
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.5
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.5
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.5
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.5
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.49
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.49
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.49
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.49
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.49
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.49
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.48
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.48
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.47
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.46
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.46
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.43
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.41
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.41
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.41
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.37
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.35
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.31
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.25
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.24
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.2
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.2
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.18
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.17
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.16
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.15
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 98.21
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 98.17
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.19
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 96.93
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.82
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.69
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.21
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 91.92
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=9e-28  Score=224.41  Aligned_cols=171  Identities=21%  Similarity=0.411  Sum_probs=151.1

Q ss_pred             CCeEEEecCCCCCCHHHHHHHHHhcCCeeEEEEeeeCCCCCcccEEEEEecccccHHHHHHhcCCccCCceEEEccCcch
Q 006398          256 QRTVFAYQICLKADERDVYEFFSRAGKVRDVRLIMDRNSRRSKGVGYVEFYDVMSVPMAIALSGQPLLGQPVMVKPSEAE  335 (647)
Q Consensus       256 ~~~v~v~~Lp~~~t~~~l~~~f~~~G~i~~v~~~~~~~tg~~~g~afV~f~~~~~a~~al~~~g~~~~g~~i~v~~~~~~  335 (647)
                      .++|||+|||+.+|+++|.++|++||.|.++.++.+..+|.++|||||+|.+.++|..|+.+++..+.+..+.+......
T Consensus         6 ~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~~~~~~~~~~~~~~~~~~~~~   85 (183)
T d1u1qa_           6 LRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAMNARPHKVDGRVVEPKRAVSR   85 (183)
T ss_dssp             HHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHTCSCEETTEECEEEECCCT
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHHHhcCCcccccchhhhhhhhc
Confidence            37999999999999999999999999999999999999999999999999999999999998888899988888765433


Q ss_pred             hhhcccccccCCCCCCCCCCCCCCCcEEEEcCCCCCCCHHHHHHhhccCCcEEEEEeccC-CCCCcceEEEEEeCCHHHH
Q 006398          336 KNLVQSNSSIAGASGGGTGPYSGGARRLYVGNLHFNMTEDQLRQVFEPFGTVELVQLPLD-ETGHCKGFGFVQFARLEDA  414 (647)
Q Consensus       336 ~~~~~~~~~~~~~~~~~~~~~~~~~~~l~v~nLp~~~~e~~l~~~f~~~G~v~~v~i~~~-~~g~~~g~afVef~~~~~A  414 (647)
                      ......             ......++|||+|||+.+++++|.++|..||.|..+.|+.+ .+|.++|||||+|.+.++|
T Consensus        86 ~~~~~~-------------~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~~~~g~~fV~f~~~e~A  152 (183)
T d1u1qa_          86 EDSQRP-------------GAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSV  152 (183)
T ss_dssp             TGGGST-------------TTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESCHHHH
T ss_pred             cccccc-------------ccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccCccceeEEEEECCHHHH
Confidence            332211             12244689999999999999999999999999999999987 5789999999999999999


Q ss_pred             HHHHHHcCCceecCeEEEEEEeecCC
Q 006398          415 RNALNLNGQLEIVGRAIKVSAVTDQS  440 (647)
Q Consensus       415 ~~Al~~l~g~~~~g~~i~v~~~~~~~  440 (647)
                      .+||+ +++..|+|+.|.|.+|.++.
T Consensus       153 ~~Al~-~~~~~~~G~~i~V~~A~~k~  177 (183)
T d1u1qa_         153 DKIVI-QKYHTVNGHNCEVRKALSKQ  177 (183)
T ss_dssp             HHHHT-SSCEEETTEEEEEEECCCHH
T ss_pred             HHHHH-hCCCeECCEEEEEEecCCcc
Confidence            99997 67889999999999986643
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure