Citrus Sinensis ID: 006476

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640---
MHMYLCNSCTCGSIMFCYDFRPNETKRPRTLSKLSDTTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPPYPKNPAIAEFAAQFPYEPTPDQKKAFLDVERDLTERETPMDRLICGDVGFGKTEVALRAIFCVVSAGKQAMVLAPTIVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHGHLNIIVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPRTLYLALTGFRDASLISTPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPMDFLQQAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQALERLAALEECRELGQGFQLAEKDMGIRGFGTIFGEQQTGDVGNVGVDLFFEMLFESLSKVDEHCVISVPYKSVQIDININPRLPSEYINHLENPMEMVNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKKLYVRRMAADIGITKIYASGKMVGMKTNMNKKVFKMMIDSMTSEVHRNSLTFEGDQIKAELLLELPREQLLNWIFQCLAELYASLPALIKY
cccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccEEEccccccHHHHHHHHHHHHHHcccEEEEEEcHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHcccccEEEEcccccccccccccccccEEEccccccccHHHHHHHHHHHcccEEEccccccHHHHcHHHHccccccccccccccccccEEEEccccHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHcccccEEEEccccccccccccccEEEEcccccccHHHHHHHccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHcccHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEcccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccEEEEEcccEEEEEEccccHHcHHHHHHHHHHHHcccccccccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcc
cccEEEEEccccHHHHHHHHccccccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccEEEccccccHHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHHHcccEEEEEEcHHHHccccEEccccEEEEEccccccccHHHHHHHHHHcccEEEEcccccHHHHHHHHHcHcccEEEcccccccccEEEEEEcccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHcccccEEEEEEEEccccccccHcEEEEHcHHHHHHHHHHHHHccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEHccHEEcccHHHcccccccHHHHHcHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccHHHcHcHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccEEEEcccccEEEEEcccccccHHHHHHHHHHccccEEEcccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHcc
mhmylcnsctcgsimfcydfrpnetkrprtlsklsdtTAWERRKTKGKVAIQKMVVDLMELYLHRlkqkrppypknpaiaefaaqfpyeptpdqkKAFLDVERDlteretpmdrlicgdvgfgkTEVALRAIFCVVSAGKQAMVLAPTIVLAKQHFDVVSerfskypdikvgLLSRFQSKAEKEEHLDMIKHGHLNIIVGTHSLLGSRVVYNnlgllvvdeeqrfgvkqkeKIASFKISVDVltlsatpiprTLYLALTgfrdaslistppperlpikthlSAFSKEKVISAIKYELDrggqvfyvlprikgleepmDFLQQAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLYQLRGRvgradkeahaylfypdksllsDQALERLAALEECRELGQGFqlaekdmgirgfgtifgeqqtgdvgnvGVDLFFEMLFESLSkvdehcvisvpyksvqidininprlpseyinhlenPMEMVNEAEKAAEQDIWCLMQFTESLRrqygkepySMEILLKKLYVRRMAADIGITKiyasgkmvgmktnMNKKVFKMMIDSMTSevhrnsltfegDQIKAELLLELPREQLLNWIFQCLAELYASLPALIKY
mhmylcnsctcgSIMFCYDFrpnetkrprtlsklsdttawerrktkgkvaiQKMVVDLMELYLHRLKQKRPPYPKNPAIAEFAAQFPYEPTPDQKKAFLDVERDLteretpmdrlicGDVGFGKTEVALRAIFCVVSAGKQAMVLAPTIVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHGHLNIIVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQkekiasfkisvdvltlsatpIPRTLYLALTGFRDASLISTPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPMDFLQQAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQALERLAALEECRELGQGFQLAEKDMGIRGFGTIFGEQQTGDVGNVGVDLFFEMLFESLSKVDEHCVISVpyksvqidininPRLPSEYINHLENPMEMVNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKKLYVRRMAADIGITkiyasgkmvgmKTNMNKKVFKMMIDSMTSEVHRNSLTFEGDQIKAELLLELPREQLLNWIFQCLAELYASLPALIKY
MHMYLCNSCTCGSIMFCYDFRPNETKRPRTLSKLSDTTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPPYPKNPAIAEFAAQFPYEPTPDQKKAFLDVERDLTERETPMDRLICGDVGFGKTEVALRAIFCVVSAGKQAMVLAPTIVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHGHLNIIVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPRTLYLALTGFRDASLISTPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPMDFLQQAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQalerlaaleecrelGQGFQLAEKDMGIRGFGTIFGEQQTGDVGNVGVDLFFEMLFESLSKVDEHCVISVPYKSVQIDININPRLPSEYINHLENPMEMVNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKKLYVRRMAADIGITKIYASGKMVGMKTNMNKKVFKMMIDSMTSEVHRNSLTFEGDQIKAelllelpreqllNWIFQCLAELYASLPALIKY
**MYLCNSCTCGSIMFCYDFR******************WERRKTKGKVAIQKMVVDLMELYLHRLK***********IAEFAA**************************PMDRLICGDVGFGKTEVALRAIFCVVSAGKQAMVLAPTIVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKA*KEEHLDMIKHGHLNIIVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPRTLYLALTGFRDASLIST*****LPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPMDFLQQAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQALERLAALEECRELGQGFQLAEKDMGIRGFGTIFGEQQTGDVGNVGVDLFFEMLFESLSKVDEHCVISVPYKSVQIDININPRLPSEYINHLENP***V****KAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKKLYVRRMAADIGITKIYASGKMVGMKTNMNKKVFKMMIDSMTSEVHRNSLTFEGDQIKAELLLELPREQLLNWIFQCLAELYASLPALI**
*HMYLCNSCTCGSIMFCYDFR*********LSKLSDTTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPPYPKNPAIAEFAAQFPYEPTPDQKKAFLDVERDLTERETPMDRLICGDVGFGKTEVALRAIFCVVSAGKQAMVLAPTIVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHGHLNIIVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPRTLYLALTGFRDASLISTPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPMDFLQQAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQALERLAALEECRELGQGFQLAEKDMGIRGFGTIFGEQQTGDVGNVGVDLFFEMLFESL***************VQIDININPRLPSEYINHLENPMEMVNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKKLYVRRMAADIGITKIYASGKMVGMKTNMNKKVFKMMIDSMT**********************LPREQLLNWIFQCLAELYASLPALI**
MHMYLCNSCTCGSIMFCYDFRPNETKRPRTLSKLSDTTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPPYPKNPAIAEFAAQFPYEPTPDQKKAFLDVERDLTERETPMDRLICGDVGFGKTEVALRAIFCVVSAGKQAMVLAPTIVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHGHLNIIVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPRTLYLALTGFRDASLISTPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPMDFLQQAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQALERLAALEECRELGQGFQLAEKDMGIRGFGTIFGEQQTGDVGNVGVDLFFEMLFESLSKVDEHCVISVPYKSVQIDININPRLPSEYINHLENPMEMVNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKKLYVRRMAADIGITKIYASGKMVGMKTNMNKKVFKMMIDSMTSEVHRNSLTFEGDQIKAELLLELPREQLLNWIFQCLAELYASLPALIKY
*HMYLCNSCTCGSIMFCYDFRPNETKRPRTLSKLSDTTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPPYPKNPAIAEFAAQFPYEPTPDQKKAFLDVERDLTERETPMDRLICGDVGFGKTEVALRAIFCVVSAGKQAMVLAPTIVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHGHLNIIVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPRTLYLALTGFRDASLISTPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPMDFLQQAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQALERLAALEECRELGQGFQLAEKDMGIRGFGTIFGEQQTGDVGNVGVDLFFEMLFESLSKVDEHCVISVPYKSVQIDININPRLPSEYINHLENPMEMVNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKKLYVRRMAADIGITKIYASGKMVGMKTNMNKKVFKMMIDSMTSEVHRNSLTFEGDQIKAELLLELPREQLLNWIFQCLAELYASLPALIKY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHMYLCNSCTCGSIMFCYDFRPNETKRPRTLSKLSDTTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPPYPKNPAIAEFAAQFPYEPTPDQKKAFLDVERDLTERETPMDRLICGDVGFGKTEVALRAIFCVVSAGKQAMVLAPTIVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHGHLNIIVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPRTLYLALTGFRDASLISTPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPMDFLQQAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQALERLAALEECRELGQGFQLAEKDMGIRGFGTIFGEQQTGDVGNVGVDLFFEMLFESLSKVDEHCVISVPYKSVQIDININPRLPSEYINHLENPMEMVNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKKLYVRRMAADIGITKIYASGKMVGMKTNMNKKVFKMMIDSMTSEVHRNSLTFEGDQIKAELLLELPREQLLNWIFQCLAELYASLPALIKY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query643 2.2.26 [Sep-21-2011]
Q557501199 Transcription-repair-coup N/A no 0.888 0.476 0.475 1e-147
Q4L3G01169 Transcription-repair-coup yes no 0.855 0.470 0.409 1e-121
Q5HRQ21169 Transcription-repair-coup yes no 0.855 0.470 0.403 1e-119
P374741177 Transcription-repair-coup yes no 0.822 0.449 0.410 1e-118
Q8CMT11169 Transcription-repair-coup yes no 0.855 0.470 0.402 1e-118
Q49V121170 Transcription-repair-coup yes no 0.852 0.468 0.418 1e-118
Q2YVY21168 Transcription-repair-coup yes no 0.858 0.472 0.397 1e-117
Q7A7B21168 Transcription-repair-coup yes no 0.858 0.472 0.397 1e-117
Q99WA01168 Transcription-repair-coup yes no 0.858 0.472 0.397 1e-117
Q8NXZ61168 Transcription-repair-coup yes no 0.858 0.472 0.397 1e-117
>sp|Q55750|MFD_SYNY3 Transcription-repair-coupling factor OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mfd PE=3 SV=1 Back     alignment and function desciption
 Score =  523 bits (1346), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 277/582 (47%), Positives = 384/582 (65%), Gaps = 11/582 (1%)

Query: 20   FRPNETKRPRTLSKLSDTTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPPYPKN-PA 78
            FR   T RP  L K+     WE  K K + A++K+ VDL+ LY  R KQ    YP + P 
Sbjct: 577  FRHTGT-RPPELHKMGGKV-WEATKNKVRKAVKKLAVDLLNLYAKRAKQVGYAYPPDSPW 634

Query: 79   IAEFAAQFPYEPTPDQKKAFLDVERDLTERETPMDRLICGDVGFGKTEVALRAIFCVVSA 138
              E    FPY+PTPDQ KA  DV+RDL E + PMDRL+CGDVGFGKTEVA+RAIF  V++
Sbjct: 635  QQELEDSFPYQPTPDQLKAVQDVKRDL-EGDRPMDRLVCGDVGFGKTEVAVRAIFKAVTS 693

Query: 139  G-KQAMVLAPTIVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHGHLNI 197
            G KQ  +LAPT VL +QH+  + ERF+ YP I +GLL+RF++ +EK+E L  +K G L+I
Sbjct: 694  GNKQVALLAPTTVLTQQHYHTLKERFAPYP-ITIGLLNRFRTASEKKEILAKLKSGELDI 752

Query: 198  IVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPRTLYLA 257
            +VGT  +LG+ V + +LGLLV+DEEQRFGV QKEKI + K  VDVLTL+ATPIPRTLY++
Sbjct: 753  VVGTQQVLGTSVKFKDLGLLVIDEEQRFGVNQKEKIKTLKTEVDVLTLTATPIPRTLYMS 812

Query: 258  LTGFRDASLISTPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPM 317
            L+G R+ SLI+TPPP R PIKTHLS ++ E + +AI+ ELDRGGQVFYV+PRI+G+EE  
Sbjct: 813  LSGIREMSLITTPPPSRRPIKTHLSPYNPEVIRTAIRNELDRGGQVFYVVPRIEGIEELG 872

Query: 318  DFLQQAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQ 377
              L+Q  P   IAI HGQ    +LE TM  F  G   IL+CT I+E+GLDI   NTIIV+
Sbjct: 873  GQLRQMVPSARIAIGHGQMEESELESTMLAFNDGEADILVCTTIIEAGLDIPRVNTIIVE 932

Query: 378  DVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQALERLAALEECRELGQGFQLA 437
            D Q+FGLAQLYQLRGRVGR+  +AHA+L YP++  L+++A  RL AL+E  +LG G+QLA
Sbjct: 933  DAQKFGLAQLYQLRGRVGRSGIQAHAWLLYPNQKQLTEKARLRLRALQEFSQLGSGYQLA 992

Query: 438  EKDMGIRGFGTIFGEQQTGDVGNVGVDLFFEMLFESLSKVDEHCVISVPYKSVQIDININ 497
             +DM IRG G + G +Q+G +  +G + + EML +++ ++    +  V  +  QID+ + 
Sbjct: 993  TRDMEIRGVGNLLGAEQSGQMEAIGYEFYMEMLQDAIKEIQGQEIPKV--EDTQIDLPLT 1050

Query: 498  PRLPSEYINHLENPMEMVNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKKLYVR 557
              +PS+YI  LE  M            D   L +       +YG  P  +E L K + ++
Sbjct: 1051 AFIPSDYIPDLEEKMAAYRRITSIESTD--ELPKIALDWGDRYGMLPSPVEELFKVVKLK 1108

Query: 558  RMAADIGITKIYASGKM-VGMKTNMNKKVFKMMIDSMTSEVH 598
             +A  +G ++I   GK  + ++T M +  +K++ +++ + + 
Sbjct: 1109 HLAKSLGFSRIKVEGKQNLVLETPMEEPAWKLLAENLPNHLQ 1150
Necessary for strand-specific repair. A lesion in the template strand blocks the RNA polymerase complex (RNAP). The RNAP-DNA-RNA complex is specifically recognized by TRCF which releases RNAP and the truncated transcript; the TCRF may replace RNAP at the lesion site and then recruit the UvrA/B/C repair system.
Synechocystis sp. (strain PCC 6803 / Kazusa) (taxid: 1111708)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: -
>sp|Q4L3G0|MFD_STAHJ Transcription-repair-coupling factor OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mfd PE=3 SV=1 Back     alignment and function description
>sp|Q5HRQ2|MFD_STAEQ Transcription-repair-coupling factor OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mfd PE=3 SV=1 Back     alignment and function description
>sp|P37474|MFD_BACSU Transcription-repair-coupling factor OS=Bacillus subtilis (strain 168) GN=mfd PE=3 SV=1 Back     alignment and function description
>sp|Q8CMT1|MFD_STAES Transcription-repair-coupling factor OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mfd PE=3 SV=1 Back     alignment and function description
>sp|Q49V12|MFD_STAS1 Transcription-repair-coupling factor OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mfd PE=3 SV=1 Back     alignment and function description
>sp|Q2YVY2|MFD_STAAB Transcription-repair-coupling factor OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=mfd PE=3 SV=1 Back     alignment and function description
>sp|Q7A7B2|MFD_STAAN Transcription-repair-coupling factor OS=Staphylococcus aureus (strain N315) GN=mfd PE=1 SV=1 Back     alignment and function description
>sp|Q99WA0|MFD_STAAM Transcription-repair-coupling factor OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mfd PE=1 SV=1 Back     alignment and function description
>sp|Q8NXZ6|MFD_STAAW Transcription-repair-coupling factor OS=Staphylococcus aureus (strain MW2) GN=mfd PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query643
224128810 817 predicted protein [Populus trichocarpa] 0.982 0.773 0.870 0.0
297832728 823 hypothetical protein ARALYDRAFT_477305 [ 0.978 0.764 0.866 0.0
18396054 823 putative DEAD/DEAH box helicase [Arabido 0.978 0.764 0.865 0.0
145331730 822 putative DEAD/DEAH box helicase [Arabido 0.978 0.765 0.865 0.0
13877639 823 putative helicase [Arabidopsis thaliana] 0.978 0.764 0.863 0.0
25084218 822 putative helicase [Arabidopsis thaliana] 0.978 0.765 0.863 0.0
312282627 823 unnamed protein product [Thellungiella h 0.982 0.767 0.851 0.0
225451661 823 PREDICTED: transcription-repair-coupling 0.978 0.764 0.847 0.0
296082243640 unnamed protein product [Vitis vinifera] 0.978 0.982 0.847 0.0
356560412 826 PREDICTED: transcription-repair-coupling 0.982 0.765 0.843 0.0
>gi|224128810|ref|XP_002320427.1| predicted protein [Populus trichocarpa] gi|222861200|gb|EEE98742.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 1158 bits (2996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/633 (87%), Positives = 602/633 (95%), Gaps = 1/633 (0%)

Query: 11  CGSIMFCYDFRPNETKRPRTLSKLSDTTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKR 70
              +++ Y+  PNETKRPRTLSKLSDT AWERRKTKGKVAIQKMVVDLMELYLHRLKQ+R
Sbjct: 186 ASRMLYRYNL-PNETKRPRTLSKLSDTGAWERRKTKGKVAIQKMVVDLMELYLHRLKQRR 244

Query: 71  PPYPKNPAIAEFAAQFPYEPTPDQKKAFLDVERDLTERETPMDRLICGDVGFGKTEVALR 130
           PPYPK P +AEFAAQFPYEPTPDQK AF+DVERDL +RETPMDRLICGDVGFGKTEVALR
Sbjct: 245 PPYPKTPFMAEFAAQFPYEPTPDQKLAFIDVERDLNQRETPMDRLICGDVGFGKTEVALR 304

Query: 131 AIFCVVSAGKQAMVLAPTIVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMI 190
           AIFC+VSAGKQAMVLAPTIVLAKQHFDV+SERFSKY  IKV LLSRFQSKAEKE +L+MI
Sbjct: 305 AIFCIVSAGKQAMVLAPTIVLAKQHFDVISERFSKYSHIKVALLSRFQSKAEKEMYLNMI 364

Query: 191 KHGHLNIIVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPI 250
           +HGHL+IIVGTHSLLG+RVVYNNLGLLVVDEEQRFGVKQKEKIASFK SVDVLTLSATPI
Sbjct: 365 EHGHLDIIVGTHSLLGNRVVYNNLGLLVVDEEQRFGVKQKEKIASFKTSVDVLTLSATPI 424

Query: 251 PRTLYLALTGFRDASLISTPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRI 310
           PRTLYLALTGFRDASLISTPPPER+PIKTHLSA++K+K+ISAIKYELDRGGQVFYVLPRI
Sbjct: 425 PRTLYLALTGFRDASLISTPPPERVPIKTHLSAYNKDKLISAIKYELDRGGQVFYVLPRI 484

Query: 311 KGLEEPMDFLQQAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQN 370
           KGLEE  DFL+Q+FP V+IA+AHGQQYS+QLE+TME+FAQG IKILICTNIVESGLDIQN
Sbjct: 485 KGLEEVKDFLEQSFPNVEIAVAHGQQYSKQLEDTMEQFAQGEIKILICTNIVESGLDIQN 544

Query: 371 ANTIIVQDVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQALERLAALEECREL 430
           ANTII+QDVQ FGLAQLYQLRGRVGRADKEAHA+LFYPDKS+L+DQALERLAALEECREL
Sbjct: 545 ANTIIIQDVQLFGLAQLYQLRGRVGRADKEAHAHLFYPDKSMLTDQALERLAALEECREL 604

Query: 431 GQGFQLAEKDMGIRGFGTIFGEQQTGDVGNVGVDLFFEMLFESLSKVDEHCVISVPYKSV 490
           GQGFQLAE+DMGIRGFGTIFGEQQTGDVGNVGVD FFEMLFESLSKVDEH VISVPY+SV
Sbjct: 605 GQGFQLAERDMGIRGFGTIFGEQQTGDVGNVGVDFFFEMLFESLSKVDEHRVISVPYQSV 664

Query: 491 QIDININPRLPSEYINHLENPMEMVNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEIL 550
           QID+NINP LPS+YIN+LENPME++NEAEKAAE DIW LMQFTE+LRRQYGKEP SMEI+
Sbjct: 665 QIDLNINPHLPSDYINYLENPMEIINEAEKAAETDIWSLMQFTENLRRQYGKEPSSMEII 724

Query: 551 LKKLYVRRMAADIGITKIYASGKMVGMKTNMNKKVFKMMIDSMTSEVHRNSLTFEGDQIK 610
           LKKLYVRRMAADIGIT+IYASGKMVGM+TNM+KKVFK+M DSM+SE+HRNSL F+G++IK
Sbjct: 725 LKKLYVRRMAADIGITRIYASGKMVGMETNMSKKVFKLMTDSMSSEMHRNSLFFDGNEIK 784

Query: 611 AELLLELPREQLLNWIFQCLAELYASLPALIKY 643
           AELLLELPR QLLNWIFQC+AEL+A LPALIKY
Sbjct: 785 AELLLELPRAQLLNWIFQCIAELHACLPALIKY 817

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297832728|ref|XP_002884246.1| hypothetical protein ARALYDRAFT_477305 [Arabidopsis lyrata subsp. lyrata] gi|297330086|gb|EFH60505.1| hypothetical protein ARALYDRAFT_477305 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18396054|ref|NP_566160.1| putative DEAD/DEAH box helicase [Arabidopsis thaliana] gi|332640233|gb|AEE73754.1| putative DEAD/DEAH box helicase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|145331730|ref|NP_001078092.1| putative DEAD/DEAH box helicase [Arabidopsis thaliana] gi|6513947|gb|AAF14851.1|AC011664_33 putative helicase [Arabidopsis thaliana] gi|332640234|gb|AEE73755.1| putative DEAD/DEAH box helicase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|13877639|gb|AAK43897.1|AF370520_1 putative helicase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|25084218|gb|AAN72199.1| putative helicase [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|312282627|dbj|BAJ34179.1| unnamed protein product [Thellungiella halophila] Back     alignment and taxonomy information
>gi|225451661|ref|XP_002276313.1| PREDICTED: transcription-repair-coupling factor-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296082243|emb|CBI21248.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356560412|ref|XP_003548486.1| PREDICTED: transcription-repair-coupling factor-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query643
TAIR|locus:2078673823 AT3G02060 [Arabidopsis thalian 0.978 0.764 0.825 2.8e-279
TIGR_CMR|CHY_02001160 CHY_0200 "transcription-repair 0.853 0.473 0.392 1.2e-106
TIGR_CMR|GSU_00171157 GSU_0017 "transcription-repair 0.818 0.454 0.414 5.3e-104
TIGR_CMR|ECH_02501134 ECH_0250 "transcription-repair 0.874 0.495 0.381 2.9e-103
TIGR_CMR|BA_00521176 BA_0052 "transcription-repair 0.824 0.450 0.387 5.4e-102
TIGR_CMR|DET_12811148 DET_1281 "transcription-repair 0.884 0.495 0.378 6.2e-101
TIGR_CMR|SO_22551164 SO_2255 "transcription-repair 0.833 0.460 0.371 5.8e-98
TIGR_CMR|SPO_20741142 SPO_2074 "transcription-repair 0.818 0.460 0.401 3.2e-97
TIGR_CMR|CBU_11481157 CBU_1148 "transcription-repair 0.835 0.464 0.388 2.2e-96
UNIPROTKB|Q9KQW21155 VC1886 "Transcription-repair c 0.830 0.462 0.387 7.6e-96
TAIR|locus:2078673 AT3G02060 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2684 (949.9 bits), Expect = 2.8e-279, P = 2.8e-279
 Identities = 520/630 (82%), Positives = 573/630 (90%)

Query:    14 IMFCYDFRPNETKRPRTLSKLSDTTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPPY 73
             +++ Y+  PNETKRPRTLS+LSDT+ WERRKTKGKVAIQKMVVDLMELYLHRL+QKR PY
Sbjct:   195 LLYRYNL-PNETKRPRTLSRLSDTSVWERRKTKGKVAIQKMVVDLMELYLHRLRQKRYPY 253

Query:    74 PKNPAIAEFAAQFPYEPTPDQKKAFLDVERDLTERETPMDRLICGDVGFGKTEVALRAIF 133
             PKNP +A+FAAQFPY  TPDQK+AFLDVE+DLTERETPMDRLICGDVGFGKTEVALRAIF
Sbjct:   254 PKNPIMADFAAQFPYNATPDQKQAFLDVEKDLTERETPMDRLICGDVGFGKTEVALRAIF 313

Query:   134 CVVSAGKQAMVLAPTIVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHG 193
             CVVS GKQAMVLAPTIVLAKQH+DV+SERFS YP IKVGLLSRFQ+KAEKEE+L+MIK G
Sbjct:   314 CVVSTGKQAMVLAPTIVLAKQHYDVISERFSLYPHIKVGLLSRFQTKAEKEEYLEMIKTG 373

Query:   194 HLNIIVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPRT 253
             HLNIIVGTHSLLGSRVVY+NLGLLVVDEEQRFGVKQKEKIASFK SVDVLTLSATPIPRT
Sbjct:   374 HLNIIVGTHSLLGSRVVYSNLGLLVVDEEQRFGVKQKEKIASFKTSVDVLTLSATPIPRT 433

Query:   254 LYLALTGFRDASLISTPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGL 313
             LYLALTGFRDASLISTPPPER+PIKTHLS+F KEKVI AIK ELDRGGQVFYVLPRIKGL
Sbjct:   434 LYLALTGFRDASLISTPPPERIPIKTHLSSFRKEKVIEAIKNELDRGGQVFYVLPRIKGL 493

Query:   314 EEPMDFLQQAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANT 373
             EE MDFL++AFP +DIA+AHG+QYS+QLEETME+FAQG IKILICTNIVESGLDIQNANT
Sbjct:   494 EEVMDFLEEAFPDIDIAMAHGKQYSKQLEETMERFAQGKIKILICTNIVESGLDIQNANT 553

Query:   374 IIVQDVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQXXXXXXXXXXXXXXGQG 433
             II+QDVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQ              GQG
Sbjct:   554 IIIQDVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQALERLSALEECRELGQG 613

Query:   434 FQLAEKDMGIRGFGTIFGEQQTGDVGNVGVDLFFEMLFESLSKVDEHCVISVPYKSVQID 493
             FQLAEKDMGIRGFGTIFGEQQTGDVGNVG+DLFFEMLFESLSKV+E  + SVPY  V+ID
Sbjct:   614 FQLAEKDMGIRGFGTIFGEQQTGDVGNVGIDLFFEMLFESLSKVEELRIFSVPYDLVKID 673

Query:   494 ININPRLPSEYINHLENPMEMVNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKK 553
             ININPRLPSEY+N+LENPME+++EAEKAAE+D+W LMQFTE+LRRQYGKEPYSMEI+LKK
Sbjct:   674 ININPRLPSEYVNYLENPMEIIHEAEKAAEKDMWSLMQFTENLRRQYGKEPYSMEIILKK 733

Query:   554 LYVRRMAADIGITKIYASGKMVGMKTNMNKKVFKMMIDSMTSEVHRNSLTFEGDQIKAXX 613
             LYVRRMAAD+G+ +IYASGKMV MKTNM+KKVFK++ DSMT +V+R+SL +EGDQI A  
Sbjct:   734 LYVRRMAADLGVNRIYASGKMVVMKTNMSKKVFKLITDSMTCDVYRSSLIYEGDQIMAEL 793

Query:   614 XXXXXXXXXXNWIFQCLAELYASLPALIKY 643
                       NW+FQCL+EL+ASLPALIKY
Sbjct:   794 LLELPREQLLNWMFQCLSELHASLPALIKY 823
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003684 "damaged DNA binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006281 "DNA repair" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
GO:0006783 "heme biosynthetic process" evidence=RCA
TIGR_CMR|CHY_0200 CHY_0200 "transcription-repair coupling factor" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0017 GSU_0017 "transcription-repair coupling factor" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0250 ECH_0250 "transcription-repair coupling factor" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|BA_0052 BA_0052 "transcription-repair coupling factor" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|DET_1281 DET_1281 "transcription-repair coupling factor" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|SO_2255 SO_2255 "transcription-repair coupling factor" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2074 SPO_2074 "transcription-repair coupling factor" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1148 CBU_1148 "transcription-repair coupling factor" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KQW2 VC1886 "Transcription-repair coupling factor" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query643
COG11971139 COG1197, Mfd, Transcription-repair coupling factor 0.0
TIGR00580926 TIGR00580, mfd, transcription-repair coupling fact 0.0
PRK106891147 PRK10689, PRK10689, transcription-repair coupling 1e-130
PRK10917681 PRK10917, PRK10917, ATP-dependent DNA helicase Rec 1e-112
COG1200677 COG1200, RecG, RecG-like helicase [DNA replication 1e-106
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 1e-102
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 6e-27
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 4e-25
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 7e-22
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 1e-20
COG1198730 COG1198, PriA, Primosomal protein N' (replication 3e-18
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 6e-17
smart0049082 smart00490, HELICc, helicase superfamily c-termina 1e-14
TIGR00595505 TIGR00595, priA, primosomal protein N' 2e-14
PRK05580679 PRK05580, PRK05580, primosome assembly protein Pri 1e-13
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 2e-11
COG4098441 COG4098, comFA, Superfamily II DNA/RNA helicase re 8e-11
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 5e-09
COG1202830 COG1202, COG1202, Superfamily II helicase, archaea 2e-05
COG1110 1187 COG1110, COG1110, Reverse gyrase [DNA replication, 3e-05
COG4581 1041 COG4581, COG4581, Superfamily II RNA helicase [DNA 1e-04
COG1198730 COG1198, PriA, Primosomal protein N' (replication 2e-04
TIGR00595505 TIGR00595, priA, primosomal protein N' 2e-04
PRK05580679 PRK05580, PRK05580, primosome assembly protein Pri 2e-04
COG1205 851 COG1205, COG1205, Distinct helicase family with a 2e-04
cd00268203 cd00268, DEADc, DEAD-box helicases 2e-04
PRK01172674 PRK01172, PRK01172, ski2-like helicase; Provisiona 3e-04
PRK09401 1176 PRK09401, PRK09401, reverse gyrase; Reviewed 4e-04
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 6e-04
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 0.001
PHA02653675 PHA02653, PHA02653, RNA helicase NPH-II; Provision 0.002
smart0105899 smart01058, CarD_TRCF, CarD-like/TRCF domain 0.004
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 0.004
>gnl|CDD|224118 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information 
 Score =  639 bits (1650), Expect = 0.0
 Identities = 257/609 (42%), Positives = 379/609 (62%), Gaps = 15/609 (2%)

Query: 30   TLSKLSDTTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPPYPKNPAI-AEFAAQFPY 88
             L KL    AW++ K K +  ++ +  +L++LY  R  +K   +P +     EF A FPY
Sbjct: 535  KLHKLGGG-AWKKAKAKARKKVRDIAAELIKLYAKRQAKKGFAFPPDTEWQEEFEASFPY 593

Query: 89   EPTPDQKKAFLDVERDLTERETPMDRLICGDVGFGKTEVALRAIFCVVSAGKQAMVLAPT 148
            E TPDQ KA  +V+RD+ E   PMDRLICGDVGFGKTEVA+RA F  V  GKQ  VL PT
Sbjct: 594  EETPDQLKAIEEVKRDM-ESGKPMDRLICGDVGFGKTEVAMRAAFKAVMDGKQVAVLVPT 652

Query: 149  IVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHGHLNIIVGTHSLLGSR 208
             +LA+QH++   ERF+ +P +++ +LSRF+S  E++E L  +  G ++I++GTH LL   
Sbjct: 653  TLLAQQHYETFKERFAGFP-VRIEVLSRFRSAKEQKEILKGLAEGKVDIVIGTHRLLSKD 711

Query: 209  VVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPRTLYLALTGFRDASLIS 268
            V + +LGLL++DEEQRFGVK KEK+   + +VDVLTLSATPIPRTL ++L+G RD S+I+
Sbjct: 712  VKFKDLGLLIIDEEQRFGVKHKEKLKELRANVDVLTLSATPIPRTLNMSLSGIRDLSVIA 771

Query: 269  TPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPMDFLQQAFPGVD 328
            TPP +RLP+KT +S +    +  AI  EL RGGQVFYV  R++ +E+  + L++  P   
Sbjct: 772  TPPEDRLPVKTFVSEYDDLLIREAILRELLRGGQVFYVHNRVESIEKKAERLRELVPEAR 831

Query: 329  IAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLY 388
            IA+AHGQ   R+LEE M  F  G   +L+CT I+E+G+DI NANTII++   +FGLAQLY
Sbjct: 832  IAVAHGQMRERELEEVMLDFYNGEYDVLVCTTIIETGIDIPNANTIIIERADKFGLAQLY 891

Query: 389  QLRGRVGRADKEAHAYLFYPDKSLLSDQALERLAALEECRELGQGFQLAEKDMGIRGFGT 448
            QLRGRVGR++K+A+AY  YP +  L++ A +RL A+    ELG GF+LA  D+ IRG G 
Sbjct: 892  QLRGRVGRSNKQAYAYFLYPPQKALTEDAEKRLEAIASFTELGAGFKLAMHDLEIRGAGN 951

Query: 449  IFGEQQTGDVGNVGVDLFFEMLFESLSKVDEHCVISVPYKSVQIDININPRLPSEYINHL 508
            + GE+Q+G + +VG DL+ EML E+++ +     +    K V+ID+ +   +P +YI   
Sbjct: 952  LLGEEQSGHIESVGFDLYMEMLEEAIAALKGSLEVLEEEKEVEIDLPVPAFIPEDYIPDD 1011

Query: 509  ENPMEM---VNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKKLYVRRMAADIGI 565
               +E+   +  AE   E     L +  E L  ++G  P  ++ LL    ++ +A  +GI
Sbjct: 1012 NLRLELYKRLANAESEEE-----LEEIKEELIDRFGPLPDEVKNLLDIAELKLLARKLGI 1066

Query: 566  TKIYASGKMVGMKTNMNKKVFKMMIDSMTSEVHRNSLTFEGDQIKAELLLELPR-EQLLN 624
             KI A    V ++ + N++V    +  +  +        +GD  K   + +L   E+ L+
Sbjct: 1067 EKIDAGENGVVIEFSKNEQVNPKKLIKLLQK-QPLKAKLKGDT-KLLFIKDLIEPEERLD 1124

Query: 625  WIFQCLAEL 633
             + + L  L
Sbjct: 1125 AVAKLLKAL 1133

Length = 1139
>gnl|CDD|233032 TIGR00580, mfd, transcription-repair coupling factor (mfd) Back     alignment and domain information
>gnl|CDD|182649 PRK10689, PRK10689, transcription-repair coupling factor; Provisional Back     alignment and domain information
>gnl|CDD|236794 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>gnl|CDD|224121 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|224119 COG1198, PriA, Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|233040 TIGR00595, priA, primosomal protein N' Back     alignment and domain information
>gnl|CDD|235514 PRK05580, PRK05580, primosome assembly protein PriA; Validated Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|226583 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|224035 COG1110, COG1110, Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|226947 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224119 COG1198, PriA, Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233040 TIGR00595, priA, primosomal protein N' Back     alignment and domain information
>gnl|CDD|235514 PRK05580, PRK05580, primosome assembly protein PriA; Validated Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|100801 PRK01172, PRK01172, ski2-like helicase; Provisional Back     alignment and domain information
>gnl|CDD|236498 PRK09401, PRK09401, reverse gyrase; Reviewed Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional Back     alignment and domain information
>gnl|CDD|215001 smart01058, CarD_TRCF, CarD-like/TRCF domain Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 643
COG11971139 Mfd Transcription-repair coupling factor (superfam 100.0
PRK106891147 transcription-repair coupling factor; Provisional 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
COG1200677 RecG RecG-like helicase [DNA replication, recombin 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
KOG0347731 consensus RNA helicase [RNA processing and modific 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0346569 consensus RNA helicase [RNA processing and modific 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
PRK05580679 primosome assembly protein PriA; Validated 100.0
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0334997 consensus RNA helicase [RNA processing and modific 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
TIGR00595505 priA primosomal protein N'. All proteins in this f 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 100.0
COG1198730 PriA Primosomal protein N' (replication factor Y) 100.0
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 100.0
PRK13766773 Hef nuclease; Provisional 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
PRK09200790 preprotein translocase subunit SecA; Reviewed 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.98
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.98
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 99.97
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.97
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.97
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.97
COG1205 851 Distinct helicase family with a unique C-terminal 99.97
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.97
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.97
PRK09694878 helicase Cas3; Provisional 99.97
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.97
KOG0354746 consensus DEAD-box like helicase [General function 99.97
PRK04914 956 ATP-dependent helicase HepA; Validated 99.96
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.95
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.95
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.95
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.95
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.94
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.94
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.94
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.93
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.93
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.93
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.93
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.92
PRK14873665 primosome assembly protein PriA; Provisional 99.92
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.91
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.91
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.91
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.9
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.9
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.88
PRK05298652 excinuclease ABC subunit B; Provisional 99.88
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.88
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.87
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.86
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.86
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 99.85
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.85
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.85
COG4096 875 HsdR Type I site-specific restriction-modification 99.85
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.84
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.83
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.83
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.82
KOG1123776 consensus RNA polymerase II transcription initiati 99.79
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.78
KOG0387923 consensus Transcription-coupled repair protein CSB 99.76
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.74
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 99.73
smart00487201 DEXDc DEAD-like helicases superfamily. 99.73
COG4889 1518 Predicted helicase [General function prediction on 99.73
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.72
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.71
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.71
PF03461101 TRCF: TRCF domain; InterPro: IPR005118 This domain 99.7
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.7
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.67
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.67
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 99.65
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 99.64
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.63
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.62
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.6
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.58
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 99.57
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 99.55
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 99.53
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.5
smart0049082 HELICc helicase superfamily c-terminal domain. 99.49
KOG03861157 consensus Chromatin remodeling complex SWI/SNF, co 99.48
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.45
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.43
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.4
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 99.33
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.3
KOG4439901 consensus RNA polymerase II transcription terminat 99.28
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.25
COG0653822 SecA Preprotein translocase subunit SecA (ATPase, 99.18
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.18
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 99.18
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.17
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.14
COG0610962 Type I site-specific restriction-modification syst 99.09
KOG1002791 consensus Nucleotide excision repair protein RAD16 99.07
smart00489289 DEXDc3 DEAD-like helicases superfamily. 99.07
smart00488289 DEXDc2 DEAD-like helicases superfamily. 99.07
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 99.02
KOG10151567 consensus Transcription regulator XNP/ATRX, DEAD-b 98.93
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.8
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 98.63
PRK15483 986 type III restriction-modification system StyLTI en 98.53
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.41
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.25
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.08
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.05
KOG1803649 consensus DNA helicase [Replication, recombination 98.04
PRK10536262 hypothetical protein; Provisional 98.03
TIGR00376637 DNA helicase, putative. The gene product may repre 98.01
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.87
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.86
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.73
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 97.71
PF1324576 AAA_19: Part of AAA domain 97.69
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.69
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.68
KOG2340698 consensus Uncharacterized conserved protein [Funct 97.64
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.64
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 97.61
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.58
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.58
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.4
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 97.35
PRK04296190 thymidine kinase; Provisional 97.29
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 97.25
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.24
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 97.2
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 97.2
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.19
PRK08181269 transposase; Validated 97.17
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.16
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 97.12
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 97.09
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.08
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.08
PRK06526254 transposase; Provisional 97.06
PRK07952244 DNA replication protein DnaC; Validated 97.05
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 97.02
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.99
PRK14974336 cell division protein FtsY; Provisional 96.94
KOG18051100 consensus DNA replication helicase [Replication, r 96.93
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 96.9
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.89
PRK106891147 transcription-repair coupling factor; Provisional 96.87
COG2256436 MGS1 ATPase related to the helicase subunit of the 96.86
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 96.84
COG11971139 Mfd Transcription-repair coupling factor (superfam 96.8
PRK14873 665 primosome assembly protein PriA; Provisional 96.79
PRK08084235 DNA replication initiation factor; Provisional 96.78
COG1200677 RecG RecG-like helicase [DNA replication, recombin 96.76
smart00382148 AAA ATPases associated with a variety of cellular 96.73
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 96.73
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.7
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 96.69
KOG1001674 consensus Helicase-like transcription factor HLTF/ 96.69
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 96.66
TIGR00643630 recG ATP-dependent DNA helicase RecG. 96.63
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 96.56
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.54
PRK11054684 helD DNA helicase IV; Provisional 96.52
PHA03333752 putative ATPase subunit of terminase; Provisional 96.51
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 96.49
PRK05580 679 primosome assembly protein PriA; Validated 96.48
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 96.4
PRK13342413 recombination factor protein RarA; Reviewed 96.39
COG1198 730 PriA Primosomal protein N' (replication factor Y) 96.38
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 96.36
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 96.35
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 96.34
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 96.34
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 96.33
PRK08903227 DnaA regulatory inactivator Hda; Validated 96.3
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.3
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.28
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 96.27
PRK00771437 signal recognition particle protein Srp54; Provisi 96.27
TIGR00064272 ftsY signal recognition particle-docking protein F 96.25
PRK10416318 signal recognition particle-docking protein FtsY; 96.23
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 96.18
smart00492141 HELICc3 helicase superfamily c-terminal domain. 96.15
PRK13341 725 recombination factor protein RarA/unknown domain f 96.15
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 96.14
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 96.11
PHA02533534 17 large terminase protein; Provisional 96.1
PTZ001121164 origin recognition complex 1 protein; Provisional 96.09
PRK08727233 hypothetical protein; Validated 96.07
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 96.07
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 96.05
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.02
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 96.01
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 96.01
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 95.99
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 95.98
smart00491142 HELICc2 helicase superfamily c-terminal domain. 95.98
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 95.98
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.95
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 95.93
PRK06893229 DNA replication initiation factor; Validated 95.93
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 95.92
PRK09112351 DNA polymerase III subunit delta'; Validated 95.91
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.89
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 95.88
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.87
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 95.86
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 95.84
PTZ00293211 thymidine kinase; Provisional 95.84
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 95.84
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 95.83
KOG2028554 consensus ATPase related to the helicase subunit o 95.79
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.79
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 95.78
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 95.78
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 95.77
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 95.73
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.71
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 95.7
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 95.7
COG0552340 FtsY Signal recognition particle GTPase [Intracell 95.69
TIGR00596814 rad1 DNA repair protein (rad1). This family is bas 95.67
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 95.65
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 95.65
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 95.62
PRK00149450 dnaA chromosomal replication initiation protein; R 95.61
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 95.6
PRK05707328 DNA polymerase III subunit delta'; Validated 95.56
PRK00411394 cdc6 cell division control protein 6; Reviewed 95.56
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 95.56
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 95.55
PLN03025319 replication factor C subunit; Provisional 95.54
PRK12402337 replication factor C small subunit 2; Reviewed 95.53
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 95.52
PRK12377248 putative replication protein; Provisional 95.5
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 95.48
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 95.47
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 95.46
PRK08769319 DNA polymerase III subunit delta'; Validated 95.45
COG4098441 comFA Superfamily II DNA/RNA helicase required for 95.45
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 95.4
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 95.37
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 95.36
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.36
PRK05642234 DNA replication initiation factor; Validated 95.35
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 95.35
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 95.33
PRK05298652 excinuclease ABC subunit B; Provisional 95.32
TIGR00959428 ffh signal recognition particle protein. This mode 95.3
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 95.28
PRK10867433 signal recognition particle protein; Provisional 95.23
PRK07940394 DNA polymerase III subunit delta'; Validated 95.22
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 95.2
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 95.17
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 95.17
PRK06871325 DNA polymerase III subunit delta'; Validated 95.13
COG4626546 Phage terminase-like protein, large subunit [Gener 95.12
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 95.12
KOG0298 1394 consensus DEAD box-containing helicase-like transc 94.99
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 94.95
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 94.94
COG1221403 PspF Transcriptional regulators containing an AAA- 94.93
KOG1513 1300 consensus Nuclear helicase MOP-3/SNO (DEAD-box sup 94.92
PRK08116268 hypothetical protein; Validated 94.91
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 94.89
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 94.87
PRK07471365 DNA polymerase III subunit delta'; Validated 94.86
COG2255332 RuvB Holliday junction resolvasome, helicase subun 94.82
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.82
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 94.77
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 94.77
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 94.76
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.75
PHA02544316 44 clamp loader, small subunit; Provisional 94.73
TIGR02928365 orc1/cdc6 family replication initiation protein. M 94.7
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.69
CHL00181287 cbbX CbbX; Provisional 94.69
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 94.65
COG0556663 UvrB Helicase subunit of the DNA excision repair c 94.64
PRK08533230 flagellar accessory protein FlaH; Reviewed 94.63
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 94.62
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 94.61
PTZ00110545 helicase; Provisional 94.61
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 94.6
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.6
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 94.56
PRK07993334 DNA polymerase III subunit delta'; Validated 94.52
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 94.5
PRK14088440 dnaA chromosomal replication initiation protein; P 94.44
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.41
PRK12422445 chromosomal replication initiation protein; Provis 94.4
PRK04328249 hypothetical protein; Provisional 94.39
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.36
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 94.35
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 94.33
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 94.28
PRK08058329 DNA polymerase III subunit delta'; Validated 94.24
TIGR02012321 tigrfam_recA protein RecA. This model describes or 94.23
PRK13767876 ATP-dependent helicase; Provisional 94.22
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 94.21
PRK06090319 DNA polymerase III subunit delta'; Validated 94.19
PRK13833323 conjugal transfer protein TrbB; Provisional 94.1
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 94.07
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 94.07
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 94.04
KOG0383696 consensus Predicted helicase [General function pre 94.04
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.02
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 93.99
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 93.95
COG0470325 HolB ATPase involved in DNA replication [DNA repli 93.92
PRK14087450 dnaA chromosomal replication initiation protein; P 93.91
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 93.91
PRK09183259 transposase/IS protein; Provisional 93.9
PRK06921266 hypothetical protein; Provisional 93.87
PF00004132 AAA: ATPase family associated with various cellula 93.77
PRK13894319 conjugal transfer ATPase TrbB; Provisional 93.76
PHA03368738 DNA packaging terminase subunit 1; Provisional 93.75
PRK00440319 rfc replication factor C small subunit; Reviewed 93.71
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 93.69
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 93.69
PRK07399314 DNA polymerase III subunit delta'; Validated 93.67
PRK09354349 recA recombinase A; Provisional 93.64
TIGR02237209 recomb_radB DNA repair and recombination protein R 93.59
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 93.55
PRK10865857 protein disaggregation chaperone; Provisional 93.51
PTZ00424401 helicase 45; Provisional 93.44
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 93.43
cd03115173 SRP The signal recognition particle (SRP) mediates 93.37
PHA02558501 uvsW UvsW helicase; Provisional 93.3
PRK05564313 DNA polymerase III subunit delta'; Validated 93.27
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 93.27
PHA02244383 ATPase-like protein 93.23
COG3972660 Superfamily I DNA and RNA helicases [General funct 93.18
PF13871278 Helicase_C_4: Helicase_C-like 93.18
cd01393226 recA_like RecA is a bacterial enzyme which has rol 93.18
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 93.15
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 93.1
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 93.09
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 93.08
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 93.04
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 93.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 92.88
PRK06964342 DNA polymerase III subunit delta'; Validated 92.83
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 92.8
PRK13851344 type IV secretion system protein VirB11; Provision 92.75
PRK09694878 helicase Cas3; Provisional 92.68
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 92.58
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 92.46
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 92.36
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 92.26
PRK05973237 replicative DNA helicase; Provisional 92.23
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 92.23
CHL00176638 ftsH cell division protein; Validated 92.23
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 92.07
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 92.06
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 91.98
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 91.98
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 91.97
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 91.95
COG3973747 Superfamily I DNA and RNA helicases [General funct 91.84
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 91.79
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 91.64
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 91.6
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 91.55
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 91.54
PRK09376416 rho transcription termination factor Rho; Provisio 91.5
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 91.47
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 91.46
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 91.45
PRK06835329 DNA replication protein DnaC; Validated 91.28
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 91.28
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 91.27
PRK14086617 dnaA chromosomal replication initiation protein; P 91.26
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 91.25
cd01394218 radB RadB. The archaeal protein radB shares simila 91.24
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 91.21
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 91.18
COG0593408 DnaA ATPase involved in DNA replication initiation 91.18
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 91.15
COG1485367 Predicted ATPase [General function prediction only 91.1
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 91.06
CHL00095821 clpC Clp protease ATP binding subunit 91.05
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 91.04
TIGR02858270 spore_III_AA stage III sporulation protein AA. Mem 90.92
PF0255998 CarD_CdnL_TRCF: CarD-like/TRCF domain; InterPro: I 90.88
PF12846304 AAA_10: AAA-like domain 90.79
PRK10865 857 protein disaggregation chaperone; Provisional 90.78
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 90.77
PRK10436462 hypothetical protein; Provisional 90.6
KOG2170344 consensus ATPase of the AAA+ superfamily [General 90.52
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 90.46
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 90.41
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 90.18
KOG0701 1606 consensus dsRNA-specific nuclease Dicer and relate 90.16
PRK04195482 replication factor C large subunit; Provisional 90.04
TIGR02974329 phageshock_pspF psp operon transcriptional activat 89.97
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 89.91
PRK01172674 ski2-like helicase; Provisional 89.83
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 89.81
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 89.77
PRK07414178 cob(I)yrinic acid a,c-diamide adenosyltransferase; 89.7
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 89.62
TIGR00767415 rho transcription termination factor Rho. Members 89.58
PHA00350399 putative assembly protein 89.54
PRK03992389 proteasome-activating nucleotidase; Provisional 89.47
CHL00095821 clpC Clp protease ATP binding subunit 89.44
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 89.39
COG0210 655 UvrD Superfamily I DNA and RNA helicases [DNA repl 89.37
COG2874235 FlaH Predicted ATPases involved in biogenesis of a 89.36
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 89.31
PRK06067234 flagellar accessory protein FlaH; Validated 88.87
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 88.79
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 88.64
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 88.64
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 88.58
PRK09361225 radB DNA repair and recombination protein RadB; Pr 88.57
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 88.44
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 88.42
TIGR02688449 conserved hypothetical protein TIGR02688. Members 88.39
PRK11823446 DNA repair protein RadA; Provisional 88.34
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 88.31
PRK08939306 primosomal protein DnaI; Reviewed 88.28
TIGR02533486 type_II_gspE general secretory pathway protein E. 88.24
KOG2036 1011 consensus Predicted P-loop ATPase fused to an acet 88.19
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 88.03
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 87.96
PRK08699325 DNA polymerase III subunit delta'; Validated 87.91
PHA02542473 41 41 helicase; Provisional 87.68
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 87.66
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 87.57
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 87.53
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 87.51
PF02606326 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPr 87.45
PRK15429686 formate hydrogenlyase transcriptional activator Fh 87.44
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information 
Probab=100.00  E-value=3e-127  Score=1088.51  Aligned_cols=625  Identities=41%  Similarity=0.677  Sum_probs=580.8

Q ss_pred             ccccccccccccc---------eeeeecCCCCCCchHHHhcCCCCcHHHHHHHHHHHhHHHHHHHHHHHHHHHHcCCCCC
Q 006476            2 HMYLCNSCTCGSI---------MFCYDFRPNETKRPRTLSKLSDTTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPP   72 (643)
Q Consensus         2 ~~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~l~~l~~~~~w~~~~~~~~~~~~~~~~~l~~~~~~r~~~~~~~   72 (643)
                      |=||.+.|..++|         +|+||+|.++  ..|+|+|||+ ++|+++|+|++++++++|.+|+++|++|+..+|++
T Consensus       500 ~dyL~l~Ya~~dkLyVPVeql~lisrY~g~~~--~~p~L~kLG~-~~W~k~K~K~~~~v~diA~eLi~lyA~R~~~~G~a  576 (1139)
T COG1197         500 RDYLELEYAGEDKLYVPVEQLHLISRYVGASD--EAPKLHKLGG-GAWKKAKAKARKKVRDIAAELIKLYAKRQAKKGFA  576 (1139)
T ss_pred             cceEEEEEcCCCeEEEEHHHhhHHhhccCCCC--CCccccccCc-HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCC
Confidence            3477887777765         5899998755  4799999985 99999999999999999999999999999999999


Q ss_pred             CCCCh-hHHHHHhcCCCCCCHHHHHHHHHhHHhhccCCCCCcEEEEccCCCchHHHHHHHHHHHHHCCCeEEEEeccHHH
Q 006476           73 YPKNP-AIAEFAAQFPYEPTPDQKKAFLDVERDLTERETPMDRLICGDVGFGKTEVALRAIFCVVSAGKQAMVLAPTIVL  151 (643)
Q Consensus        73 ~~~~~-~~~~~~~~~~~~~tp~Q~~ai~~i~~~~~~~~~~~d~li~a~TGsGKT~~~l~~i~~~~~~g~~vlil~Pt~~L  151 (643)
                      |++|. |+..|++.|||+.||+|..||+++++|| +++++||+||||++|+|||+||++|++.++++|+||+|||||+.|
T Consensus       577 f~~d~~~q~~F~~~FPyeET~DQl~AI~eVk~DM-~~~kpMDRLiCGDVGFGKTEVAmRAAFkAV~~GKQVAvLVPTTlL  655 (1139)
T COG1197         577 FPPDTEWQEEFEASFPYEETPDQLKAIEEVKRDM-ESGKPMDRLICGDVGFGKTEVAMRAAFKAVMDGKQVAVLVPTTLL  655 (1139)
T ss_pred             CCCChHHHHHHHhcCCCcCCHHHHHHHHHHHHHh-ccCCcchheeecCcCCcHHHHHHHHHHHHhcCCCeEEEEcccHHh
Confidence            99988 9999999999999999999999999999 578999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhcCCCCceEEEEeCCCChHHHHHHHHHHhcCCceEEEechHhhhcccccCccceEEeecccccchhHHH
Q 006476          152 AKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHGHLNIIVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQKE  231 (643)
Q Consensus       152 a~Q~~~~~~~~~~~~~~i~v~~l~g~~~~~~~~~~~~~l~~g~~dIiI~T~~~L~~~~~~~~l~llViDEah~~g~~~~~  231 (643)
                      |+|||++|++||.+|| ++|..++++.+.++++..++.+++|++|||||||.+|++++.|+|+||+||||+||||+++++
T Consensus       656 A~QHy~tFkeRF~~fP-V~I~~LSRF~s~kE~~~il~~la~G~vDIvIGTHrLL~kdv~FkdLGLlIIDEEqRFGVk~KE  734 (1139)
T COG1197         656 AQQHYETFKERFAGFP-VRIEVLSRFRSAKEQKEILKGLAEGKVDIVIGTHRLLSKDVKFKDLGLLIIDEEQRFGVKHKE  734 (1139)
T ss_pred             HHHHHHHHHHHhcCCC-eeEEEecccCCHHHHHHHHHHHhcCCccEEEechHhhCCCcEEecCCeEEEechhhcCccHHH
Confidence            9999999999999997 999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhcCCCceEEEeccCCChHhHHHHHhcCCCcceeeCCCCCccceeEEEccCCHHHHHHHHHHHHhcCCeEEEEecCcc
Q 006476          232 KIASFKISVDVLTLSATPIPRTLYLALTGFRDASLISTPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIK  311 (643)
Q Consensus       232 ~l~~~~~~~~vl~lSATp~~~~~~~~~~~~~~~~~i~~~~~~~~~v~~~~~~~~~~~~~~~i~~~l~~~~qvlvf~~~~~  311 (643)
                      +|++++.++++|.|||||+|||++|++.|++|.|+|.+||.+|.||+|++.++++..+++++.+++.||||+++++|+++
T Consensus       735 kLK~Lr~~VDvLTLSATPIPRTL~Msm~GiRdlSvI~TPP~~R~pV~T~V~~~d~~~ireAI~REl~RgGQvfYv~NrV~  814 (1139)
T COG1197         735 KLKELRANVDVLTLSATPIPRTLNMSLSGIRDLSVIATPPEDRLPVKTFVSEYDDLLIREAILRELLRGGQVFYVHNRVE  814 (1139)
T ss_pred             HHHHHhccCcEEEeeCCCCcchHHHHHhcchhhhhccCCCCCCcceEEEEecCChHHHHHHHHHHHhcCCEEEEEecchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ChHHHHHHHHhhCCCCcEEEEeCCCCHHHHHHHHHHHhcCCceEEEecccccccccccCCCEEEEecCCCCCHHHHHHHH
Q 006476          312 GLEEPMDFLQQAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLYQLR  391 (643)
Q Consensus       312 ~~e~l~~~L~~~~p~~~v~~~hg~~~~~~r~~v~~~F~~g~~~ILVaT~i~~~GiDip~v~~VI~~d~p~~s~~~~~Qr~  391 (643)
                      +++.+++.|++++|+++|++.||+|+..+.+++|.+|.+|+++|||||+|+|+||||||+||+|+.++++||++|+||++
T Consensus       815 ~Ie~~~~~L~~LVPEarI~vaHGQM~e~eLE~vM~~F~~g~~dVLv~TTIIEtGIDIPnANTiIIe~AD~fGLsQLyQLR  894 (1139)
T COG1197         815 SIEKKAERLRELVPEARIAVAHGQMRERELEEVMLDFYNGEYDVLVCTTIIETGIDIPNANTIIIERADKFGLAQLYQLR  894 (1139)
T ss_pred             hHHHHHHHHHHhCCceEEEEeecCCCHHHHHHHHHHHHcCCCCEEEEeeeeecCcCCCCCceEEEeccccccHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hccCCCCCceEEEEEecCCCCCcHHHHHHHHHHHHHhhcccchhhhhhhcccccCCCccCccccCCccchhhhhHHHHHH
Q 006476          392 GRVGRADKEAHAYLFYPDKSLLSDQALERLAALEECRELGQGFQLAEKDMGIRGFGTIFGEQQTGDVGNVGVDLFFEMLF  471 (643)
Q Consensus       392 GR~GR~g~~g~a~~l~~~~~~~~~~~~~rl~~i~~~~~l~~g~~i~~~dl~irg~g~~lg~~q~g~~~~~~~~~~~~~l~  471 (643)
                      ||+||+++.||||++|++.+.+++.+.+||.+|++++++|+||++|++||+|||+||+||.+|||+|.+|||++|++||+
T Consensus       895 GRVGRS~~~AYAYfl~p~~k~lT~~A~kRL~aI~~~~~LGaGf~lA~~DLeIRGaGNlLG~eQSG~I~~VGf~LY~~mLe  974 (1139)
T COG1197         895 GRVGRSNKQAYAYFLYPPQKALTEDAEKRLEAIASFTELGAGFKLAMHDLEIRGAGNLLGEEQSGHIESVGFDLYMEMLE  974 (1139)
T ss_pred             cccCCccceEEEEEeecCccccCHHHHHHHHHHHhhhhcCchHHHHhcchhccccccccCccccCchheecHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhhcCccccccCCcceeEeeccCCCCCccccCCCCCchHHHHHHHHhcccCHHHHHHHHHHHHhhcCCCcHHHHHHH
Q 006476          472 ESLSKVDEHCVISVPYKSVQIDININPRLPSEYINHLENPMEMVNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILL  551 (643)
Q Consensus       472 ~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~p~~~~~~~  551 (643)
                      +||+++++..........+.++++++++||++||++.+.|+++|||++.+  ++.+++.++..||+||||++|+++++||
T Consensus       975 eAI~~lk~~~e~~~~~~~~eIdL~~~a~iPe~YI~d~~~rl~~YkRi~~~--~s~~el~~i~~EliDRFG~lP~ev~~Ll 1052 (1139)
T COG1197         975 EAIAALKGSLEVLEEEKEVEIDLPVPAFIPEDYIPDDNLRLELYKRLANA--ESEEELEEIKEELIDRFGPLPDEVKNLL 1052 (1139)
T ss_pred             HHHHHHhcCCcccccCCCeeEecCCCCcCChhhccCHHHHHHHHHHHHhc--CCHHHHHHHHHHHHHhcCCCCHHHHHHH
Confidence            99999998332233345789999999999999999999999999999987  7789999999999999999999999999


Q ss_pred             HHHHHHHHhhhcCcceEeecCCEEEEEeccCHHH-HHHHHHhhcccccccceeeeCCeEEEEEEec-CChHHHHHHHHHH
Q 006476          552 KKLYVRRMAADIGITKIYASGKMVGMKTNMNKKV-FKMMIDSMTSEVHRNSLTFEGDQIKAELLLE-LPREQLLNWIFQC  629 (643)
Q Consensus       552 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~  629 (643)
                      .+++||.+|.++||.+|..+++.+.|.+..+..+ ...+.+.++....  ..++. +...+.+... ....++++++..+
T Consensus      1053 ~i~~lk~la~~lgI~~i~~~~~~~~i~f~~~~~~~~~~l~~~~~~~~~--~~~~~-~~~~i~~~~~~~~~~~~l~~~~~~ 1129 (1139)
T COG1197        1053 DIAELKLLARKLGIEKIDAGENGVVIEFSKNEQVNPKKLIKLLQKQPL--KAKLK-GDTKLLFIKDLIEPEERLDAVAKL 1129 (1139)
T ss_pred             HHHHHHHHHHHcCCeeeccCCceEEEEeccccccCHHHHHHHhhccce--eeecC-CCceEEEecccCCHHHHHHHHHHH
Confidence            9999999999999999999999999987755322 3444444443222  22333 4445554444 5667789999999


Q ss_pred             HHHHHhh
Q 006476          630 LAELYAS  636 (643)
Q Consensus       630 ~~~~~~~  636 (643)
                      +..+...
T Consensus      1130 l~~L~~~ 1136 (1139)
T COG1197        1130 LKALAEL 1136 (1139)
T ss_pred             HHHHHhh
Confidence            9887653

>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF03461 TRCF: TRCF domain; InterPro: IPR005118 This domain is found in proteins necessary for strand-specific repair in DNA such as TRCF in Escherichia coli Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>TIGR02858 spore_III_AA stage III sporulation protein AA Back     alignment and domain information
>PF02559 CarD_CdnL_TRCF: CarD-like/TRCF domain; InterPro: IPR003711 The bacterium Myxococcus xanthus responds to blue light by producing carotenoids Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2874 FlaH Predicted ATPases involved in biogenesis of archaeal flagella [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PHA02542 41 41 helicase; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF02606 LpxK: Tetraacyldisaccharide-1-P 4'-kinase; InterPro: IPR003758 Tetraacyldisaccharide 4'-kinase phosphorylates the 4'-position of a tetraacyldisaccharide 1-phosphate precursor (DS-1-P) of lipid A, but the enzyme has not yet been purified because of instability [] Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query643
2eyq_A1151 Crystal Structure Of Escherichia Coli Transcription 1e-103
1gm5_A780 Structure Of Recg Bound To Three-Way Dna Junction L 5e-67
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 9e-06
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 2e-04
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 3e-04
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 3e-04
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 3e-04
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 3e-04
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 4e-04
2jgn_A185 Ddx3 Helicase Domain Length = 185 5e-04
>pdb|2EYQ|A Chain A, Crystal Structure Of Escherichia Coli Transcription-Repair Coupling Factor Length = 1151 Back     alignment and structure 
Iteration: 1

 Score =  373 bits (957), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 198/539 (36%), Positives = 311/539 (57%), Gaps = 8/539 (1%)
Query: 39   AWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPPYPKNPAIAE-FAAQFPYEPTPDQKKA 97
            AW R + K    ++ +  +L+++Y  R  ++   +  +    + F   FP+E TPDQ +A
Sbjct: 552  AWSRARQKAAEKVRDVAAELLDIYAQRAAKEGFAFKHDREQYQLFCDSFPFETTPDQAQA 611
Query: 98   FLDVERDLTERETPMDRLICGDVGFGKTEVALRAIFCVVSAGKQAMVLAPTIVLAKQHFD 157
               V  D+ +    MDRL+CGDVGFGKTEVA+RA F  V   KQ  VL PT +LA+QH+D
Sbjct: 612  INAVLSDMCQ-PLAMDRLVCGDVGFGKTEVAMRAAFLAVDNHKQVAVLVPTTLLAQQHYD 670
Query: 158  VVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHGHLNIIVGTHSLLGSRVVYNNLGLL 217
               +RF+ +P +++ ++SRF+S  E+ + L  +  G ++I++GTH LL S V + +LGLL
Sbjct: 671  NFRDRFANWP-VRIEMISRFRSAKEQTQILAEVAEGKIDILIGTHKLLQSDVKFKDLGLL 729
Query: 218  VVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPRTLYLALTGFRDASLISTPPPERLPI 277
            +VDEE RFGV+ KE+I + + +VD+LTL+ATPIPRTL +A++G RD S+I+TPP  RL +
Sbjct: 730  IVDEEHRFGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRDLSIIATPPARRLAV 789
Query: 278  KTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPMDFLQQAFPGVDIAIAHGQQY 337
            KT +  +    V  AI  E+ RGGQV+Y+   ++ +++  + L +  P   IAI HGQ  
Sbjct: 790  KTFVREYDSMVVREAILREILRGGQVYYLYNDVENIQKAAERLAELVPEARIAIGHGQMR 849
Query: 338  SRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLYQLRGRVGRA 397
             R+LE  M  F      +L+CT I+E+G+DI  ANTII++    FGLAQL+QLRGRVGR+
Sbjct: 850  ERELERVMNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERADHFGLAQLHQLRGRVGRS 909
Query: 398  DKEAHAYLFYPDKSLLSDQXXXXXXXXXXXXXXGQGFQLAEKDMGIRGFGTIFGEQQTGD 457
              +A+A+L  P    ++                G GF LA  D+ IRG G + GE+Q+G 
Sbjct: 910  HHQAYAWLLTPHPKAMTTDAQKRLEAIASLEDLGAGFALATHDLEIRGAGELLGEEQSGS 969
Query: 458  VGNVGVDLFFEML---FESLSKVDEHCVISVPYKSVQIDININPRLPSEYINHLENPMEM 514
            +  +G  L+ E+L    ++L    E  +  +  +  ++++ +   LP ++I  +   +  
Sbjct: 970  METIGFSLYMELLENAVDALKAGREPSLEDLTSQQTEVELRMPSLLPDDFIPDVNTRLSF 1029
Query: 515  VNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKKLYVRRMAADIGITKIYASGK 573
                  A  ++   L +    L  ++G  P     LL    +R+ A  +GI K+  + K
Sbjct: 1030 YKRIASAKTEN--ELEEIKVELIDRFGLLPDPARTLLDIARLRQQAQKLGIRKLEGNEK 1086
>pdb|1GM5|A Chain A, Structure Of Recg Bound To Three-Way Dna Junction Length = 780 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query643
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 0.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 1e-111
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 4e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 9e-14
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 5e-11
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 4e-10
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 8e-10
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 1e-09
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 2e-09
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 2e-09
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 5e-09
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 7e-09
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 8e-09
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 9e-09
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 1e-08
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 3e-08
1yks_A440 Genome polyprotein [contains: flavivirin protease 7e-08
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 9e-08
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 3e-07
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 6e-07
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 5e-05
3b6e_A216 Interferon-induced helicase C domain-containing P; 3e-06
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 3e-06
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 4e-06
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 4e-06
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 1e-05
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 1e-05
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 9e-05
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 2e-05
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 2e-05
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 2e-05
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 2e-05
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 2e-05
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 5e-05
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 3e-05
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 3e-05
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 3e-05
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 4e-05
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 4e-05
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 2e-04
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 5e-05
2qsr_A173 Transcription-repair coupling factor; structural g 9e-05
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 9e-05
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 2e-04
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 2e-04
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 2e-04
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 3e-04
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 7e-04
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 7e-04
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Length = 1151 Back     alignment and structure
 Score =  652 bits (1685), Expect = 0.0
 Identities = 215/625 (34%), Positives = 346/625 (55%), Gaps = 19/625 (3%)

Query: 23   NETKRPRTLSKLSDTTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPPYPK-NPAIAE 81
               +    L KL    AW R + K    ++ +  +L+++Y  R  ++   +         
Sbjct: 538  GAEENAP-LHKLG-GDAWSRARQKAAEKVRDVAAELLDIYAQRAAKEGFAFKHDREQYQL 595

Query: 82   FAAQFPYEPTPDQKKAFLDVERDLTERETPMDRLICGDVGFGKTEVALRAIFCVVSAGKQ 141
            F   FP+E TPDQ +A   V  D+  +   MDRL+CGDVGFGKTEVA+RA F  V   KQ
Sbjct: 596  FCDSFPFETTPDQAQAINAVLSDM-CQPLAMDRLVCGDVGFGKTEVAMRAAFLAVDNHKQ 654

Query: 142  AMVLAPTIVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHGHLNIIVGT 201
              VL PT +LA+QH+D   +RF+ +P +++ ++SRF+S  E+ + L  +  G ++I++GT
Sbjct: 655  VAVLVPTTLLAQQHYDNFRDRFANWP-VRIEMISRFRSAKEQTQILAEVAEGKIDILIGT 713

Query: 202  HSLLGSRVVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPRTLYLALTGF 261
            H LL S V + +LGLL+VDEE RFGV+ KE+I + + +VD+LTL+ATPIPRTL +A++G 
Sbjct: 714  HKLLQSDVKFKDLGLLIVDEEHRFGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGM 773

Query: 262  RDASLISTPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPMDFLQ 321
            RD S+I+TPP  RL +KT +  +    V  AI  E+ RGGQV+Y+   ++ +++  + L 
Sbjct: 774  RDLSIIATPPARRLAVKTFVREYDSMVVREAILREILRGGQVYYLYNDVENIQKAAERLA 833

Query: 322  QAFPGVDIAIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQ 381
            +  P   IAI HGQ   R+LE  M  F      +L+CT I+E+G+DI  ANTII++    
Sbjct: 834  ELVPEARIAIGHGQMRERELERVMNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERADH 893

Query: 382  FGLAQLYQLRGRVGRADKEAHAYLFYPDKSLLSDQALERLAALEECRELGQGFQLAEKDM 441
            FGLAQL+QLRGRVGR+  +A+A+L  P    ++  A +RL A+    +LG GF LA  D+
Sbjct: 894  FGLAQLHQLRGRVGRSHHQAYAWLLTPHPKAMTTDAQKRLEAIASLEDLGAGFALATHDL 953

Query: 442  GIRGFGTIFGEQQTGDVGNVGVDLFFEMLFESLSKV---DEHCVISVPYKSVQIDININP 498
             IRG G + GE+Q+G +  +G  L+ E+L  ++  +    E  +  +  +  ++++ +  
Sbjct: 954  EIRGAGELLGEEQSGSMETIGFSLYMELLENAVDALKAGREPSLEDLTSQQTEVELRMPS 1013

Query: 499  RLPSEYINHLENPMEM---VNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKKLY 555
             LP ++I  +   +     +  A+   E     L +    L  ++G  P     LL    
Sbjct: 1014 LLPDDFIPDVNTRLSFYKRIASAKTENE-----LEEIKVELIDRFGLLPDPARTLLDIAR 1068

Query: 556  VRRMAADIGITKIYASGKMVGMKTNMNKKVFKMMIDSMTSEVHRNSLTFEGDQIKAELLL 615
            +R+ A  +GI K+  + K   ++      V    +  +  +        +G   + + + 
Sbjct: 1069 LRQQAQKLGIRKLEGNEKGGVIEFAEKNHVNPAWLIGLLQK-QPQHYRLDGPT-RLKFIQ 1126

Query: 616  ELP-REQLLNWIFQCLAELYASLPA 639
            +L  R+  + W+ Q + EL  +  A
Sbjct: 1127 DLSERKTRIEWVRQFMRELEENAIA 1151
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Length = 780 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Length = 997 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Length = 175 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Length = 165 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Length = 1054 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Length = 300 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Length = 212 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>2qsr_A Transcription-repair coupling factor; structural genomics, PSI-2, protein ST initiative; 3.10A {Streptococcus pneumoniae} Length = 173 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Length = 163 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query643
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 100.0
3h1t_A590 Type I site-specific restriction-modification syst 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.98
3jux_A822 Protein translocase subunit SECA; protein transloc 99.97
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.96
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.96
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.96
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.96
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.95
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.94
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.93
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.93
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.93
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.93
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.93
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.93
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.93
3bor_A237 Human initiation factor 4A-II; translation initiat 99.93
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.92
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.92
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.92
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.92
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.92
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.92
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.92
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.87
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.86
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.86
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.86
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.86
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.85
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.85
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.84
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.84
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.83
2qsr_A173 Transcription-repair coupling factor; structural g 99.81
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.7
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.81
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.8
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.8
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.76
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.67
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.6
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.5
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.26
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 98.25
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.23
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 98.21
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.18
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 98.08
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 98.08
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.54
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.51
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.46
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.06
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 97.04
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.0
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.93
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.85
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.68
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.65
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 96.58
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 96.57
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.51
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 96.49
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.44
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 96.41
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 96.36
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 96.28
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 96.27
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 96.26
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 96.25
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 96.23
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 96.18
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 96.16
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.14
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 96.14
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 96.09
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 96.07
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 96.06
3bos_A242 Putative DNA replication factor; P-loop containing 96.03
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 95.96
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 95.89
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.83
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.78
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 95.73
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 95.69
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.53
2gno_A305 DNA polymerase III, gamma subunit-related protein; 95.5
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 95.31
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 95.24
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 95.23
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 95.18
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 95.18
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.16
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 95.13
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 95.04
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 95.01
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 95.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 95.0
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 94.92
3pvs_A447 Replication-associated recombination protein A; ma 94.91
2kjq_A149 DNAA-related protein; solution structure, NESG, st 94.9
3co5_A143 Putative two-component system transcriptional RES 94.89
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 94.82
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 94.67
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 94.49
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.48
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 94.36
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 94.28
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 94.25
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 94.25
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 94.15
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 94.06
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 94.03
1ojl_A304 Transcriptional regulatory protein ZRAR; response 94.01
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 93.96
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.92
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 93.88
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 93.87
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 93.79
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 93.67
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 93.63
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 93.63
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 93.61
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 92.69
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 93.55
2l8b_A189 Protein TRAI, DNA helicase I; RECD, hydrolase; NMR 93.48
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.44
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 93.36
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 93.31
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 93.27
2chq_A319 Replication factor C small subunit; DNA-binding pr 93.27
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 93.1
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 93.03
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.02
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 92.98
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 92.96
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 92.94
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 92.86
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 92.84
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 92.84
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 92.76
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 92.62
1u94_A356 RECA protein, recombinase A; homologous recombinat 92.47
1xp8_A366 RECA protein, recombinase A; recombination, radior 92.39
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 92.14
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 91.97
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 91.94
2xxa_A433 Signal recognition particle protein; protein trans 91.65
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 91.64
3io5_A333 Recombination and repair protein; storage dimer, i 91.55
2j37_W504 Signal recognition particle 54 kDa protein (SRP54) 91.19
2z43_A324 DNA repair and recombination protein RADA; archaea 91.07
2qgz_A308 Helicase loader, putative primosome component; str 90.97
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 90.66
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 90.32
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 90.2
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 90.2
2r6a_A454 DNAB helicase, replicative helicase; replication, 90.11
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 89.93
1vma_A306 Cell division protein FTSY; TM0570, structural gen 89.82
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 89.78
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 89.76
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 89.58
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 89.57
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 88.85
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 88.79
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 88.77
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 88.63
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 88.49
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 88.34
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 88.34
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 88.28
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 88.27
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 87.93
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 87.64
1yks_A440 Genome polyprotein [contains: flavivirin protease 87.61
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 87.45
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 87.37
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 87.32
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 87.03
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 86.91
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 86.87
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 86.37
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 86.17
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 86.08
4gl2_A699 Interferon-induced helicase C domain-containing P; 85.97
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 85.8
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 85.5
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 85.45
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 84.72
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 84.3
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 84.17
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 84.1
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 83.7
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 83.7
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 83.48
1p9r_A418 General secretion pathway protein E; bacterial typ 83.36
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 82.98
4a74_A231 DNA repair and recombination protein RADA; hydrola 82.74
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 82.02
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 81.68
2cvh_A220 DNA repair and recombination protein RADB; filamen 81.63
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 81.62
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 81.49
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 81.43
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 81.37
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 81.29
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 80.96
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 80.95
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 80.72
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 80.59
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 80.48
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 80.48
2eyu_A261 Twitching motility protein PILT; pilus retraction 80.33
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 80.31
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 80.26
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 80.22
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 80.17
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 80.03
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
Probab=100.00  E-value=1.9e-87  Score=810.22  Aligned_cols=611  Identities=35%  Similarity=0.619  Sum_probs=547.2

Q ss_pred             ceeeeecCCCCCCchHHHhcCCCCcHHHHHHHHHHHhHHHHHHHHHHHHHHHHcCCCCCCCCCh-hHHHHHhcCCCCCCH
Q 006476           14 IMFCYDFRPNETKRPRTLSKLSDTTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPPYPKNP-AIAEFAAQFPYEPTP   92 (643)
Q Consensus        14 ~~~~~~~~~~~~~~~~~l~~l~~~~~w~~~~~~~~~~~~~~~~~l~~~~~~r~~~~~~~~~~~~-~~~~~~~~~~~~~tp   92 (643)
                      .++++|.|++.  ..+.++++++ +.|++.+.++++.+.++|.+++++|+.|...+++++++++ +++.|.+.|+|++||
T Consensus       530 ~~~~~y~g~~~--~~~~l~~l~~-~~w~~~k~~~~~~~~~~a~~l~~~~a~r~~~~g~~~~~~~~~~~~~~~~f~~~~t~  606 (1151)
T 2eyq_A          530 HLISRYAGGAE--ENAPLHKLGG-DAWSRARQKAAEKVRDVAAELLDIYAQRAAKEGFAFKHDREQYQLFCDSFPFETTP  606 (1151)
T ss_dssp             GGEEECCCSCS--SSCCCCCTTC-SHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCCCCCCCHHHHHHHHHTCCSCCCH
T ss_pred             hhHhcccCCCC--CCCchhhcCc-hhHHHHHHHHHHHHHHHHHHHHHHHHHHhhCCCCCCCCCHHHHHHHHHhCCCCCCH
Confidence            46899988754  2588999984 8999999999999999999999999999999999998887 899999999999999


Q ss_pred             HHHHHHHHhHHhhccCCCCCcEEEEccCCCchHHHHHHHHHHHHHCCCeEEEEeccHHHHHHHHHHHHHHhcCCCCceEE
Q 006476           93 DQKKAFLDVERDLTERETPMDRLICGDVGFGKTEVALRAIFCVVSAGKQAMVLAPTIVLAKQHFDVVSERFSKYPDIKVG  172 (643)
Q Consensus        93 ~Q~~ai~~i~~~~~~~~~~~d~li~a~TGsGKT~~~l~~i~~~~~~g~~vlil~Pt~~La~Q~~~~~~~~~~~~~~i~v~  172 (643)
                      +|.+|++.++++|. +.+++|++++||||+|||++|+.+++..+..+++++|++||++||.||+++|.+++..+ ++++.
T Consensus       607 ~Q~~ai~~il~~~~-~g~p~d~ll~~~TGsGKT~val~aa~~~~~~g~~vlvlvPt~~La~Q~~~~~~~~~~~~-~i~v~  684 (1151)
T 2eyq_A          607 DQAQAINAVLSDMC-QPLAMDRLVCGDVGFGKTEVAMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANW-PVRIE  684 (1151)
T ss_dssp             HHHHHHHHHHHHHH-SSSCCEEEEECCCCTTTHHHHHHHHHHHHTTTCEEEEECSSHHHHHHHHHHHHHHSTTT-TCCEE
T ss_pred             HHHHHHHHHHHHHh-cCCcCcEEEECCCCCCHHHHHHHHHHHHHHhCCeEEEEechHHHHHHHHHHHHHHhhcC-CCeEE
Confidence            99999999999884 45678999999999999999999999999999999999999999999999999988877 58999


Q ss_pred             EEeCCCChHHHHHHHHHHhcCCceEEEechHhhhcccccCccceEEeecccccchhHHHHHHhcCCCceEEEeccCCChH
Q 006476          173 LLSRFQSKAEKEEHLDMIKHGHLNIIVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPR  252 (643)
Q Consensus       173 ~l~g~~~~~~~~~~~~~l~~g~~dIiI~T~~~L~~~~~~~~l~llViDEah~~g~~~~~~l~~~~~~~~vl~lSATp~~~  252 (643)
                      .++++.+..++...+..+..|.++|+||||+++.+.+.++++++|||||||+|+..+.+.++.++.+.++++|||||+|+
T Consensus       685 ~l~~~~~~~~~~~~~~~l~~g~~dIvV~T~~ll~~~~~~~~l~lvIiDEaH~~g~~~~~~l~~l~~~~~vl~lSATp~p~  764 (1151)
T 2eyq_A          685 MISRFRSAKEQTQILAEVAEGKIDILIGTHKLLQSDVKFKDLGLLIVDEEHRFGVRHKERIKAMRANVDILTLTATPIPR  764 (1151)
T ss_dssp             EESTTSCHHHHHHHHHHHHTTCCSEEEECTHHHHSCCCCSSEEEEEEESGGGSCHHHHHHHHHHHTTSEEEEEESSCCCH
T ss_pred             EEeCCCCHHHHHHHHHHHhcCCCCEEEECHHHHhCCccccccceEEEechHhcChHHHHHHHHhcCCCCEEEEcCCCChh
Confidence            99999999999999999999999999999999998899999999999999999999999999998999999999999999


Q ss_pred             hHHHHHhcCCCcceeeCCCCCccceeEEEccCCHHHHHHHHHHHHhcCCeEEEEecCccChHHHHHHHHhhCCCCcEEEE
Q 006476          253 TLYLALTGFRDASLISTPPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPMDFLQQAFPGVDIAIA  332 (643)
Q Consensus       253 ~~~~~~~~~~~~~~i~~~~~~~~~v~~~~~~~~~~~~~~~i~~~l~~~~qvlvf~~~~~~~e~l~~~L~~~~p~~~v~~~  332 (643)
                      ++.+...++.+.+.+..+|..+.++.+++...+...+...+.+.+.++++++||||++++++.+++.|+..+|+.++..+
T Consensus       765 ~l~~~~~~~~~~~~i~~~~~~r~~i~~~~~~~~~~~i~~~il~~l~~g~qvlvf~~~v~~~~~l~~~L~~~~p~~~v~~l  844 (1151)
T 2eyq_A          765 TLNMAMSGMRDLSIIATPPARRLAVKTFVREYDSMVVREAILREILRGGQVYYLYNDVENIQKAAERLAELVPEARIAIG  844 (1151)
T ss_dssp             HHHHHHTTTSEEEECCCCCCBCBCEEEEEEECCHHHHHHHHHHHHTTTCEEEEECCCSSCHHHHHHHHHHHCTTSCEEEC
T ss_pred             hHHHHHhcCCCceEEecCCCCccccEEEEecCCHHHHHHHHHHHHhcCCeEEEEECCHHHHHHHHHHHHHhCCCCeEEEE
Confidence            99999999999999999999999999999888888889999999999999999999999999999999999999999999


Q ss_pred             eCCCCHHHHHHHHHHHhcCCceEEEecccccccccccCCCEEEEecCCCCCHHHHHHHHhccCCCCCceEEEEEecCCCC
Q 006476          333 HGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLYQLRGRVGRADKEAHAYLFYPDKSL  412 (643)
Q Consensus       333 hg~~~~~~r~~v~~~F~~g~~~ILVaT~i~~~GiDip~v~~VI~~d~p~~s~~~~~Qr~GR~GR~g~~g~a~~l~~~~~~  412 (643)
                      ||+|++.+|++++++|++|+++|||||+++++|+|+|++++||+++++.|++++|+||+||+||.|+.|+||+++++++.
T Consensus       845 hg~~~~~eR~~il~~F~~g~~~VLVaT~v~e~GiDip~v~~VIi~~~~~~~l~~l~Qr~GRvgR~g~~g~~~ll~~~~~~  924 (1151)
T 2eyq_A          845 HGQMRERELERVMNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERADHFGLAQLHQLRGRVGRSHHQAYAWLLTPHPKA  924 (1151)
T ss_dssp             CSSCCHHHHHHHHHHHHTTSCCEEEESSTTGGGSCCTTEEEEEETTTTSSCHHHHHHHHTTCCBTTBCEEEEEEECCGGG
T ss_pred             eCCCCHHHHHHHHHHHHcCCCcEEEECCcceeeecccCCcEEEEeCCCCCCHHHHHHHHhccCcCCCceEEEEEECCccc
Confidence            99999999999999999999999999999999999999999999999888999999999999999999999999999888


Q ss_pred             CcHHHHHHHHHHHHHhhcccchhhhhhhcccccCCCccCccccCCccchhhhhHHHHHHHHHhhhcCccccc-cC--Ccc
Q 006476          413 LSDQALERLAALEECRELGQGFQLAEKDMGIRGFGTIFGEQQTGDVGNVGVDLFFEMLFESLSKVDEHCVIS-VP--YKS  489 (643)
Q Consensus       413 ~~~~~~~rl~~i~~~~~l~~g~~i~~~dl~irg~g~~lg~~q~g~~~~~~~~~~~~~l~~a~~~~~~~~~~~-~~--~~~  489 (643)
                      .+..+.+|+..++...++|+||.+++.|++|||+|+++|.+|+|++..+||++|.+++++++..+++++... ..  ...
T Consensus       925 l~~~~~~rl~~i~~~~~lg~gf~ia~~dl~irg~g~~lg~~q~g~i~~~~~~~~~~~l~~a~~~~~~~~~~~~~~~~~~~ 1004 (1151)
T 2eyq_A          925 MTTDAQKRLEAIASLEDLGAGFALATHDLEIRGAGELLGEEQSGSMETIGFSLYMELLENAVDALKAGREPSLEDLTSQQ 1004 (1151)
T ss_dssp             SCHHHHHHHHHHTTCCSBSHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHCHHHHHHHHHHHHHHHHHTCCSCCGGGSCCC
T ss_pred             cCHHHHHHHHHHHHhhccCCcchHHHHHhccCCCcccCCccccCChhhccHHHHHHHHHHHHHHHHcCCCCCcccccccC
Confidence            899999999999999999999999999999999999999999999999999999999999999887432211 11  125


Q ss_pred             eeEeeccCCCCCccccCCCCCchHHHHHHHHhcccCHHHHHHHHHHHHhhcCCCcHHHHHHHHHHHHHHHhhhcCcceEe
Q 006476          490 VQIDININPRLPSEYINHLENPMEMVNEAEKAAEQDIWCLMQFTESLRRQYGKEPYSMEILLKKLYVRRMAADIGITKIY  569 (643)
Q Consensus       490 ~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~p~~~~~~~~~~~~~~~~~~~~~~~~~  569 (643)
                      +.+++++++++|+.||++...|+++|+|++.+  .+.+++.++..||.||||++|.++++||.+++||.+|+++||.+|.
T Consensus      1005 ~~i~l~~~~~ip~~yi~~~~~rl~~y~~l~~~--~~~~~~~~~~~el~drfg~~p~~~~~l~~~~~~k~~~~~~~i~~i~ 1082 (1151)
T 2eyq_A         1005 TEVELRMPSLLPDDFIPDVNTRLSFYKRIASA--KTENELEEIKVELIDRFGLLPDPARTLLDIARLRQQAQKLGIRKLE 1082 (1151)
T ss_dssp             CCEECSSCCSCCTTTSCCHHHHHHHHHHHHHC--CSHHHHHHHHHHHHHHHCSCCHHHHHHHHHHHHHHHHHHHCCSCEE
T ss_pred             eeEecCCcCcCChhhcCCHHHHHHHHHHHHcC--CCHHHHHHHHHHHHHHcCCCcHHHHHHHHHHHHHHHHHHCCCcEEE
Confidence            68999999999999999999999999999987  6778999999999999999999999999999999999999999999


Q ss_pred             ecCCEEEEEeccCHHH-HHHHHHhhcccccccceeeeC-CeEEEEEEecCChHHHHHHHHHHHHHHH
Q 006476          570 ASGKMVGMKTNMNKKV-FKMMIDSMTSEVHRNSLTFEG-DQIKAELLLELPREQLLNWIFQCLAELY  634 (643)
Q Consensus       570 ~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~  634 (643)
                      ..++.+.+.+.....+ ...+...+...  +..+++.+ ..+.+.+.. ....+.++++..+++.+.
T Consensus      1083 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~ 1146 (1151)
T 2eyq_A         1083 GNEKGGVIEFAEKNHVNPAWLIGLLQKQ--PQHYRLDGPTRLKFIQDL-SERKTRIEWVRQFMRELE 1146 (1151)
T ss_dssp             ECSSEEEEECCSSCCCCHHHHHHHHHHC--GGGEEEETTTEEEEECCC-CSHHHHHHHHHHHHHHHH
T ss_pred             ecCCeEEEEEecCCCCCHHHHHHHHHhc--CCcEEECCCceEEEEecC-CCHHHHHHHHHHHHHHHH
Confidence            9999988877432111 22233333322  23455543 333332211 124445888888888775
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2qsr_A Transcription-repair coupling factor; structural genomics, PSI-2, protein ST initiative; 3.10A {Streptococcus pneumoniae} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 643
d2eyqa5211 c.37.1.19 (A:779-989) Transcription-repair couplin 2e-57
d2eyqa3233 c.37.1.19 (A:546-778) Transcription-repair couplin 3e-56
d1gm5a4206 c.37.1.19 (A:550-755) RecG helicase domain {Thermo 8e-41
d1gm5a3264 c.37.1.19 (A:286-549) RecG helicase domain {Thermo 3e-39
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 1e-26
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 8e-20
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 3e-13
d2eyqa6158 d.315.1.1 (A:990-1147) Transcription-repair coupli 3e-12
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 6e-12
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 5e-10
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 7e-10
d1yksa1140 c.37.1.14 (A:185-324) YFV helicase domain {Yellow 4e-07
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 1e-06
d2fz4a1206 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Arc 6e-06
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 7e-06
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 9e-05
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 1e-04
d2fwra1200 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar 1e-04
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 1e-04
d2j0sa2168 c.37.1.19 (A:244-411) Probable ATP-dependent RNA h 2e-04
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Length = 211 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Transcription-repair coupling factor, TRCF
species: Escherichia coli [TaxId: 562]

 Score =  191 bits (485), Expect = 2e-57
 Identities = 83/208 (39%), Positives = 125/208 (60%)

Query: 270 PPPERLPIKTHLSAFSKEKVISAIKYELDRGGQVFYVLPRIKGLEEPMDFLQQAFPGVDI 329
           PP  RL +KT +  +    V  AI  E+ RGGQV+Y+   ++ +++  + L +  P   I
Sbjct: 1   PPARRLAVKTFVREYDSMVVREAILREILRGGQVYYLYNDVENIQKAAERLAELVPEARI 60

Query: 330 AIAHGQQYSRQLEETMEKFAQGAIKILICTNIVESGLDIQNANTIIVQDVQQFGLAQLYQ 389
           AI HGQ   R+LE  M  F      +L+CT I+E+G+DI  ANTII++    FGLAQL+Q
Sbjct: 61  AIGHGQMRERELERVMNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERADHFGLAQLHQ 120

Query: 390 LRGRVGRADKEAHAYLFYPDKSLLSDQALERLAALEECRELGQGFQLAEKDMGIRGFGTI 449
           LRGRVGR+  +A+A+L  P    ++  A +RL A+    +LG GF LA  D+ IRG G +
Sbjct: 121 LRGRVGRSHHQAYAWLLTPHPKAMTTDAQKRLEAIASLEDLGAGFALATHDLEIRGAGEL 180

Query: 450 FGEQQTGDVGNVGVDLFFEMLFESLSKV 477
            GE+Q+G +  +G  L+ E+L  ++  +
Sbjct: 181 LGEEQSGSMETIGFSLYMELLENAVDAL 208
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Length = 233 Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 206 Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Length = 264 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2eyqa6 d.315.1.1 (A:990-1147) Transcription-repair coupling factor, TRCF, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 158 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 206 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query643
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 100.0
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 100.0
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 100.0
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 100.0
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 100.0
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.95
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.95
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.94
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.94
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.93
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.93
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.92
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.91
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.9
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.89
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.89
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.89
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.89
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.89
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.89
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.88
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.88
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.87
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.87
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.87
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.87
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.86
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.79
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.75
d2eyqa6158 Transcription-repair coupling factor, TRCF, C-term 99.75
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.74
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.73
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.72
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.68
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.68
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.66
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.62
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.57
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.53
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.42
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.31
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.18
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.18
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 99.15
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.78
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.72
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.64
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 98.19
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.93
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 97.63
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 97.61
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.58
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 97.45
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 97.39
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.32
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 97.21
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.17
d1okkd2207 GTPase domain of the signal recognition particle r 97.01
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.0
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 96.88
d1vmaa2213 GTPase domain of the signal recognition particle r 96.87
d2qy9a2211 GTPase domain of the signal recognition particle r 96.76
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 96.7
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 96.47
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.47
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 96.23
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 96.06
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.0
d1j8yf2211 GTPase domain of the signal sequence recognition p 96.0
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 95.88
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 95.85
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 95.81
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 95.75
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 95.75
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.71
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 95.63
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 95.59
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.56
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.54
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.32
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 94.93
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 94.92
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.9
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 94.7
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.47
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 94.17
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 93.69
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 92.56
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 91.82
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 91.74
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.5
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 91.21
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 91.14
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 91.05
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 91.04
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 91.04
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 90.9
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 90.73
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 90.61
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 90.52
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 90.51
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 90.04
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 89.41
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 89.34
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 89.33
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 89.06
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 89.04
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 89.03
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 88.94
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 88.37
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 88.15
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 88.1
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 87.88
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 86.86
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 86.44
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 86.35
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 85.53
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 85.52
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 85.51
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 85.29
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 85.09
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 85.08
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 85.07
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 84.92
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 84.82
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 84.28
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 84.17
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 83.74
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 83.67
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 83.58
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 83.28
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 83.25
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 82.88
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 82.81
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 81.69
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 81.35
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 81.21
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 80.81
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 80.4
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 80.3
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 80.09
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Transcription-repair coupling factor, TRCF
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1e-44  Score=357.78  Aligned_cols=231  Identities=44%  Similarity=0.800  Sum_probs=221.3

Q ss_pred             CcHHHHHHHHHHHhHHHHHHHHHHHHHHHHcCCCCCCCCCh-hHHHHHhcCCCCCCHHHHHHHHHhHHhhccCCCCCcEE
Q 006476           37 TTAWERRKTKGKVAIQKMVVDLMELYLHRLKQKRPPYPKNP-AIAEFAAQFPYEPTPDQKKAFLDVERDLTERETPMDRL  115 (643)
Q Consensus        37 ~~~w~~~~~~~~~~~~~~~~~l~~~~~~r~~~~~~~~~~~~-~~~~~~~~~~~~~tp~Q~~ai~~i~~~~~~~~~~~d~l  115 (643)
                      +++|+++|.++++++.++|.+|+++|++|...+++.++.+. +++.+.+.+||.+|+.|.+|+.++.+++. ++.+|++|
T Consensus         2 ~~~W~k~K~Kakk~i~~lA~eLL~i~akR~~~kg~~~~~~~~~~~~~~~~lP~~lt~~Q~~~~~~i~~~~~-~~~~~~~L   80 (233)
T d2eyqa3           2 GDAWSRARQKAAEKVRDVAAELLDIYAQRAAKEGFAFKHDREQYQLFCDSFPFETTPDQAQAINAVLSDMC-QPLAMDRL   80 (233)
T ss_dssp             CSHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSCCCCCCCCHHHHHHHHHTCCSCCCHHHHHHHHHHHHHHH-SSSCCEEE
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCCCCCCCHHHHHhhhhccccccchhHHHHHHHHHHHHh-ccCccCeE
Confidence            58999999999999999999999999999999999998877 89999999999999999999999999994 67899999


Q ss_pred             EEccCCCchHHHHHHHHHHHHHCCCeEEEEeccHHHHHHHHHHHHHHhcCCCCceEEEEeCCCChHHHHHHHHHHhcCCc
Q 006476          116 ICGDVGFGKTEVALRAIFCVVSAGKQAMVLAPTIVLAKQHFDVVSERFSKYPDIKVGLLSRFQSKAEKEEHLDMIKHGHL  195 (643)
Q Consensus       116 i~a~TGsGKT~~~l~~i~~~~~~g~~vlil~Pt~~La~Q~~~~~~~~~~~~~~i~v~~l~g~~~~~~~~~~~~~l~~g~~  195 (643)
                      ++|+||||||++|+.+++..+.+|+|+++++||..|+.||+++|+++|+.+ ++++..++|+.+..++...|..+.+|++
T Consensus        81 L~GdvGsGKT~V~~~a~~~~~~~g~qv~~l~Pt~~La~Q~~~~~~~~~~~~-~~~v~~l~~~~~~~~~~~~~~~~~~g~~  159 (233)
T d2eyqa3          81 VCGDVGFGKTEVAMRAAFLAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANW-PVRIEMISRFRSAKEQTQILAEVAEGKI  159 (233)
T ss_dssp             EECCCCTTTHHHHHHHHHHHHTTTCEEEEECSSHHHHHHHHHHHHHHSTTT-TCCEEEESTTSCHHHHHHHHHHHHTTCC
T ss_pred             EEcCCCCCcHHHHHHHHHHHHHcCCceEEEccHHHhHHHHHHHHHHHHhhC-CCEEEeccCcccchhHHHHHHHHhCCCC
Confidence            999999999999999999999999999999999999999999999999988 5999999999999999999999999999


Q ss_pred             eEEEechHhhhcccccCccceEEeecccccchhHHHHHHhcCCCceEEEeccCCChHhHHHHHhcCCCcceeeC
Q 006476          196 NIIVGTHSLLGSRVVYNNLGLLVVDEEQRFGVKQKEKIASFKISVDVLTLSATPIPRTLYLALTGFRDASLIST  269 (643)
Q Consensus       196 dIiI~T~~~L~~~~~~~~l~llViDEah~~g~~~~~~l~~~~~~~~vl~lSATp~~~~~~~~~~~~~~~~~i~~  269 (643)
                      +|+||||..+.+.+.|+++++|||||.|+||+++++.++....++++|++||||+|+++.++..|..+.+.+.+
T Consensus       160 ~iviGths~l~~~~~f~~LgLiIiDEeH~fg~kQ~~~l~~~~~~~~~l~~SATPiprtl~~~~~g~~~~s~i~t  233 (233)
T d2eyqa3         160 DILIGTHKLLQSDVKFKDLGLLIVDEEHRFGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRDLSIIAT  233 (233)
T ss_dssp             SEEEECTHHHHSCCCCSSEEEEEEESGGGSCHHHHHHHHHHHTTSEEEEEESSCCCHHHHHHHTTTSEEEECCC
T ss_pred             CEEEeehhhhccCCccccccceeeechhhhhhHHHHHHHhhCCCCCEEEEecchhHHHHHHHHHhccceeeecC
Confidence            99999999999999999999999999999999999999988899999999999999999999999998887753
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2eyqa6 d.315.1.1 (A:990-1147) Transcription-repair coupling factor, TRCF, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure