Citrus Sinensis ID: 006939

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-----
MSGYFHFSGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLSVSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSISSGTVSTVSMPPFNAFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDVS
ccccEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEEccEEEEEEEccccEEEEEEEccccEEEEcccccccccEEEcccccccccEEEEccccccEEccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcc
cccEEEEEcccccEEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEEEcccccEEEEEEcccEEEEEEccccEEEEEEEEcccEEccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEcccccccccHHHccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccc
msgyfhfsgsadrtvkfwdLETFEligsagpetsgvrcltfnpdgrtLLCGLHEslkvfswepirchdavdvgwsrlsdlnvhegkllgcsynqscvgVWVVdisriepytigsvtrvnglseskssasgnlsvlnensakaslgklsvsqnsdplvketkslgrlsvsqnsdpllketktlgrlsvsqnsepakeskvlsstgsvpgtpqrvnlnmgsktSVVNSTAVVSKRtstrantasnvpilnksdivpvivprtntRFEQAVESRKDidvigrtmpfslqskatdsrkfqnsgdevdqpaVSVLCEntgskatevssvadrntfAAIKGSIQgvsvternskediftvsgksgtmsmsespasyederydslghksnrdgyamesqkrgRMHSLVINwekrgsspnydgptssissgtvstvsmppfnafkqrgysssaeketasvsdedatADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISastsvgvdieAEQRIERCNRCFIElekvkcclptlmrrggsvaKSAQELNLALQDVS
msgyfhfsgsadrtvkFWDLETFELigsagpetsgvRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASlgklsvsqnsdpLVKEtkslgrlsvsqnsdpllketktlgrlsvsqnsepakeskvlsstgsvpgtpqrvnlnmgsktsvVNSTavvskrtstrantasnvpilnksdivpvivprtntrfeqavesrkdidvigrtmpfslqskatdsrkfqnsgdevdqpaVSVLCENTGskatevssvadrntfaaikgsiqgvsvternskediftvsgksgtmsmsespasYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSISSGTVSTVSMPPFNAFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAisastsvgvdiEAEQRIERCNRCFIELEKVKCCLPTLMRrggsvaksaQELNLALQDVS
MSGYFHFSGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLSVSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPtssissgtvstvsMPPFNAFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCllplltgllESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDVS
***YFHFSGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRV*****************************************************************************************************************************VPILNKSDIVPVIVPRTNTRFEQAV*****IDVIG***************************************************FAAI**********************************************************************************************************************************************LAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRR*******************
MSGYFHFSGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVN***************LNENSAKASLG******************************************************************************VNS****************************************************************************************************************************************************************************************************************************************ADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKC*****************ELNLALQDV*
MSGYFHFSGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNG**********NLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLS********************PGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQ***************VDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVS*****************ERYDSLGHKSNRDG*********RMHSLVINWEKRGSSPNYDGPTSSISSGTVSTVSMPPFNAFKQ******************ATADVMEQ**********RLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDVS
*SGYFHFSGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIG**************************************************************************************************************************************************************************************************************************************************************************************************************************************************VSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDVS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGYFHFSGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLSVSQNSEPAKESKVLSSTGSVPGTPQRVNLNMGSKTSVVNSTAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSISSGTVSTVSMPPFNAFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDVS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query625 2.2.26 [Sep-21-2011]
Q8H0T9837 Katanin p80 WD40 repeat-c yes no 0.985 0.735 0.581 0.0
O61585690 Katanin p80 WD40 repeat-c yes no 0.208 0.188 0.428 6e-26
Q5ZIU8657 Katanin p80 WD40 repeat-c yes no 0.169 0.161 0.481 4e-25
Q7ZUV2694 Katanin p80 WD40 repeat-c yes no 0.188 0.170 0.467 8e-25
Q4V7Y7655 Katanin p80 WD40 repeat-c N/A no 0.430 0.410 0.292 2e-24
Q6NVM2655 Katanin p80 WD40 repeat-c yes no 0.396 0.378 0.296 9e-24
Q9BVA0655 Katanin p80 WD40 repeat-c yes no 0.179 0.170 0.429 3e-22
Q8BG40658 Katanin p80 WD40 repeat-c yes no 0.161 0.153 0.445 5e-21
B8M7Q5667 Probable E3 ubiquitin lig N/A no 0.136 0.127 0.302 0.0001
B6Q4Z5660 Probable E3 ubiquitin lig N/A no 0.121 0.115 0.337 0.0002
>sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 Back     alignment and function desciption
 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/645 (58%), Positives = 461/645 (71%), Gaps = 29/645 (4%)

Query: 4   YFHFSGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEP 63
           +   +GSADRTVKFWDLETFELIGS GPET+GVRCL+FNPDG+T+LCGL ESLK+FSWEP
Sbjct: 198 FLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNPDGKTVLCGLQESLKIFSWEP 257

Query: 64  IRCHDAVDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSE 123
           IRCHD VDVGWSRLSD+NVHEGKLLGCSYNQSCVGVWVVD+SR EP   G   + NG  E
Sbjct: 258 IRCHDGVDVGWSRLSDMNVHEGKLLGCSYNQSCVGVWVVDLSRTEPCMAGDTAQSNGHPE 317

Query: 124 SKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDP--------- 174
            +S +  +  VLN+N++K  LGKLSVSQN DPL+KETKSLGRLSVSQNSDP         
Sbjct: 318 KRSCSGRDPVVLNDNNSKTVLGKLSVSQNVDPLLKETKSLGRLSVSQNSDPSTKETKSIG 377

Query: 175 ----------LLKETKTLGRLSVSQNSEPAKESKVLSSTGSVPGTPQRVN-LNMGSKTSV 223
                      +KE+K LGRLSVSQNS+ +KES+  SSTGS+PGTP RV+  N+   TS 
Sbjct: 378 RSSTSQNSESSMKESKPLGRLSVSQNSDVSKESRTFSSTGSLPGTPHRVSSTNVSKATSG 437

Query: 224 VN---STAVVSKRTSTRANTASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRT 280
           V+   S A  S+R  T+AN  +N P+   +D  PVIVPR + R EQA ESR ++D+I RT
Sbjct: 438 VSTAVSNAATSRRNFTKANPKAN-PVNKAADFAPVIVPRADPRIEQATESRAELDIIART 496

Query: 281 MPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGV 340
           MP+SLQ  A DSR+  +S +  D P  SVL E + S+  E +++ D  T    K  ++G 
Sbjct: 497 MPYSLQ--AADSRRSPSSRNNPDLPDASVL-EMSESQPVEPNNIPDGGTLPGGKVGMRGA 553

Query: 341 SVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSL 400
             TER+  +  +   G+S + S   SP    DE YD + H+SNRD    ESQK GR  SL
Sbjct: 554 --TERSINDFRYKRYGRSNSRSRMGSPPRNHDENYDLVSHRSNRDPSPTESQKGGRFQSL 611

Query: 401 VINWEKRGSSPNYDGPTSSISSGTVSTVSMPPFNAFKQRGYSSSAEKETASVSDEDATAD 460
           VIN E+RG   N++GP S+ SSG +   ++ P N FKQRG     E+   S S+E+   D
Sbjct: 612 VINRERRGRFSNFEGPVSNFSSGNMPAPNIRPSNMFKQRGNHMPVEQGIDSPSEENIVED 671

Query: 461 VMEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEI 520
           +M +H+QFVSSMQSRLAKLQ V RYWERNDVK +I +++KMAD+ V ADV+ I+ E+ EI
Sbjct: 672 IMGKHNQFVSSMQSRLAKLQVVRRYWERNDVKNSIGSIEKMADNAVTADVLGIITERNEI 731

Query: 521 VTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAE 580
           +TLD C+ LLPLLT LL S MD+HLS+SLD+LLKLVR +GS IYS++SA  SVGVDIEAE
Sbjct: 732 LTLDNCTSLLPLLTALLGSGMDQHLSVSLDLLLKLVRLYGSPIYSSLSAPASVGVDIEAE 791

Query: 581 QRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQDVS 625
           QRIER +RCF+ELEKVK CLP+L RRGG VAKS  ELNLA Q+VS
Sbjct: 792 QRIERYSRCFVELEKVKACLPSLARRGGLVAKSVLELNLAFQEVS 836
May participate in a complex which severs microtubules in an ATP-dependent manner. This activity may promote rapid reorganization of cellular microtubule arrays.
Arabidopsis thaliana (taxid: 3702)
>sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 Back     alignment and function description
>sp|Q5ZIU8|KTNB1_CHICK Katanin p80 WD40 repeat-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2 Back     alignment and function description
>sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 Back     alignment and function description
>sp|Q4V7Y7|KTNB1_XENLA Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1 Back     alignment and function description
>sp|Q6NVM2|KTNB1_XENTR Katanin p80 WD40 repeat-containing subunit B1 OS=Xenopus tropicalis GN=katnb1 PE=2 SV=1 Back     alignment and function description
>sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 Back     alignment and function description
>sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 Back     alignment and function description
>sp|B8M7Q5|SCONB_TALSN Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=sconB PE=3 SV=1 Back     alignment and function description
>sp|B6Q4Z5|SCONB_PENMQ Probable E3 ubiquitin ligase complex SCF subunit sconB OS=Penicillium marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=sconB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query625
255545317 803 katanin P80 subunit, putative [Ricinus c 0.952 0.740 0.684 0.0
224100461 802 predicted protein [Populus trichocarpa] 0.955 0.744 0.675 0.0
359484098 800 PREDICTED: katanin p80 WD40 repeat-conta 0.961 0.751 0.665 0.0
449458795 795 PREDICTED: katanin p80 WD40 repeat-conta 0.937 0.737 0.623 0.0
356573375 758 PREDICTED: katanin p80 WD40 repeat-conta 0.888 0.732 0.593 0.0
30688988 837 Katanin p80 WD40 repeat-containing subun 0.985 0.735 0.581 0.0
297812493 837 transducin family protein [Arabidopsis l 0.985 0.735 0.584 0.0
145357786 839 katanin p80 subunit-like protein [Arabid 0.988 0.736 0.556 0.0
30688991 836 Katanin p80 WD40 repeat-containing subun 0.984 0.735 0.579 0.0
110742137 839 katanin p80 subunit - like protein [Arab 0.988 0.736 0.555 0.0
>gi|255545317|ref|XP_002513719.1| katanin P80 subunit, putative [Ricinus communis] gi|223547170|gb|EEF48666.1| katanin P80 subunit, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/621 (68%), Positives = 494/621 (79%), Gaps = 26/621 (4%)

Query: 10  SADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHESLKVFSWEPIRCHDA 69
           SADRTVKFWDLETFELIGSAGPET+GVRCLTFNPDGRTLLCGLHE+LKVFSWEP+RCHDA
Sbjct: 200 SADRTVKFWDLETFELIGSAGPETTGVRCLTFNPDGRTLLCGLHENLKVFSWEPLRCHDA 259

Query: 70  VDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSAS 129
           VDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPY+  +V R+NG SESKS  S
Sbjct: 260 VDVGWSRLSDLNVHEGKLLGCSYNQSCVGVWVVDISRIEPYSPSNVNRLNGYSESKSGIS 319

Query: 130 GNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGRLSVSQ 189
            N SVL +++AK SLG                   RLS +QNS+ L+KETK+ GRLSVSQ
Sbjct: 320 ANQSVLLDSTAKTSLG-------------------RLSAAQNSEILVKETKSFGRLSVSQ 360

Query: 190 NSEPAKES----KVLSSTGSVPGTPQRVNLNMGSKTSV---VNSTAVVSKRTSTRANTAS 242
           N++P KES    K+L+STG+VPGTPQRVN N   KT++   +       KRTST+  +A 
Sbjct: 361 NTDPVKESTKESKILASTGNVPGTPQRVNFNTALKTTLSGPITVNVAAPKRTSTKVQSAV 420

Query: 243 NVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEV 302
           NVP+LNK+D++PVIVPRTNTR +   E RK+I + GRTMPFSLQSKA D RKF NS D++
Sbjct: 421 NVPVLNKADVIPVIVPRTNTRPDPVAEPRKEIGIAGRTMPFSLQSKACDYRKFTNSRDDM 480

Query: 303 DQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVSGKSGTMS 362
           DQP +S+  + T SK+  +S+V DRN F+ +KGSI+ +S  +RN KED    SGK  +  
Sbjct: 481 DQPTISIPSDTTSSKSMALSNVGDRNIFSTVKGSIREISTADRNIKEDRPVGSGKQDSSL 540

Query: 363 MSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPTSSISS 422
           ++E P SY++E Y++ GHK NRD  ++E QK GRM SLVINWEKRG SPNY+GP S  S 
Sbjct: 541 IAEPPVSYQEENYETRGHKLNRDATSLEGQKAGRMRSLVINWEKRGRSPNYEGPISGSSP 600

Query: 423 GTVSTVSMPPFNAFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAV 482
            T S+V+M  FN  KQRG S + EKE  S SDEDA ADVMEQH QFVSSMQSR  KLQAV
Sbjct: 601 ETASSVNMLSFNMLKQRGCSPTTEKEMVSASDEDAIADVMEQHDQFVSSMQSRFGKLQAV 660

Query: 483 YRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMD 542
           +R+WERNDVKGAISAM+KMADH VLADV+S++ EKI+IVTLD+C+CLLPLL GLLESDMD
Sbjct: 661 HRFWERNDVKGAISAMEKMADHGVLADVISVINEKIDIVTLDVCTCLLPLLAGLLESDMD 720

Query: 543 RHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPT 602
           RHLSISLD+LLKLVRTFGSMIYS +SAST VGVDIEAEQR+ERCN CF+ELEKVK CLPT
Sbjct: 721 RHLSISLDVLLKLVRTFGSMIYSTVSASTPVGVDIEAEQRLERCNLCFVELEKVKRCLPT 780

Query: 603 LMRRGGSVAKSAQELNLALQD 623
           LMRRGGSVAK  QELNLALQD
Sbjct: 781 LMRRGGSVAKITQELNLALQD 801

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224100461|ref|XP_002311885.1| predicted protein [Populus trichocarpa] gi|222851705|gb|EEE89252.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359484098|ref|XP_002268907.2| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449458795|ref|XP_004147132.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Cucumis sativus] gi|449524677|ref|XP_004169348.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|356573375|ref|XP_003554837.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog 1-like [Glycine max] Back     alignment and taxonomy information
>gi|30688988|ref|NP_851064.1| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis thaliana] gi|73620972|sp|Q8H0T9.3|KTNB1_ARATH RecName: Full=Katanin p80 WD40 repeat-containing subunit B1 homolog gi|25083345|gb|AAN72064.1| putative protein [Arabidopsis thaliana] gi|332005783|gb|AED93166.1| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297812493|ref|XP_002874130.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] gi|297319967|gb|EFH50389.1| transducin family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|145357786|ref|NP_568194.2| katanin p80 subunit-like protein [Arabidopsis thaliana] gi|332003911|gb|AED91294.1| katanin p80 subunit-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30688991|ref|NP_197734.2| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis thaliana] gi|332005784|gb|AED93167.1| Katanin p80 WD40 repeat-containing subunit B1-1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110742137|dbj|BAE98997.1| katanin p80 subunit - like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query625
TAIR|locus:2154438837 AT5G23430 "AT5G23430" [Arabido 0.788 0.589 0.520 2.1e-126
TAIR|locus:2150788839 AT5G08390 "AT5G08390" [Arabido 0.768 0.572 0.513 2.4e-125
TAIR|locus:2202129 1021 AT1G11160 "AT1G11160" [Arabido 0.348 0.213 0.411 2.1e-76
UNIPROTKB|Q5ZIU8657 KATNB1 "Katanin p80 WD40 repea 0.32 0.304 0.361 1e-37
MGI|MGI:1921437658 Katnb1 "katanin p80 (WD40-cont 0.456 0.433 0.299 2.2e-35
RGD|1311256655 Katnb1 "katanin p80 (WD repeat 0.312 0.297 0.336 2.8e-35
UNIPROTKB|E1BQV9660 KATNB1 "Katanin p80 WD40 repea 0.316 0.3 0.350 1e-34
UNIPROTKB|F1P0F4661 KATNB1 "Katanin p80 WD40 repea 0.316 0.299 0.350 1e-34
UNIPROTKB|E3W9A3661 KATNB1 "Katanin p80 WD40 repea 0.315 0.298 0.344 3e-34
UNIPROTKB|E2QTQ5655 KATNB1 "Uncharacterized protei 0.310 0.296 0.344 3.4e-34
TAIR|locus:2154438 AT5G23430 "AT5G23430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1190 (424.0 bits), Expect = 2.1e-126, Sum P(2) = 2.1e-126
 Identities = 263/505 (52%), Positives = 335/505 (66%)

Query:   125 KSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVSQNSDPLLKETKTLGR 184
             K S S N+  L + +   SLG+LSVSQNSDP  KETKS+GR S SQNS+  +KE+K LGR
Sbjct:   340 KLSVSQNVDPLLKETK--SLGRLSVSQNSDPSTKETKSIGRSSTSQNSESSMKESKPLGR 397

Query:   185 LSVSQNSEPAKESKVLSSTGSVPGTPQRVN-LNMGSKTSVVN---STAVVSKRTSTRANT 240
             LSVSQNS+ +KES+  SSTGS+PGTP RV+  N+   TS V+   S A  S+R  T+AN 
Sbjct:   398 LSVSQNSDVSKESRTFSSTGSLPGTPHRVSSTNVSKATSGVSTAVSNAATSRRNFTKANP 457

Query:   241 ASNVPILNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGD 300
              +N P+   +D  PVIVPR + R EQA ESR ++D+I RTMP+SLQ  A DSR+  +S +
Sbjct:   458 KAN-PVNKAADFAPVIVPRADPRIEQATESRAELDIIARTMPYSLQ--AADSRRSPSSRN 514

Query:   301 EVDQPAVSVLCENTGSKATEVSSVADRNTFAAIKGSIQGVSVTERNSKEDIFTVSGKSGT 360
               D P  SVL E + S+  E +++ D  T    K  ++G   TER+  +  +   G+S +
Sbjct:   515 NPDLPDASVL-EMSESQPVEPNNIPDGGTLPGGKVGMRGA--TERSINDFRYKRYGRSNS 571

Query:   361 MSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINWEKRGSSPNYDGPXXXX 420
              S   SP    DE YD + H+SNRD    ESQK GR  SLVIN E+RG   N++GP    
Sbjct:   572 RSRMGSPPRNHDENYDLVSHRSNRDPSPTESQKGGRFQSLVINRERRGRFSNFEGPVSNF 631

Query:   421 XXXXXXXXXMPPFNAFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQ 480
                      + P N FKQRG     E+   S S+E+   D+M +H+QFVSSMQSRLAKLQ
Sbjct:   632 SSGNMPAPNIRPSNMFKQRGNHMPVEQGIDSPSEENIVEDIMGKHNQFVSSMQSRLAKLQ 691

Query:   481 AVYRYWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCXXXXXXXXXESD 540
              V RYWERNDVK +I +++KMAD+ V ADV+ I+ E+ EI+TLD C+           S 
Sbjct:   692 VVRRYWERNDVKNSIGSIEKMADNAVTADVLGIITERNEILTLDNCTSLLPLLTALLGSG 751

Query:   541 MDRHLSISLDILLKLVRTFGSMIYSAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCL 600
             MD+HLS+SLD+LLKLVR +GS IYS++SA  SVGVDIEAEQRIER +RCF+ELEKVK CL
Sbjct:   752 MDQHLSVSLDLLLKLVRLYGSPIYSSLSAPASVGVDIEAEQRIERYSRCFVELEKVKACL 811

Query:   601 PTLMRRGGSVAKSAQELNLALQDVS 625
             P+L RRGG VAKS  ELNLA Q+VS
Sbjct:   812 PSLARRGGLVAKSVLELNLAFQEVS 836
GO:0000166 "nucleotide binding" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:2150788 AT5G08390 "AT5G08390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202129 AT1G11160 "AT1G11160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIU8 KATNB1 "Katanin p80 WD40 repeat-containing subunit B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1921437 Katnb1 "katanin p80 (WD40-containing) subunit B 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311256 Katnb1 "katanin p80 (WD repeat containing) subunit B 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQV9 KATNB1 "Katanin p80 WD40 repeat-containing subunit B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0F4 KATNB1 "Katanin p80 WD40 repeat-containing subunit B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E3W9A3 KATNB1 "Katanin p80 WD40 repeat-containing subunit B1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E2QTQ5 KATNB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8H0T9KTNB1_ARATHNo assigned EC number0.58130.98560.7359yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query625
pfam13925164 pfam13925, Katanin_con80, con80 domain of Katanin 2e-57
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-07
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-07
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-06
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-05
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 1e-05
>gnl|CDD|222456 pfam13925, Katanin_con80, con80 domain of Katanin Back     alignment and domain information 
 Score =  190 bits (485), Expect = 2e-57
 Identities = 70/164 (42%), Positives = 108/164 (65%), Gaps = 3/164 (1%)

Query: 462 MEQHSQFVSSMQSRLAKLQAVYRYWERNDVKGAISAMQKMADHTVLADVMSIV--VEKIE 519
            + H   +S + SRL KL+ V   W +ND+KGAI+A ++M D  VL DV+S++    K E
Sbjct: 1   SKDHDTMLSVLSSRLTKLKVVRTLWRQNDIKGAIAAARRMNDLAVLVDVLSVLTQSLKKE 60

Query: 520 IVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIYSAISA-STSVGVDIE 578
            +TLD+C  LLPL+  LL+S  +RH+ + L+ L  +++ FG +I SA+SA  +SVGVD+ 
Sbjct: 61  SITLDLCVDLLPLVEELLQSKYERHILVGLETLRSILKKFGPVIRSALSAAPSSVGVDLS 120

Query: 579 AEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQ 622
            E+R+++C +C  +L+K+K  +  L RR GSV + A+EL L L 
Sbjct: 121 REERLQKCQKCKQQLKKIKQIVKLLARRKGSVGELARELQLELP 164

The con80 domain of katanin is the C-terminal region of the protein that binds to the N-terminal domain of katanin-p60, the catalytic ATPase. The complex associates with a specific subregion of the mitotic spindle leading to increased microtubule disassembly and targeting of p60 to the spindle poles. The assembly and function of the mitotic spindle requires the activity of a number of microtubule-binding proteins. Katanin, a heterodimeric microtubule-severing ATPase, is found localized at mitotic spindle poles. A proposed model is that katanin is targeted to spindle poles through a combination of direct microtubule binding by the p60 subunit and through interactions between the WD40 domain and an unknown protein. Length = 164
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 625
KOG0267825 consensus Microtubule severing protein katanin p80 100.0
PF13925164 Katanin_con80: con80 domain of Katanin 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.65
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.58
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.56
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.56
KOG0263707 consensus Transcription initiation factor TFIID, s 99.52
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.52
KOG0263707 consensus Transcription initiation factor TFIID, s 99.5
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.49
KOG0266456 consensus WD40 repeat-containing protein [General 99.49
KOG0267 825 consensus Microtubule severing protein katanin p80 99.45
PTZ00421493 coronin; Provisional 99.43
KOG0286343 consensus G-protein beta subunit [General function 99.42
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 99.42
KOG0266456 consensus WD40 repeat-containing protein [General 99.4
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 99.37
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.37
KOG0295406 consensus WD40 repeat-containing protein [Function 99.35
KOG0286343 consensus G-protein beta subunit [General function 99.34
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.34
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.32
PTZ00420568 coronin; Provisional 99.3
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.3
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.28
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.27
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.27
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.26
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.26
KOG0315311 consensus G-protein beta subunit-like protein (con 99.25
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.24
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.24
KOG0295406 consensus WD40 repeat-containing protein [Function 99.24
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.24
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.22
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.22
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 99.22
PLN00181793 protein SPA1-RELATED; Provisional 99.18
KOG0645312 consensus WD40 repeat protein [General function pr 99.18
KOG0318603 consensus WD40 repeat stress protein/actin interac 99.15
PTZ00421493 coronin; Provisional 99.15
KOG0319775 consensus WD40-repeat-containing subunit of the 18 99.13
KOG0315311 consensus G-protein beta subunit-like protein (con 99.12
KOG0265338 consensus U5 snRNP-specific protein-like factor an 99.12
KOG0645312 consensus WD40 repeat protein [General function pr 99.12
KOG0283712 consensus WD40 repeat-containing protein [Function 99.1
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.09
KOG0289506 consensus mRNA splicing factor [General function p 99.09
KOG0306888 consensus WD40-repeat-containing subunit of the 18 99.09
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.08
KOG0293519 consensus WD40 repeat-containing protein [Function 99.07
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.07
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.06
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.05
KOG0284464 consensus Polyadenylation factor I complex, subuni 99.05
PLN00181793 protein SPA1-RELATED; Provisional 99.04
PTZ00420568 coronin; Provisional 99.04
KOG0302440 consensus Ribosome Assembly protein [General funct 99.04
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.03
KOG0291893 consensus WD40-repeat-containing subunit of the 18 99.02
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.02
KOG0294362 consensus WD40 repeat-containing protein [Function 99.02
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.01
KOG0269839 consensus WD40 repeat-containing protein [Function 99.01
KOG0270463 consensus WD40 repeat-containing protein [Function 99.0
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.0
KOG0308735 consensus Conserved WD40 repeat-containing protein 98.99
KOG0316307 consensus Conserved WD40 repeat-containing protein 98.99
KOG0647347 consensus mRNA export protein (contains WD40 repea 98.97
KOG0289506 consensus mRNA splicing factor [General function p 98.97
KOG0310487 consensus Conserved WD40 repeat-containing protein 98.96
KOG0283712 consensus WD40 repeat-containing protein [Function 98.96
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 98.95
KOG0306888 consensus WD40-repeat-containing subunit of the 18 98.94
KOG0313423 consensus Microtubule binding protein YTM1 (contai 98.93
KOG0303472 consensus Actin-binding protein Coronin, contains 98.91
KOG0973 942 consensus Histone transcription regulator HIRA, WD 98.91
KOG0300481 consensus WD40 repeat-containing protein [Function 98.91
KOG0310487 consensus Conserved WD40 repeat-containing protein 98.89
KOG0641350 consensus WD40 repeat protein [General function pr 98.89
KOG0643327 consensus Translation initiation factor 3, subunit 98.88
KOG0300481 consensus WD40 repeat-containing protein [Function 98.88
KOG0640430 consensus mRNA cleavage stimulating factor complex 98.85
KOG0973 942 consensus Histone transcription regulator HIRA, WD 98.85
KOG0296399 consensus Angio-associated migratory cell protein 98.84
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.83
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 98.83
KOG0296399 consensus Angio-associated migratory cell protein 98.83
KOG0318603 consensus WD40 repeat stress protein/actin interac 98.82
KOG0639705 consensus Transducin-like enhancer of split protei 98.82
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 98.81
KOG0301745 consensus Phospholipase A2-activating protein (con 98.8
KOG1273405 consensus WD40 repeat protein [General function pr 98.79
KOG0293519 consensus WD40 repeat-containing protein [Function 98.77
KOG0772641 consensus Uncharacterized conserved protein, conta 98.77
KOG0278334 consensus Serine/threonine kinase receptor-associa 98.76
KOG0308735 consensus Conserved WD40 repeat-containing protein 98.76
KOG1407313 consensus WD40 repeat protein [Function unknown] 98.75
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 98.73
KOG0299479 consensus U3 snoRNP-associated protein (contains W 98.73
KOG0643327 consensus Translation initiation factor 3, subunit 98.73
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 98.71
KOG1539910 consensus WD repeat protein [General function pred 98.71
KOG0301745 consensus Phospholipase A2-activating protein (con 98.7
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 98.69
KOG0646476 consensus WD40 repeat protein [General function pr 98.65
KOG14451012 consensus Tumor-specific antigen (contains WD repe 98.64
KOG0269 839 consensus WD40 repeat-containing protein [Function 98.64
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 98.64
KOG14081080 consensus WD40 repeat protein [Function unknown] 98.64
KOG0299479 consensus U3 snoRNP-associated protein (contains W 98.63
KOG4283397 consensus Transcription-coupled repair protein CSA 98.63
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 98.62
KOG0288459 consensus WD40 repeat protein TipD [General functi 98.61
KOG0772641 consensus Uncharacterized conserved protein, conta 98.6
KOG0639705 consensus Transducin-like enhancer of split protei 98.57
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 98.57
KOG4283397 consensus Transcription-coupled repair protein CSA 98.56
KOG2096420 consensus WD40 repeat protein [General function pr 98.56
KOG0270463 consensus WD40 repeat-containing protein [Function 98.55
KOG0294362 consensus WD40 repeat-containing protein [Function 98.54
KOG1274 933 consensus WD40 repeat protein [General function pr 98.53
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 98.51
KOG2096420 consensus WD40 repeat protein [General function pr 98.5
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 98.49
KOG0647347 consensus mRNA export protein (contains WD40 repea 98.49
KOG0302440 consensus Ribosome Assembly protein [General funct 98.48
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 98.48
KOG1407313 consensus WD40 repeat protein [Function unknown] 98.47
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.45
KOG0268433 consensus Sof1-like rRNA processing protein (conta 98.44
KOG0288459 consensus WD40 repeat protein TipD [General functi 98.43
KOG0641350 consensus WD40 repeat protein [General function pr 98.41
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 98.39
KOG0649325 consensus WD40 repeat protein [General function pr 98.39
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 98.39
KOG0303472 consensus Actin-binding protein Coronin, contains 98.39
KOG0278334 consensus Serine/threonine kinase receptor-associa 98.37
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 98.36
KOG0771398 consensus Prolactin regulatory element-binding pro 98.34
KOG1310758 consensus WD40 repeat protein [General function pr 98.33
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 98.32
KOG0322323 consensus G-protein beta subunit-like protein GNB1 98.32
KOG0268433 consensus Sof1-like rRNA processing protein (conta 98.31
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 98.29
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 98.28
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 98.28
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 98.24
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 98.23
KOG0646476 consensus WD40 repeat protein [General function pr 98.22
COG2319466 FOG: WD40 repeat [General function prediction only 98.22
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 98.18
KOG0644 1113 consensus Uncharacterized conserved protein, conta 98.17
KOG14081080 consensus WD40 repeat protein [Function unknown] 98.17
KOG2055514 consensus WD40 repeat protein [General function pr 98.16
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 98.16
KOG0321720 consensus WD40 repeat-containing protein L2DTL [Fu 98.15
KOG2110391 consensus Uncharacterized conserved protein, conta 98.15
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 98.14
KOG4378673 consensus Nuclear protein COP1 [Signal transductio 98.14
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 98.11
KOG0290364 consensus Conserved WD40 repeat-containing protein 98.11
COG2319466 FOG: WD40 repeat [General function prediction only 98.1
KOG4227609 consensus WD40 repeat protein [General function pr 98.07
KOG1539 910 consensus WD repeat protein [General function pred 98.07
KOG2394636 consensus WD40 protein DMR-N9 [General function pr 98.04
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 98.03
KOG1063764 consensus RNA polymerase II elongator complex, sub 98.02
KOG1274 933 consensus WD40 repeat protein [General function pr 98.02
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 98.01
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.0
KOG2048691 consensus WD40 repeat protein [General function pr 98.0
KOG4328498 consensus WD40 protein [Function unknown] 97.98
KOG1272545 consensus WD40-repeat-containing subunit of the 18 97.95
KOG1272545 consensus WD40-repeat-containing subunit of the 18 97.94
KOG0322323 consensus G-protein beta subunit-like protein GNB1 97.93
KOG2106626 consensus Uncharacterized conserved protein, conta 97.88
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 97.87
KOG0649325 consensus WD40 repeat protein [General function pr 97.85
KOG1188376 consensus WD40 repeat protein [General function pr 97.84
KOG2048691 consensus WD40 repeat protein [General function pr 97.83
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 97.77
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 97.7
KOG2111346 consensus Uncharacterized conserved protein, conta 97.68
KOG1063764 consensus RNA polymerase II elongator complex, sub 97.66
KOG4547541 consensus WD40 repeat-containing protein [General 97.64
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.62
KOG2111346 consensus Uncharacterized conserved protein, conta 97.62
KOG2110391 consensus Uncharacterized conserved protein, conta 97.56
KOG0644 1113 consensus Uncharacterized conserved protein, conta 97.55
KOG1310 758 consensus WD40 repeat protein [General function pr 97.55
KOG12401431 consensus Protein kinase containing WD40 repeats [ 97.54
KOG2055514 consensus WD40 repeat protein [General function pr 97.54
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 97.47
KOG1273405 consensus WD40 repeat protein [General function pr 97.46
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 97.46
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 97.41
KOG4328498 consensus WD40 protein [Function unknown] 97.41
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 97.41
KOG3881412 consensus Uncharacterized conserved protein [Funct 97.36
KOG2139445 consensus WD40 repeat protein [General function pr 97.29
PRK11028330 6-phosphogluconolactonase; Provisional 97.27
KOG4547541 consensus WD40 repeat-containing protein [General 97.27
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 97.24
PRK01742429 tolB translocation protein TolB; Provisional 97.22
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 97.19
PRK11028330 6-phosphogluconolactonase; Provisional 97.13
KOG2139445 consensus WD40 repeat protein [General function pr 97.1
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.1
KOG15171387 consensus Guanine nucleotide binding protein MIP1 97.05
KOG0280339 consensus Uncharacterized conserved protein [Amino 97.05
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 97.0
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 97.0
KOG15171387 consensus Guanine nucleotide binding protein MIP1 97.0
PRK01742429 tolB translocation protein TolB; Provisional 96.98
KOG1963792 consensus WD40 repeat protein [General function pr 96.94
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 96.93
KOG0290364 consensus Conserved WD40 repeat-containing protein 96.88
KOG2321703 consensus WD40 repeat protein [General function pr 96.86
KOG2106626 consensus Uncharacterized conserved protein, conta 96.86
KOG1188376 consensus WD40 repeat protein [General function pr 96.85
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 96.83
KOG41901034 consensus Uncharacterized conserved protein [Funct 96.79
KOG2321703 consensus WD40 repeat protein [General function pr 96.74
KOG3881412 consensus Uncharacterized conserved protein [Funct 96.71
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 96.71
KOG12401431 consensus Protein kinase containing WD40 repeats [ 96.68
KOG0771398 consensus Prolactin regulatory element-binding pro 96.68
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.62
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 96.61
PRK05137435 tolB translocation protein TolB; Provisional 96.49
KOG1524737 consensus WD40 repeat-containing protein CHE-2 [Ge 96.45
KOG2695425 consensus WD40 repeat protein [General function pr 96.44
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.38
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 96.22
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 96.2
PRK03629429 tolB translocation protein TolB; Provisional 96.19
PRK03629429 tolB translocation protein TolB; Provisional 96.18
PRK02889427 tolB translocation protein TolB; Provisional 96.18
KOG2695425 consensus WD40 repeat protein [General function pr 96.11
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 96.11
KOG4714319 consensus Nucleoporin [Nuclear structure] 96.09
KOG4497447 consensus Uncharacterized conserved protein WDR8, 96.06
PRK04922433 tolB translocation protein TolB; Provisional 96.04
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 96.04
PRK04922433 tolB translocation protein TolB; Provisional 96.04
PLN029191057 haloacid dehalogenase-like hydrolase family protei 96.02
COG4946668 Uncharacterized protein related to the periplasmic 95.83
PRK05137435 tolB translocation protein TolB; Provisional 95.6
PRK02889427 tolB translocation protein TolB; Provisional 95.46
KOG2315566 consensus Predicted translation initiation factor 95.41
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 95.4
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 95.32
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 95.29
KOG1409404 consensus Uncharacterized conserved protein, conta 95.21
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 95.19
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 95.17
PRK01029428 tolB translocation protein TolB; Provisional 95.16
PRK00178430 tolB translocation protein TolB; Provisional 95.13
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 95.11
KOG4227609 consensus WD40 repeat protein [General function pr 95.02
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 95.01
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 95.0
KOG1963792 consensus WD40 repeat protein [General function pr 94.95
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 94.87
KOG1409404 consensus Uncharacterized conserved protein, conta 94.83
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 94.78
PRK04792448 tolB translocation protein TolB; Provisional 94.75
KOG1912 1062 consensus WD40 repeat protein [General function pr 94.63
KOG4497447 consensus Uncharacterized conserved protein WDR8, 94.56
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 94.48
PRK00178430 tolB translocation protein TolB; Provisional 94.46
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 94.41
KOG4714319 consensus Nucleoporin [Nuclear structure] 94.33
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 94.22
PRK04792448 tolB translocation protein TolB; Provisional 94.04
KOG1334559 consensus WD40 repeat protein [General function pr 94.0
PRK01029428 tolB translocation protein TolB; Provisional 93.97
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 93.46
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 93.4
PLN029191057 haloacid dehalogenase-like hydrolase family protei 93.35
KOG2314698 consensus Translation initiation factor 3, subunit 93.31
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 92.9
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 92.87
KOG2315566 consensus Predicted translation initiation factor 92.75
KOG4532344 consensus WD40-like repeat containing protein [Gen 92.52
KOG1334559 consensus WD40 repeat protein [General function pr 92.52
smart0032040 WD40 WD40 repeats. Note that these repeats are per 92.38
KOG41901034 consensus Uncharacterized conserved protein [Funct 92.32
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 92.19
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 92.08
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 91.95
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 91.72
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 91.5
KOG4532344 consensus WD40-like repeat containing protein [Gen 91.49
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 91.37
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 91.25
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 91.19
COG4946668 Uncharacterized protein related to the periplasmic 91.07
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 90.82
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 90.22
KOG2314698 consensus Translation initiation factor 3, subunit 90.06
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 89.81
PRK02888635 nitrous-oxide reductase; Validated 89.69
KOG2041 1189 consensus WD40 repeat protein [General function pr 88.18
PRK04043419 tolB translocation protein TolB; Provisional 87.84
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 87.78
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 87.75
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 87.5
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 87.21
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 86.89
KOG2444238 consensus WD40 repeat protein [General function pr 86.34
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 86.19
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 84.59
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 84.36
PRK04043419 tolB translocation protein TolB; Provisional 83.93
KOG4640665 consensus Anaphase-promoting complex (APC), subuni 83.71
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 83.02
KOG1912 1062 consensus WD40 repeat protein [General function pr 82.93
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 82.02
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 81.74
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 81.35
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 81.14
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 80.93
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 80.67
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 80.35
PF09384148 UTP15_C: UTP15 C terminal; InterPro: IPR018983 Thi 80.28
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information 
Probab=100.00  E-value=3.7e-67  Score=570.39  Aligned_cols=611  Identities=35%  Similarity=0.450  Sum_probs=521.3

Q ss_pred             CCCCEEEEEeCCCeEEEEECCCCeEEEEeCCCCCCeEEEEEcCCCCEEEEEeCC-cEEEEeCCCCeeEEEEeccCCceeE
Q 006939            1 MSGYFHFSGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHE-SLKVFSWEPIRCHDAVDVGWSRLSD   79 (625)
Q Consensus         1 PdG~lLASGS~D~tVkIWDL~tg~~i~tl~~h~~~V~sv~fsPdg~~LvSgs~D-sIrVWdl~sg~~i~t~~~~~s~v~~   79 (625)
                      |-|.++|+|+.|+.+++||.+...|++.+.+|...|.++.|+|+|+|+++|+.| +++|||+.-|+....|..|...+..
T Consensus       122 P~~~~~a~gStdtd~~iwD~Rk~Gc~~~~~s~~~vv~~l~lsP~Gr~v~~g~ed~tvki~d~~agk~~~ef~~~e~~v~s  201 (825)
T KOG0267|consen  122 PYGEFFASGSTDTDLKIWDIRKKGCSHTYKSHTRVVDVLRLSPDGRWVASGGEDNTVKIWDLTAGKLSKEFKSHEGKVQS  201 (825)
T ss_pred             cceEEeccccccccceehhhhccCceeeecCCcceeEEEeecCCCceeeccCCcceeeeecccccccccccccccccccc
Confidence            457889999999999999999999999999999999999999999999999998 9999999999999888878788888


Q ss_pred             EEec-CCCEEEEeeCCCeEEEEecc----CCcccccc-------------------------------------------
Q 006939           80 LNVH-EGKLLGCSYNQSCVGVWVVD----ISRIEPYT-------------------------------------------  111 (625)
Q Consensus        80 l~~~-dg~lL~sg~~Dg~V~vWdv~----~~~~~~~~-------------------------------------------  111 (625)
                      +.|| ...+++.|+.|++|++||++    +....+..                                           
T Consensus       202 le~hp~e~Lla~Gs~d~tv~f~dletfe~I~s~~~~~~~v~~~~fn~~~~~~~~G~q~sl~~~~~a~ah~~~~~~~~Ep~  281 (825)
T KOG0267|consen  202 LEFHPLEVLLAPGSSDRTVRFWDLETFEVISSGKPETDGVRSLAFNPDGKIVLSGEQISLSESRTASAHVRKTLARWEPE  281 (825)
T ss_pred             cccCchhhhhccCCCCceeeeeccceeEEeeccCCccCCceeeeecCCceeeecCchhhhhhhhcccceeeccccccccc
Confidence            8784 56677999999999999998    11111110                                           


Q ss_pred             -ccceeEEeccCCCccccccCcCcccccccccccCcccccCCCCCCccccccccccccc-CCCCcchhcccccccccccc
Q 006939          112 -IGSVTRVNGLSESKSSASGNLSVLNENSAKASLGKLSVSQNSDPLVKETKSLGRLSVS-QNSDPLLKETKTLGRLSVSQ  189 (625)
Q Consensus       112 -~~~i~~l~gHs~~v~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~~~t~s~g~~s~~-~~~~~~~~e~~~~~~~s~~~  189 (625)
                       .........|.+.+.+...++..+|.......++++...+.. ++.+.|.++|+++++ |+.|+..++.+..+.++.+|
T Consensus       282 ~~~~~vqs~~~~ek~v~v~~d~~~ln~~~s~~~~~kl~~~~~~-p~l~~t~~l~rl~~S~q~dep~~~~~k~~~~s~t~~  360 (825)
T KOG0267|consen  282 MDGAVVQSNSHKEKVVAVGRDPQDLNAFSSKVNLSKLEDSTYV-PLLKETKSLGRLSVSYQTDEPLDKSTKPHRRSSTSQ  360 (825)
T ss_pred             cccceeeecCCcccccccccCcccccccccccccccccccccc-ceeccccchhccccccccCCCcccCCCCcccccccc
Confidence             001223344555555555566666666666677888888777 788899999999887 99999888877655554444


Q ss_pred             CC-------------------CcccccccccCCCCCCCCCCccccCCCCCc-ccccc---ccccccccccccccCCCCCc
Q 006939          190 NS-------------------EPAKESKVLSSTGSVPGTPQRVNLNMGSKT-SVVNS---TAVVSKRTSTRANTASNVPI  246 (625)
Q Consensus       190 ~~-------------------~~~~~~~~~~~~~~~~~tp~r~~~~~~p~~-~~~~~---~~~~~~~~~~~~~~~~~~~~  246 (625)
                      |.                   +..+..+.+.+++..+..|+|....+.++. +++++   +++.++...++++++.+.+.
T Consensus       361 ~s~~~~~~s~P~~r~~s~~~~di~~~s~~lss~e~~~~~P~r~s~tn~~k~~sgvSs~~~rs~ts~~~~~k~n~ka~~~~  440 (825)
T KOG0267|consen  361 NSDRSEVESKPLTRESSNLSPDIPKESRTLSSTESNSEYPHRVSPTNPVKIVSGVSSSVTRSPTSPVNPGKANPKAEIAS  440 (825)
T ss_pred             cccccccccCccccccCCCCcccccccccccccccCCCCCCcccccCccccccccccccccCCCCCCCccccCccccccc
Confidence            33                   233455556677778999999999877777 77766   88888888888888888655


Q ss_pred             ccccccccccccCCCCccccccccccccccccccccCccCCcccccccccCCCCCCCccccccccccCCCCCcccccccc
Q 006939          247 LNKSDIVPVIVPRTNTRFEQAVESRKDIDVIGRTMPFSLQSKATDSRKFQNSGDEVDQPAVSVLCENTGSKATEVSSVAD  326 (625)
Q Consensus       247 ~~~~~~~p~~~pr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  326 (625)
                      . ..|+.||+.+ ..+..+++.++....+..+|++|.+.++.+.++|  ++.++++..++.. ..+++.+.+.++.-++.
T Consensus       441 ~-e~~~~~v~~~-~~p~~~q~~Esp~~~~~~arttP~s~~P~~~~~r--~~~rs~~~~~~st-~~~rtssspvmpv~lp~  515 (825)
T KOG0267|consen  441 V-EQDNNPVIQD-PLPTIEQATESPVPSTRIARTTPASVQPIALNSR--SNSRSDPPPPTST-VPERTSSSPVMPVILPQ  515 (825)
T ss_pred             c-ccccccccCC-CcccccccccCccccccccccCCccccccccccc--ccCCCCCCCcccc-cccccccCCccccccCC
Confidence            4 7788999988 7788889999999999999999999999999999  7889998877744 34778888888888888


Q ss_pred             cc--ccccccccccccccccccCcccceeccCCCCCCCCCCCCCCcccccccccCCCCCCCCccchhcccCccccceecc
Q 006939          327 RN--TFAAIKGSIQGVSVTERNSKEDIFTVSGKSGTMSMSESPASYEDERYDSLGHKSNRDGYAMESQKRGRMHSLVINW  404 (625)
Q Consensus       327 ~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~l~~~~  404 (625)
                      .+  .++...++.+.  .++.......+-.+++++-.+.++.|...+..++.+  +..-.-++..-.++.++-.+.++++
T Consensus       516 ~s~~ty~~~~v~a~~--~a~~s~~r~~~~~~~~a~~~~~~~~~~~l~r~r~~~--pa~~~~tk~~~~~~~t~~~s~iasr  591 (825)
T KOG0267|consen  516 ASMSTYPEPPVGASS--TARTSSARILPVTFNQANNISSEEAPVTLRRQRRNS--PARVMPTKLNQSVNMTSDTSHIASR  591 (825)
T ss_pred             CcccccCCCCccccC--cccccccccccccccccccccCcCCccccccccCCC--cccccccccchhhcccccccchhhh
Confidence            88  88888888887  788888888999999999999889999888887772  2222223334445668889999999


Q ss_pred             cccCCCCCCCCCCCcCCCCCccccCCCCcccccccCCCcccccccCCCCcHHHHHHHHHhHHHHHHHHHHHHHHHHHHHH
Q 006939          405 EKRGSSPNYDGPTSSISSGTVSTVSMPPFNAFKQRGYSSSAEKETASVSDEDATADVMEQHSQFVSSMQSRLAKLQAVYR  484 (625)
Q Consensus       405 e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~d~~~~~~l~~~H~~~~~vl~~R~~~L~~vr~  484 (625)
                      +|+..+.+..+|+....++.+++.+.++-.+..++..... |+...+..|+|+.++||..|++|++.|++||++||+||+
T Consensus       592 ~r~s~t~~~~tPa~~~~~~~mt~~et~~t~~~~q~~n~~~-ee~~~s~~eedI~e~im~~Hde~lstlqSRl~kLqiVR~  670 (825)
T KOG0267|consen  592 HRVSPTQMLATPAVIDQVGDMTADETRPTNMQPQRDNLVQ-EEPIISDREEDIVEDIMGTHNEFLSTLQSRLTKLQIVRH  670 (825)
T ss_pred             hccCccccccccceeccccccccccccccccccccccccc-cccccCcchhhhhhhhhhcchHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999998888888888887777 887788999999999999999999999999999999999


Q ss_pred             HhhcCCHHHHHHHHHhcCCchhHHHHHHHHHhcccccchhhHHhhHHHHHHhhccCCchhHHHHHHHHHHHHHHHHHHHH
Q 006939          485 YWERNDVKGAISAMQKMADHTVLADVMSIVVEKIEIVTLDICSCLLPLLTGLLESDMDRHLSISLDILLKLVRTFGSMIY  564 (625)
Q Consensus       485 ~W~~~dik~ai~~~~~~~D~~VlvD~L~~l~~~~~~~tLd~c~~lLP~i~~LL~Sk~E~~v~~al~~l~~i~~~F~~~I~  564 (625)
                      ||+++|||++|.++++|.|++|.||+|+||++|.++|+||+|..|||++..||.|++|+|+.++|++|+++++.||++|+
T Consensus       671 ~Wer~DiK~sI~s~~kl~D~sV~ADvL~Iltek~eiLtLDl~t~l~P~lt~LLgS~~e~~v~vsld~Llklv~~fgt~I~  750 (825)
T KOG0267|consen  671 FWERSDIKGSIGSLRKLADNSVQADVLNILTEKIEILTLDLCTQLLPVLTALLGSKTERPVNVSLDMLLKLVAVFGTVIY  750 (825)
T ss_pred             HhhhhhhhHHHHHHHHhhhhhHHHHHHHHHhhhhhHhhHHHHHHHHHHHHHHhcccchhhhhhHHHHHHHHHHHhhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhccCCCcccCccHHHHHHHHHHHHHHHHHHHhhhhhhhhhCCchhHHHHHHHHHhh
Q 006939          565 SAISASTSVGVDIEAEQRIERCNRCFIELEKVKCCLPTLMRRGGSVAKSAQELNLALQ  622 (625)
Q Consensus       565 ~~~~~~~~~gVDl~~EeR~~kc~~c~~~L~~i~~~l~~l~~~~g~~g~~a~el~~~l~  622 (625)
                      ++++||..+||||.+|||.++|..||.+|.+|.-.|+++++.+|..+...++++.++.
T Consensus       751 stlsAp~~VGVDi~aeer~~~~~lc~~~l~kl~~~~~s~s~~s~s~~~~~~s~~~~~~  808 (825)
T KOG0267|consen  751 STLSAPRSVGVDIHAEERKERYSLCFVELPKLFCGLASLSKNSSSFIKKRRSLNKKGS  808 (825)
T ss_pred             hhhhCCcccccccchHHHHhhhhhhhhhcchhhccccccccccccchhhhhhhccccc
Confidence            9999999999999999999999999999999999999999999999999999988654

>PF13925 Katanin_con80: con80 domain of Katanin Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09384 UTP15_C: UTP15 C terminal; InterPro: IPR018983 This entry represents the C-terminal domain of the U3 small nucleolar RNA-associated protein 15 (UTP15) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query625
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.61
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.6
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.59
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 99.55
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.55
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.55
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.54
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.54
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.52
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 99.52
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.51
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.5
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.5
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.49
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.49
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.47
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.47
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.46
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.45
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.45
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.45
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.45
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.44
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.44
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.43
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.43
2pm7_B297 Protein transport protein SEC13, protein transport 99.42
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.41
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.4
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.4
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.39
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.39
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.39
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.39
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 99.39
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.39
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.38
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.38
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.37
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.37
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.36
2pm7_B297 Protein transport protein SEC13, protein transport 99.36
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.36
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.36
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.36
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.35
3jrp_A379 Fusion protein of protein transport protein SEC13 99.35
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.34
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.34
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.33
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.33
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.33
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.33
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.32
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.32
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.32
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.32
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.31
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.31
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.31
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.31
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.31
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.29
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.29
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.29
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.29
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.28
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.28
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.28
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.28
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.27
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.27
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.27
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.27
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.27
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.26
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.26
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.26
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.26
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.26
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.25
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.25
3jrp_A379 Fusion protein of protein transport protein SEC13 99.25
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.25
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.25
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.25
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.25
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.25
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.25
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.24
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.23
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.23
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.22
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.21
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.21
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.21
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.2
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.19
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.19
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.18
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.18
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.18
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.18
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.18
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.18
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.18
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.18
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.17
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.17
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.17
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.17
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.17
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.17
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.17
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.17
3jro_A 753 Fusion protein of protein transport protein SEC13 99.17
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.15
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.15
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 99.13
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.11
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.1
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.07
3jro_A753 Fusion protein of protein transport protein SEC13 99.05
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.93
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.87
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.87
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 98.82
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.79
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.65
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.6
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.44
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.42
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.41
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.37
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 98.36
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.36
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.33
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.33
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.33
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.33
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.28
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.27
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.26
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.24
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.23
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.21
1k32_A1045 Tricorn protease; protein degradation, substrate g 98.21
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.2
1k32_A1045 Tricorn protease; protein degradation, substrate g 98.19
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.19
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.17
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.13
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.11
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 98.06
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.04
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.02
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.02
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 98.01
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.99
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 97.96
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.91
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 97.89
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.87
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.86
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.78
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.78
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.77
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.71
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.64
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.64
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.64
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.58
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.58
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.51
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.5
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.49
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.47
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 97.47
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.44
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 97.3
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 97.24
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 97.22
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.21
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.12
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.1
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.1
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.06
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 97.06
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 97.04
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.03
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 97.03
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.89
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.87
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 96.87
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 96.86
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 96.86
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 96.67
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 96.65
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 96.58
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 96.51
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 96.5
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.45
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 96.44
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.41
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 96.31
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 96.3
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 96.07
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.89
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 95.77
2qe8_A343 Uncharacterized protein; structural genomics, join 95.71
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 95.61
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 95.52
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.51
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 95.42
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 95.38
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 95.28
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.25
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 95.08
2ece_A462 462AA long hypothetical selenium-binding protein; 94.94
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 94.91
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 94.8
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 94.75
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 94.63
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 94.6
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 94.6
2ece_A462 462AA long hypothetical selenium-binding protein; 94.46
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 94.44
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 94.31
2qe8_A343 Uncharacterized protein; structural genomics, join 94.11
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 93.86
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 93.77
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 93.59
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 93.3
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 93.2
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 92.84
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 92.8
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 92.6
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 92.31
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 91.95
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 91.84
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 91.69
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 91.63
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 91.16
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 91.14
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 90.28
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 90.16
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 89.59
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 89.17
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 88.97
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 88.88
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 88.01
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 87.96
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 87.35
2fp8_A322 Strictosidine synthase; six bladed beta propeller 87.32
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 87.13
2p4o_A306 Hypothetical protein; putative lactonase, structur 86.81
2fp8_A322 Strictosidine synthase; six bladed beta propeller 81.33
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
Probab=99.61  E-value=1.1e-14  Score=151.01  Aligned_cols=122  Identities=19%  Similarity=0.269  Sum_probs=111.5

Q ss_pred             CCCCEEEEEeCCCeEEEEECCCCeEEEEeCCCCCCeEEEEEcCCCCEEEEEeCC-cEEEEeCCCCeeEEEEeccCCceeE
Q 006939            1 MSGYFHFSGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCGLHE-SLKVFSWEPIRCHDAVDVGWSRLSD   79 (625)
Q Consensus         1 PdG~lLASGS~D~tVkIWDL~tg~~i~tl~~h~~~V~sv~fsPdg~~LvSgs~D-sIrVWdl~sg~~i~t~~~~~s~v~~   79 (625)
                      |||++||+|+.|++|++||+.+++++..+.+|...|.+++|+|++.+|++|+.| .|++||++.+.+...+..+...+..
T Consensus       174 pdg~~lasg~~dg~i~iwd~~~~~~~~~~~~h~~~v~~l~~spd~~~l~s~s~dg~i~iwd~~~~~~~~~~~~h~~~v~~  253 (321)
T 3ow8_A          174 PDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLN  253 (321)
T ss_dssp             TTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCCCEEEECTTSCEEEEECTTSCEEEEETTTCCEEEEECCCSSCEEE
T ss_pred             CCCCEEEEEcCCCeEEEEECCCCcEEEEEcccCCceeEEEEcCCCCEEEEEcCCCeEEEEECCCcceeEEEcCCCCceEE
Confidence            789999999999999999999999999999999999999999999999999999 9999999999999888888888999


Q ss_pred             EEe-cCCCEEEEeeCCCeEEEEeccCCccccccccceeEEeccCCCccccc
Q 006939           80 LNV-HEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSSAS  129 (625)
Q Consensus        80 l~~-~dg~lL~sg~~Dg~V~vWdv~~~~~~~~~~~~i~~l~gHs~~v~~~~  129 (625)
                      +.| +++.+|++++.|+.|++||+.       .+..+..+.+|...+....
T Consensus       254 ~~~sp~~~~l~s~s~D~~v~iwd~~-------~~~~~~~~~~h~~~v~~v~  297 (321)
T 3ow8_A          254 VAFCPDDTHFVSSSSDKSVKVWDVG-------TRTCVHTFFDHQDQVWGVK  297 (321)
T ss_dssp             EEECTTSSEEEEEETTSCEEEEETT-------TTEEEEEECCCSSCEEEEE
T ss_pred             EEECCCCCEEEEEeCCCcEEEEeCC-------CCEEEEEEcCCCCcEEEEE
Confidence            998 799999999999999999997       4566777888887765543
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 625
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-08
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-07
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.003
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-07
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 0.003
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 2e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-06
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 9e-05
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-06
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 0.002
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 3e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-05
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.002
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 2e-05
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-05
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 3e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-05
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-04
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.003
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 4e-04
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 4e-04
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 7e-04
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 0.001
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.002
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.003
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 0.002
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 0.002
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 52.4 bits (124), Expect = 7e-08
 Identities = 13/50 (26%), Positives = 17/50 (34%)

Query: 2   SGYFHFSGSADRTVKFWDLETFELIGSAGPETSGVRCLTFNPDGRTLLCG 51
           SG    +G  D     WD    +  G      + V CL    DG  +  G
Sbjct: 281 SGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATG 330
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query625
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.61
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.48
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.46
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.44
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.41
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.38
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.35
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.34
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.33
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.32
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.31
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.29
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.29
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.28
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.28
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.25
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.25
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.18
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.17
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.17
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.17
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.15
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.1
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.05
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.04
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.03
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.01
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.96
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.93
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.82
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.81
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.73
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.6
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.57
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.54
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.33
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.25
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.25
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.2
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.08
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.07
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.72
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.64
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.49
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.35
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.32
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.3
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.26
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.2
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.11
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 95.55
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 95.53
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 95.46
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 95.01
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 93.82
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 92.59
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 91.87
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 91.16
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 90.22
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 89.33
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 88.23
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 87.05
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 86.4
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 83.12
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 82.84
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 80.52
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Antiviral protein Ski8 (Ski8p)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.61  E-value=5.2e-15  Score=153.69  Aligned_cols=119  Identities=18%  Similarity=0.220  Sum_probs=103.9

Q ss_pred             CCCCEEEEEeCCCeEEEEECCCCeEEEEe------CCCCCCeEEEEEcCCCCEEEEEeCC-c---EEEEeCCCCeeEEEE
Q 006939            1 MSGYFHFSGSADRTVKFWDLETFELIGSA------GPETSGVRCLTFNPDGRTLLCGLHE-S---LKVFSWEPIRCHDAV   70 (625)
Q Consensus         1 PdG~lLASGS~D~tVkIWDL~tg~~i~tl------~~h~~~V~sv~fsPdg~~LvSgs~D-s---IrVWdl~sg~~i~t~   70 (625)
                      ||| +||+|+.|++|+|||+.+++++..+      .+|...|.+++|+|||.+|++|+.| +   |++||++++.++..+
T Consensus       194 ~dg-~lasgs~Dg~i~iwd~~~~~~~~~~~~~~~l~~h~~~V~~l~~spdg~~l~sgs~D~t~~~i~lwd~~~g~~~~~l  272 (393)
T d1sq9a_         194 ERG-LIATGFNNGTVQISELSTLRPLYNFESQHSMINNSNSIRSVKFSPQGSLLAIAHDSNSFGCITLYETEFGERIGSL  272 (393)
T ss_dssp             TTS-EEEEECTTSEEEEEETTTTEEEEEEECCC---CCCCCEEEEEECSSTTEEEEEEEETTEEEEEEEETTTCCEEEEE
T ss_pred             CCC-EEEEEeCCCcEEEEeecccccccccccccccccccceEEEcccccccceeeeecCCCCcceeeecccccceeeeee
Confidence            455 8899999999999999999887654      5688999999999999999999987 4   899999999887766


Q ss_pred             e-------------ccCCceeEEEe-cCCCEEEEeeCCCeEEEEeccCCccccccccceeEEeccCCCccc
Q 006939           71 D-------------VGWSRLSDLNV-HEGKLLGCSYNQSCVGVWVVDISRIEPYTIGSVTRVNGLSESKSS  127 (625)
Q Consensus        71 ~-------------~~~s~v~~l~~-~dg~lL~sg~~Dg~V~vWdv~~~~~~~~~~~~i~~l~gHs~~v~~  127 (625)
                      .             +|...|..+.| +++++|++|+.|++|++||+.       .+..+..+.||.+.+..
T Consensus       273 ~~~~~~~~~~~~~~gH~~~V~~l~fspd~~~l~S~s~D~~v~vWd~~-------~g~~~~~l~gH~~~v~~  336 (393)
T d1sq9a_         273 SVPTHSSQASLGEFAHSSWVMSLSFNDSGETLCSAGWDGKLRFWDVK-------TKERITTLNMHCDDIEI  336 (393)
T ss_dssp             CBC--------CCBSBSSCEEEEEECSSSSEEEEEETTSEEEEEETT-------TTEEEEEEECCGGGCSS
T ss_pred             ccccccccceeeeecccCceeeeccCCCCCeeEEECCCCEEEEEECC-------CCCEEEEECCcCCcccC
Confidence            3             57778999999 799999999999999999998       67889999999988754
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure