Citrus Sinensis ID: 007764

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590
MSNQAESSDAKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTMEKLQFFRGDTILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQV
ccccccccccccccccccHHHHHHccccccEEEcccccccccEEEEcHHHHHHcccccccEEEEEEccccEEEEEEEccccccccEEEEcHHHHHHcccccccEEEEEEccccccccEEEEccccccccccccccHHHHHHHHHHHcccccccccEEEEEcccEEEEEEEEEEcccccEEEccccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEccccccccHHHHccccccEEEEEccccHHHHHHHHHHHHccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHccccccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHcccccHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHHHHHccccEEEEcccccccccc
ccccccccccccccccHHHHHHHccccccEEEEEccccccccEEEEcHHHHHHcccccccEEEEEccccccEEEEEcccccccccEEEEcccEEcccEEEcccEEEEEEccccccccEEEEcccccccccccHHHHHHHHHHHHHHHccccccccEEEEccccccEEEEEEEEccccEEEEccccEEEEcccccccEEEEEcccccHcccccHHHHHHHHHHHHccccccHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHcccEEEEccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEcHHHHccccccccccHHHHHHHHHHHHHccccccccEEEEEEccccccccHHHcccccccEEEEcccccHHHHHHHHHHHHccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccHHHHHHHHHccccHHccEEEEEcccccHHHcccHHHHHHHHHHHHccccccHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHccccEEEEccHHHHHHHHcHcHHHHHHHHHHHHHHccEEEEEHHHHHHcccc
msnqaessdakgtkrdFSTAILErkkapnrlvvdeainddnsvvvlhpdtmeklqffrgdtilikgkkrkdTVCIALAddtceepkirmnKVVRSNLRVrlgdvvsvhqcadvkygkrvhilpvddtiegvtgnlfdaylkpyfteayrpvrkgdlflvrggmrsvefkvietdppeycvvapdteifcegepvrredenrldevgyddvggVRKQMAQIRELVElplrhpqlfksigvkppkgillygppgsgkTLIARAVANETgafffcingpeimsKLAGESESNLRKAFEEAeknapsiifideidsiapkrekthgeVERRIVSQLLTLMDGLKSRAHVIVIgatnrpnsidpalrrfgrfdreidigvpdevgRLEVLRIHtknmklsddvdleriakdthgyvgADLAALCTEAALQCIREKmdvidledeTIDAEILNSMAVTDEHFKtalgtsnpsaLRETVVevpnvnwedigglENVKRELQETvqypvehpekfekfgmspskgvlfygppgcgkTLLAKAIANECQanfisvkgpelltmwfgesEANVREIFDKArqsapcvlffDELDSIATQV
msnqaessdakgtkrdfstailerkkapnrlvvdeainddnsvvvlhpdtmeklqffrgdtilikgkkrkdtVCIAladdtceepkirmnkvvrsnlrvrlgdvvsvhqcadvkygkrvhilpvddtiegVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSvefkvietdppeycvvapdteifcegepvrredenrldevgyddvggVRKQMAQIRELVelplrhpqlfksigvkppkgILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEaeknapsiifideidsiapkrekthgeverRIVSQLLTLMDGLKSRAHVIVigatnrpnsidpalRRFGrfdreidigvpdevgrlevlrihtknmklsddvdLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTalgtsnpsalrETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQV
MSNQAESSDAKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTMEKLQFFRGDTILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQV
*****************************RLVVDEAINDDNSVVVLHPDTMEKLQFFRGDTILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPV*******LDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIM***********************SIIFIDEIDSIA********EVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVE****FEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELD******
******************************LVVDEAINDDNSVVVLHPDTMEKLQFFRGDTILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTI**VTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTE*********************DDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDS*****************SQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREK**************ILNSMAVTDEHFKTALG****************VNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQV
**************RDFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTMEKLQFFRGDTILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPK********ERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQV
***************DFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTMEKLQFFRGDTILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKR**THGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQ*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNQAESSDAKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTMEKLQFFRGDTILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query590 2.2.26 [Sep-21-2011]
P54774 807 Cell division cycle prote no no 0.993 0.726 0.952 0.0
Q9SCN8 815 Cell division control pro yes no 0.991 0.717 0.938 0.0
Q9LZF6 810 Cell division control pro no no 0.996 0.725 0.949 0.0
P54609 809 Cell division control pro no no 0.996 0.726 0.945 0.0
Q96372 805 Cell division cycle prote N/A no 0.959 0.703 0.935 0.0
Q7ZU99 806 Transitional endoplasmic yes no 0.984 0.720 0.802 0.0
Q01853 806 Transitional endoplasmic yes no 0.984 0.720 0.806 0.0
P55072 806 Transitional endoplasmic yes no 0.984 0.720 0.806 0.0
P46462 806 Transitional endoplasmic yes no 0.984 0.720 0.806 0.0
Q6GL04 805 Transitional endoplasmic yes no 0.984 0.721 0.806 0.0
>sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 Back     alignment and function desciption
 Score = 1163 bits (3009), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/589 (95%), Positives = 576/589 (97%)

Query: 1   MSNQAESSDAKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTMEKLQFFRGD 60
           MS Q ESSD K  K+DFSTAILERKK+PNRLVVDEA+NDDNSVV +HP TMEKLQ FRGD
Sbjct: 1   MSQQGESSDPKSGKKDFSTAILERKKSPNRLVVDEAVNDDNSVVTMHPQTMEKLQLFRGD 60

Query: 61  TILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH 120
           TILIKGKKRKDT+CIALAD+ CEEPKIRMNKVVRSNLRVRLGDVVSVHQC DVKYGKRVH
Sbjct: 61  TILIKGKKRKDTICIALADENCEEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH 120

Query: 121 ILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCV 180
           ILP+DDTIEGVTGNLFDA+LKPYF EAYRPVRKGDLFLVRGGMRSVEFKV+ETDP EYCV
Sbjct: 121 ILPIDDTIEGVTGNLFDAFLKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVVETDPGEYCV 180

Query: 181 VAPDTEIFCEGEPVRREDENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVK 240
           VAPDTEIFCEGEP++REDE RLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVK
Sbjct: 181 VAPDTEIFCEGEPLKREDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVK 240

Query: 241 PPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKN 300
           PPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKN
Sbjct: 241 PPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKN 300

Query: 301 APSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPA 360
           APSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPA
Sbjct: 301 APSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPA 360

Query: 361 LRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCT 420
           LRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCT
Sbjct: 361 LRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCT 420

Query: 421 EAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNW 480
           EAALQCIREKMDVIDLEDETIDAE+LNSMAVT+EHF+TALGTSNPSALRETVVEVPNV+W
Sbjct: 421 EAALQCIREKMDVIDLEDETIDAEVLNSMAVTNEHFQTALGTSNPSALRETVVEVPNVSW 480

Query: 481 EDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQ 540
           EDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQ
Sbjct: 481 EDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQ 540

Query: 541 ANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQ 589
           ANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQ
Sbjct: 541 ANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQ 589
Probably functions in cell division and growth processes.
Glycine max (taxid: 3847)
>sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 Back     alignment and function description
>sp|Q9LZF6|CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2 Back     alignment and function description
>sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 Back     alignment and function description
>sp|Q96372|CDC48_CAPAN Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 Back     alignment and function description
>sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 Back     alignment and function description
>sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 Back     alignment and function description
>sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 Back     alignment and function description
>sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 Back     alignment and function description
>sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query590
225440045 806 PREDICTED: cell division cycle protein 4 0.993 0.727 0.976 0.0
381145559 807 cell division cycle protein 48 [Camellia 0.993 0.726 0.969 0.0
224140199 802 predicted protein [Populus trichocarpa] 0.991 0.729 0.969 0.0
255556934 806 Transitional endoplasmic reticulum ATPas 0.993 0.727 0.967 0.0
356548285 811 PREDICTED: cell division cycle protein 4 0.993 0.722 0.967 0.0
449451036 807 PREDICTED: cell division cycle protein 4 0.993 0.726 0.969 0.0
98962497 808 putative spindle disassembly related pro 0.993 0.725 0.960 0.0
356505246 808 PREDICTED: cell division cycle protein 4 0.993 0.725 0.964 0.0
449482441 807 PREDICTED: LOW QUALITY PROTEIN: cell div 0.993 0.726 0.966 0.0
449440119 804 PREDICTED: cell division cycle protein 4 0.991 0.727 0.962 0.0
>gi|225440045|ref|XP_002282146.1| PREDICTED: cell division cycle protein 48 homolog [Vitis vinifera] gi|297741633|emb|CBI32765.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1186 bits (3069), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/589 (97%), Positives = 583/589 (98%)

Query: 1   MSNQAESSDAKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTMEKLQFFRGD 60
           MSNQAESSD+KGTKRDFSTAILERKKA NRLVVDEA+NDDNSVV LHPDTMEKLQ FRGD
Sbjct: 1   MSNQAESSDSKGTKRDFSTAILERKKAANRLVVDEAVNDDNSVVALHPDTMEKLQLFRGD 60

Query: 61  TILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH 120
           TILIKGKKRKDT+CIALADDTC+EPKIRMNKVVRSNLRVRLGDVVSVHQC DVKYGKRVH
Sbjct: 61  TILIKGKKRKDTICIALADDTCDEPKIRMNKVVRSNLRVRLGDVVSVHQCPDVKYGKRVH 120

Query: 121 ILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCV 180
           ILPVDDTIEGVTGNLFDAYLKPYF EAYRPVRKGDLFLVRGGMRSVEFKVIETDP EYCV
Sbjct: 121 ILPVDDTIEGVTGNLFDAYLKPYFLEAYRPVRKGDLFLVRGGMRSVEFKVIETDPAEYCV 180

Query: 181 VAPDTEIFCEGEPVRREDENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVK 240
           VAPDTEIFCEGEPVRREDE+RLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVK
Sbjct: 181 VAPDTEIFCEGEPVRREDEDRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVK 240

Query: 241 PPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKN 300
           PPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKN
Sbjct: 241 PPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKN 300

Query: 301 APSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPA 360
           APSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPA
Sbjct: 301 APSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPA 360

Query: 361 LRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCT 420
           LRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLS+DVDLERIAKDTHGYVGADLAALCT
Sbjct: 361 LRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSEDVDLERIAKDTHGYVGADLAALCT 420

Query: 421 EAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNW 480
           EAALQCIREKMDVIDLEDE+IDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNV+W
Sbjct: 421 EAALQCIREKMDVIDLEDESIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVSW 480

Query: 481 EDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQ 540
           EDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQ
Sbjct: 481 EDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQ 540

Query: 541 ANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQ 589
           ANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQ
Sbjct: 541 ANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQ 589

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|381145559|gb|AFF59215.1| cell division cycle protein 48 [Camellia sinensis] Back     alignment and taxonomy information
>gi|224140199|ref|XP_002323472.1| predicted protein [Populus trichocarpa] gi|222868102|gb|EEF05233.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255556934|ref|XP_002519500.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] gi|223541363|gb|EEF42914.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356548285|ref|XP_003542533.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max] Back     alignment and taxonomy information
>gi|449451036|ref|XP_004143268.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|98962497|gb|ABF59516.1| putative spindle disassembly related protein CDC48 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|356505246|ref|XP_003521403.1| PREDICTED: cell division cycle protein 48 homolog [Glycine max] Back     alignment and taxonomy information
>gi|449482441|ref|XP_004156282.1| PREDICTED: LOW QUALITY PROTEIN: cell division cycle protein 48 homolog [Cucumis sativus] Back     alignment and taxonomy information
>gi|449440119|ref|XP_004137832.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus] gi|449525650|ref|XP_004169829.1| PREDICTED: cell division cycle protein 48 homolog [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query590
TAIR|locus:2101933 815 AtCDC48B "AT3G53230" [Arabidop 0.998 0.722 0.938 2.2e-302
TAIR|locus:2831844 810 AtCDC48C "cell division cycle 0.996 0.725 0.949 4.6e-302
TAIR|locus:2085064 809 CDC48 "cell division cycle 48" 0.996 0.726 0.945 1.1e-300
DICTYBASE|DDB_G0288065 793 cdcD "CDC48 family AAA ATPase" 0.974 0.725 0.853 6.6e-271
UNIPROTKB|P55072 806 VCP "Transitional endoplasmic 0.984 0.720 0.806 7.5e-263
MGI|MGI:99919 806 Vcp "valosin containing protei 0.984 0.720 0.806 7.5e-263
RGD|621595 806 Vcp "valosin-containing protei 0.984 0.720 0.806 7.5e-263
ZFIN|ZDB-GENE-030131-5408 806 vcp "valosin containing protei 0.984 0.720 0.802 1.2e-262
UNIPROTKB|Q6GL04 805 vcp "Transitional endoplasmic 0.984 0.721 0.806 1.6e-262
UNIPROTKB|G3X757 806 VCP "Transitional endoplasmic 0.984 0.720 0.804 2.5e-262
TAIR|locus:2101933 AtCDC48B "AT3G53230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2902 (1026.6 bits), Expect = 2.2e-302, P = 2.2e-302
 Identities = 553/589 (93%), Positives = 579/589 (98%)

Query:     1 MSNQAESSDAKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTMEKLQFFRGD 60
             M+NQAESSD+KGTK+DFSTAILE+KKA NRLVVDEAINDDNSVV LHPDTMEKLQ FRGD
Sbjct:     1 MANQAESSDSKGTKKDFSTAILEKKKAANRLVVDEAINDDNSVVSLHPDTMEKLQLFRGD 60

Query:    61 TILIKGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVH 120
             TILIKGKKRKDTVCIALAD+TC+EPKIRMNKVVRSNLRVRLGDV+SVHQC DVKYG RVH
Sbjct:    61 TILIKGKKRKDTVCIALADETCDEPKIRMNKVVRSNLRVRLGDVISVHQCPDVKYGNRVH 120

Query:   121 ILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCV 180
             ILP+DDTIEGV+GN+FDAYLKPYF EAYRPVRKGDLFLVRGGMRS+EFKVIETDP EYCV
Sbjct:   121 ILPLDDTIEGVSGNIFDAYLKPYFLEAYRPVRKGDLFLVRGGMRSIEFKVIETDPAEYCV 180

Query:   181 VAPDTEIFCEGEPVRREDENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVK 240
             VAPDTEIFCEGEP++REDE RLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVK
Sbjct:   181 VAPDTEIFCEGEPIKREDEERLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVK 240

Query:   241 PPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKN 300
             PPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKN
Sbjct:   241 PPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKN 300

Query:   301 APSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPA 360
             APSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIV+GATNRPNSIDPA
Sbjct:   301 APSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVMGATNRPNSIDPA 360

Query:   361 LRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCT 420
             LRRFGRFDREIDIGVPDE+GRLEVLRIHTKNMKL++DVDLER++KDTHGYVGADLAALCT
Sbjct:   361 LRRFGRFDREIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERVSKDTHGYVGADLAALCT 420

Query:   421 EAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNW 480
             EAALQCIREKMDVIDL+DE IDAEILNSMAV+++HF+TALG SNPSALRETVVEVPNV+W
Sbjct:   421 EAALQCIREKMDVIDLDDEEIDAEILNSMAVSNDHFQTALGNSNPSALRETVVEVPNVSW 480

Query:   481 EDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQ 540
             EDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQ
Sbjct:   481 EDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQ 540

Query:   541 ANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQ 589
             ANFIS+KGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQ
Sbjct:   541 ANFISIKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQ 589
GO:0005524 "ATP binding" evidence=ISS
GO:0005730 "nucleolus" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0005886 "plasma membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0005654 "nucleoplasm" evidence=IDA
GO:0045732 "positive regulation of protein catabolic process" evidence=IDA
TAIR|locus:2831844 AtCDC48C "cell division cycle 48C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085064 CDC48 "cell division cycle 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288065 cdcD "CDC48 family AAA ATPase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|P55072 VCP "Transitional endoplasmic reticulum ATPase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:99919 Vcp "valosin containing protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621595 Vcp "valosin-containing protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5408 vcp "valosin containing protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GL04 vcp "Transitional endoplasmic reticulum ATPase" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|G3X757 VCP "Transitional endoplasmic reticulum ATPase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q58556Y1156_METJANo assigned EC number0.53290.93220.6090yesno
P54609CD48A_ARATHNo assigned EC number0.94560.99660.7268nono
Q9SCN8CD48D_ARATHNo assigned EC number0.93880.99150.7177yesno
P46462TERA_RATNo assigned EC number0.80650.98470.7208yesno
Q3ZBT1TERA_BOVINNo assigned EC number0.80470.98470.7208yesno
O28972Y1297_ARCFUNo assigned EC number0.51870.93380.7517yesno
Q9P3A7CDC48_SCHPONo assigned EC number0.73950.97450.7055yesno
P55072TERA_HUMANNo assigned EC number0.80650.98470.7208yesno
Q01853TERA_MOUSENo assigned EC number0.80650.98470.7208yesno
Q5AWS6CDC48_EMENINo assigned EC number0.73670.98130.7035yesno
Q8SSJ5CDC48_ENCCUNo assigned EC number0.60340.97960.7410yesno
Q7KN62TERA_DROMENo assigned EC number0.76930.97960.7215yesno
Q96372CDC48_CAPANNo assigned EC number0.93540.95930.7031N/Ano
P54812TERA2_CAEELNo assigned EC number0.74190.99320.7234yesno
Q7ZU99TERA_DANRENo assigned EC number0.80240.98470.7208yesno
Q6GL04TERA_XENTRNo assigned EC number0.80650.98470.7217yesno
O05209VAT_THEACNo assigned EC number0.53600.83890.6644yesno
P54774CDC48_SOYBNNo assigned EC number0.95240.99320.7261nono
P25694CDC48_YEASTNo assigned EC number0.73550.96610.6826yesno
P23787TERA_XENLANo assigned EC number0.80650.98470.7217N/Ano
Q9LZF6CD48E_ARATHNo assigned EC number0.94900.99660.7259nono
P03974TERA_PIGNo assigned EC number0.80300.98470.7208yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00023232001
SubName- Full=Chromosome chr8 scaffold_29, whole genome shotgun sequence; (806 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00035970001
SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (309 aa)
    ••• 0.864
GSVIVG00025932001
SubName- Full=Chromosome chr12 scaffold_36, whole genome shotgun sequence; (302 aa)
    ••  0.827
GSVIVG00014044001
SubName- Full=Chromosome chr16 scaffold_10, whole genome shotgun sequence; (501 aa)
    ••• 0.811
GSVIVG00030573001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (474 aa)
     •  0.800
GSVIVG00023611001
SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (411 aa)
     •  0.800

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query590
TIGR01243 733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 0.0
COG0464 494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 1e-134
PRK03992389 PRK03992, PRK03992, proteasome-activating nucleoti 7e-98
COG1222406 COG1222, RPT1, ATP-dependent 26S proteasome regula 6e-97
TIGR01243733 TIGR01243, CDC48, AAA family ATPase, CDC48 subfami 4e-89
TIGR01242364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 8e-88
COG0464494 COG0464, SpoVK, ATPases of the AAA+ class [Posttra 2e-84
TIGR01241495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 2e-75
PTZ00361438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 7e-74
PTZ00454398 PTZ00454, PTZ00454, 26S protease regulatory subuni 2e-69
COG0465596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 3e-66
CHL00176638 CHL00176, ftsH, cell division protein; Validated 2e-64
pfam00004131 pfam00004, AAA, ATPase family associated with vari 8e-58
TIGR03689512 TIGR03689, pup_AAA, proteasome ATPase 7e-56
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 3e-54
COG1223368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 7e-53
PRK03992 389 PRK03992, PRK03992, proteasome-activating nucleoti 5e-44
COG1222 406 COG1222, RPT1, ATP-dependent 26S proteasome regula 3e-43
TIGR01242 364 TIGR01242, 26Sp45, 26S proteasome subunit P45 fami 3e-38
PTZ00454 398 PTZ00454, PTZ00454, 26S protease regulatory subuni 1e-34
TIGR03689 512 TIGR03689, pup_AAA, proteasome ATPase 3e-34
pfam00004131 pfam00004, AAA, ATPase family associated with vari 1e-32
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 4e-32
PTZ00361 438 PTZ00361, PTZ00361, 26 proteosome regulatory subun 3e-31
CHL00176 638 CHL00176, ftsH, cell division protein; Validated 4e-30
TIGR01241 495 TIGR01241, FtsH_fam, ATP-dependent metalloprotease 1e-28
COG1223 368 COG1223, COG1223, Predicted ATPase (AAA+ superfami 5e-26
pfam0235984 pfam02359, CDC48_N, Cell division protein 48 (CDC4 1e-23
PRK10733 644 PRK10733, hflB, ATP-dependent metalloprotease; Rev 3e-23
COG0465 596 COG0465, HflB, ATP-dependent Zn proteases [Posttra 1e-22
smart0107382 smart01073, CDC48_N, Cell division protein 48 (CDC 8e-21
smart00382148 smart00382, AAA, ATPases associated with a variety 1e-20
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a 1e-19
CHL00195489 CHL00195, ycf46, Ycf46; Provisional 2e-16
CHL00195 489 CHL00195, ycf46, Ycf46; Provisional 1e-13
smart00382148 smart00382, AAA, ATPases associated with a variety 3e-12
PRK13342413 PRK13342, PRK13342, recombination factor protein R 4e-12
smart0107264 smart01072, CDC48_2, Cell division protein 48 (CDC 6e-11
COG2256436 COG2256, MGS1, ATPase related to the helicase subu 8e-10
PRK13342 413 PRK13342, PRK13342, recombination factor protein R 5e-09
COG0714329 COG0714, COG0714, MoxR-like ATPases [General funct 3e-08
pfam0293361 pfam02933, CDC48_2, Cell division protein 48 (CDC4 4e-08
TIGR03922557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 4e-08
COG0542 786 COG0542, clpA, ATP-binding subunits of Clp proteas 8e-08
PRK13341 725 PRK13341, PRK13341, recombination factor protein R 8e-08
COG2255332 COG2255, RuvB, Holliday junction resolvasome, heli 1e-07
COG0593408 COG0593, DnaA, ATPase involved in DNA replication 2e-07
PRK00080328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 2e-07
TIGR00635305 TIGR00635, ruvB, Holliday junction DNA helicase, R 4e-07
COG2256 436 COG2256, MGS1, ATPase related to the helicase subu 5e-07
pfam07728135 pfam07728, AAA_5, AAA domain (dynein-related subfa 5e-07
PRK00080 328 PRK00080, ruvB, Holliday junction DNA helicase Ruv 1e-06
PHA02544316 PHA02544, 44, clamp loader, small subunit; Provisi 2e-06
pfam05496 231 pfam05496, RuvB_N, Holliday junction DNA helicase 3e-06
COG2255 332 COG2255, RuvB, Holliday junction resolvasome, heli 4e-06
TIGR00635 305 TIGR00635, ruvB, Holliday junction DNA helicase, R 6e-06
pfam13401124 pfam13401, AAA_22, AAA domain 6e-06
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 1e-05
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 2e-05
PRK04195 482 PRK04195, PRK04195, replication factor C large sub 3e-05
COG1484254 COG1484, DnaC, DNA replication protein [DNA replic 3e-05
TIGR03922 557 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPas 4e-05
TIGR00382413 TIGR00382, clpX, endopeptidase Clp ATP-binding reg 4e-05
COG1224450 COG1224, TIP49, DNA helicase TIP49, TBP-interactin 7e-05
pfam05496231 pfam05496, RuvB_N, Holliday junction DNA helicase 8e-05
COG1484254 COG1484, DnaC, DNA replication protein [DNA replic 9e-05
PRK13341 725 PRK13341, PRK13341, recombination factor protein R 2e-04
pfam06068395 pfam06068, TIP49, TIP49 C-terminus 2e-04
PRK05342412 PRK05342, clpX, ATP-dependent protease ATP-binding 3e-04
COG1219408 COG1219, ClpX, ATP-dependent protease Clp, ATPase 3e-04
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 4e-04
PRK08116268 PRK08116, PRK08116, hypothetical protein; Validate 4e-04
COG1474366 COG1474, CDC6, Cdc6-related protein, AAA superfami 4e-04
PRK06835329 PRK06835, PRK06835, DNA replication protein DnaC; 6e-04
pfam00910105 pfam00910, RNA_helicase, RNA helicase 9e-04
PRK08116268 PRK08116, PRK08116, hypothetical protein; Validate 0.001
pfam13207114 pfam13207, AAA_17, AAA domain 0.001
TIGR02881 261 TIGR02881, spore_V_K, stage V sporulation protein 0.003
pfam01078 207 pfam01078, Mg_chelatase, Magnesium chelatase, subu 0.003
pfam01057271 pfam01057, Parvo_NS1, Parvovirus non-structural pr 0.004
TIGR02639 730 TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi 0.004
COG1373398 COG1373, COG1373, Predicted ATPase (AAA+ superfami 0.004
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information 
 Score =  599 bits (1545), Expect = 0.0
 Identities = 295/563 (52%), Positives = 395/563 (70%), Gaps = 11/563 (1%)

Query: 30  RLVVDEAINDD--NSVVVLHPDTMEKLQFFRGDTILIKGKKRKDTVCIA-LADDTCEEPK 86
            L V EA   D    +V +   T  +L    GD + I+   R     +  L  D      
Sbjct: 3   ELRVAEAYPRDVGRGIVRIDRQTAARLGVEPGDFVEIEKGDRSVVAIVWPLRPDDEGRGI 62

Query: 87  IRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTE 146
           IRM+  +R+N  V +GD V+V + A+VK  K+V + P   T     G  F  Y+K +   
Sbjct: 63  IRMDGYLRANAGVTIGDTVTVER-AEVKEAKKVVLAP---TQPIRFGRDFVDYVKEFLLG 118

Query: 147 AYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPDTEIFCEGEPVRREDENRLDEVG 206
             +P+ KG+  +V     ++ F V+ T P  +  V   TE+    +PVR E E ++ +V 
Sbjct: 119 --KPISKGETVIVPVLEGALPFVVVSTQPAGFVYVTEATEVEIREKPVREEIERKVPKVT 176

Query: 207 YDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANET 266
           Y+D+GG+++   +IRE+VELP++HP+LF+ +G++PPKG+LLYGPPG+GKTL+A+AVANE 
Sbjct: 177 YEDIGGLKEAKEKIREMVELPMKHPELFEHLGIEPPKGVLLYGPPGTGKTLLAKAVANEA 236

Query: 267 GAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVER 326
           GA+F  INGPEIMSK  GESE  LR+ F+EAE+NAPSIIFIDEID+IAPKRE+  GEVE+
Sbjct: 237 GAYFISINGPEIMSKYYGESEERLREIFKEAEENAPSIIFIDEIDAIAPKREEVTGEVEK 296

Query: 327 RIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLR 386
           R+V+QLLTLMDGLK R  VIVIGATNRP+++DPALRR GRFDREI I VPD+  R E+L+
Sbjct: 297 RVVAQLLTLMDGLKGRGRVIVIGATNRPDALDPALRRPGRFDREIVIRVPDKRARKEILK 356

Query: 387 IHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDV--IDLEDETIDAE 444
           +HT+NM L++DVDL+++A+ THG+VGADLAAL  EAA+  +R  +    I+ E E I AE
Sbjct: 357 VHTRNMPLAEDVDLDKLAEVTHGFVGADLAALAKEAAMAALRRFIREGKINFEAEEIPAE 416

Query: 445 ILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKRELQETVQYPVEHP 504
           +L  + VT + F  AL    PSA+RE +VEVPNV W DIGGLE VK+EL+E V++P++HP
Sbjct: 417 VLKELKVTMKDFMEALKMVEPSAIREVLVEVPNVRWSDIGGLEEVKQELREAVEWPLKHP 476

Query: 505 EKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVR 564
           E FEK G+ P KGVL +GPPG GKTLLAKA+A E  ANFI+V+GPE+L+ W GESE  +R
Sbjct: 477 EIFEKMGIRPPKGVLLFGPPGTGKTLLAKAVATESGANFIAVRGPEILSKWVGESEKAIR 536

Query: 565 EIFDKARQSAPCVLFFDELDSIA 587
           EIF KARQ+AP ++FFDE+D+IA
Sbjct: 537 EIFRKARQAAPAIIFFDEIDAIA 559

This subfamily of the AAA family ATPases includes two members each from three archaeal species. It also includes yeast CDC48 (cell division control protein 48) and the human ortholog, transitional endoplasmic reticulum ATPase (valosin-containing protein). These proteins in eukaryotes are involved in the budding and transfer of membrane from the transitional endoplasmic reticulum to the Golgi apparatus. Length = 733
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233328 TIGR01243, CDC48, AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|179699 PRK03992, PRK03992, proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>gnl|CDD|224143 COG1222, RPT1, ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130309 TIGR01242, 26Sp45, 26S proteasome subunit P45 family Back     alignment and domain information
>gnl|CDD|240423 PTZ00454, PTZ00454, 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200312 TIGR03689, pup_AAA, proteasome ATPase Back     alignment and domain information
>gnl|CDD|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|185575 PTZ00361, PTZ00361, 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>gnl|CDD|214386 CHL00176, ftsH, cell division protein; Validated Back     alignment and domain information
>gnl|CDD|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH Back     alignment and domain information
>gnl|CDD|224144 COG1223, COG1223, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|216993 pfam02359, CDC48_N, Cell division protein 48 (CDC48), N-terminal domain Back     alignment and domain information
>gnl|CDD|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>gnl|CDD|223541 COG0465, HflB, ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215012 smart01073, CDC48_N, Cell division protein 48 (CDC48) N-terminal domain Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|177094 CHL00195, ycf46, Ycf46; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|215011 smart01072, CDC48_2, Cell division protein 48 (CDC48) domain 2 Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed Back     alignment and domain information
>gnl|CDD|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|202475 pfam02933, CDC48_2, Cell division protein 48 (CDC48), domain 2 Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|223616 COG0542, clpA, ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223666 COG0593, DnaA, ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|234619 PRK00080, ruvB, Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>gnl|CDD|222866 PHA02544, 44, clamp loader, small subunit; Provisional Back     alignment and domain information
>gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>gnl|CDD|222104 pfam13401, AAA_22, AAA domain Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|188437 TIGR03922, T7SS_EccA, type VII secretion AAA-ATPase EccA Back     alignment and domain information
>gnl|CDD|232949 TIGR00382, clpX, endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>gnl|CDD|224145 COG1224, TIP49, DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>gnl|CDD|203260 pfam05496, RuvB_N, Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>gnl|CDD|224401 COG1484, DnaC, DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|237354 PRK13341, PRK13341, recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>gnl|CDD|147949 pfam06068, TIP49, TIP49 C-terminus Back     alignment and domain information
>gnl|CDD|235422 PRK05342, clpX, ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>gnl|CDD|224140 COG1219, ClpX, ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|236153 PRK08116, PRK08116, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|224391 COG1474, CDC6, Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235871 PRK06835, PRK06835, DNA replication protein DnaC; Validated Back     alignment and domain information
>gnl|CDD|216186 pfam00910, RNA_helicase, RNA helicase Back     alignment and domain information
>gnl|CDD|236153 PRK08116, PRK08116, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|163057 TIGR02881, spore_V_K, stage V sporulation protein K Back     alignment and domain information
>gnl|CDD|144608 pfam01078, Mg_chelatase, Magnesium chelatase, subunit ChlI Back     alignment and domain information
>gnl|CDD|216270 pfam01057, Parvo_NS1, Parvovirus non-structural protein NS1 Back     alignment and domain information
>gnl|CDD|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|224292 COG1373, COG1373, Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 590
KOG0730 693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
KOG0736 953 consensus Peroxisome assembly factor 2 containing 100.0
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0735 952 consensus AAA+-type ATPase [Posttranslational modi 100.0
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 100.0
COG0464 494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
KOG0730693 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 100.0
KOG0736953 consensus Peroxisome assembly factor 2 containing 100.0
COG1223368 Predicted ATPase (AAA+ superfamily) [General funct 100.0
KOG0738491 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0728404 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0727408 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0726440 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0734752 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0735952 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 100.0
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 100.0
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 100.0
KOG0739439 consensus AAA+-type ATPase [Posttranslational modi 100.0
KOG0731774 consensus AAA+-type ATPase containing the peptidas 100.0
KOG0737386 consensus AAA+-type ATPase [Posttranslational modi 100.0
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 100.0
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 100.0
PRK03992389 proteasome-activating nucleotidase; Provisional 100.0
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 100.0
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational 100.0
CHL00195489 ycf46 Ycf46; Provisional 100.0
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 100.0
KOG0651388 consensus 26S proteasome regulatory complex, ATPas 100.0
TIGR01241495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 100.0
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 100.0
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 100.0
CHL00176638 ftsH cell division protein; Validated 99.98
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 99.97
COG1222 406 RPT1 ATP-dependent 26S proteasome regulatory subun 99.97
KOG0740428 consensus AAA+-type ATPase [Posttranslational modi 99.97
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.97
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 99.97
CHL00206 2281 ycf2 Ycf2; Provisional 99.97
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 99.96
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK 99.96
CHL00095 821 clpC Clp protease ATP binding subunit 99.96
KOG0727 408 consensus 26S proteasome regulatory complex, ATPas 99.94
CHL00195 489 ycf46 Ycf46; Provisional 99.94
KOG0739 439 consensus AAA+-type ATPase [Posttranslational modi 99.94
PRK10865 857 protein disaggregation chaperone; Provisional 99.94
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 99.94
KOG0729 435 consensus 26S proteasome regulatory complex, ATPas 99.93
KOG0738 491 consensus AAA+-type ATPase [Posttranslational modi 99.93
KOG0728 404 consensus 26S proteasome regulatory complex, ATPas 99.91
KOG0726 440 consensus 26S proteasome regulatory complex, ATPas 99.91
KOG0737 386 consensus AAA+-type ATPase [Posttranslational modi 99.9
KOG0652 424 consensus 26S proteasome regulatory complex, ATPas 99.89
KOG0734 752 consensus AAA+-type ATPase containing the peptidas 99.89
COG1223 368 Predicted ATPase (AAA+ superfamily) [General funct 99.89
PTZ00454 398 26S protease regulatory subunit 6B-like protein; P 99.88
KOG0731 774 consensus AAA+-type ATPase containing the peptidas 99.87
KOG0651 388 consensus 26S proteasome regulatory complex, ATPas 99.86
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 99.86
PRK03992 389 proteasome-activating nucleotidase; Provisional 99.86
PTZ00361 438 26 proteosome regulatory subunit 4-like protein; P 99.85
PLN00020 413 ribulose bisphosphate carboxylase/oxygenase activa 99.84
PF00004132 AAA: ATPase family associated with various cellula 99.84
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 99.82
KOG0740 428 consensus AAA+-type ATPase [Posttranslational modi 99.82
CHL00181287 cbbX CbbX; Provisional 99.81
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 99.8
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational 99.8
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.8
TIGR01242 364 26Sp45 26S proteasome subunit P45 family. Many pro 99.8
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 99.79
CHL00176 638 ftsH cell division protein; Validated 99.74
KOG0744423 consensus AAA+-type ATPase [Posttranslational modi 99.74
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 99.73
KOG0741 744 consensus AAA+-type ATPase [Posttranslational modi 99.73
KOG0743457 consensus AAA+-type ATPase [Posttranslational modi 99.71
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.71
KOG1051 898 consensus Chaperone HSP104 and related ATP-depende 99.71
CHL00206 2281 ycf2 Ycf2; Provisional 99.69
TIGR00763775 lon ATP-dependent protease La. This protein is ind 99.63
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 99.62
PF00004132 AAA: ATPase family associated with various cellula 99.62
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.62
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.6
COG2255332 RuvB Holliday junction resolvasome, helicase subun 99.6
COG2256436 MGS1 ATPase related to the helicase subunit of the 99.6
CHL00181 287 cbbX CbbX; Provisional 99.59
TIGR02881 261 spore_V_K stage V sporulation protein K. Members o 99.59
TIGR02880 284 cbbX_cfxQ probable Rubsico expression protein CbbX 99.58
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 99.54
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 99.54
PF0235987 CDC48_N: Cell division protein 48 (CDC48), N-termi 99.46
PRK04195 482 replication factor C large subunit; Provisional 99.45
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 99.45
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 99.43
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 99.43
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 99.43
PF05496 233 RuvB_N: Holliday junction DNA helicase ruvB N-term 99.42
PRK00149450 dnaA chromosomal replication initiation protein; R 99.42
PRK07940394 DNA polymerase III subunit delta'; Validated 99.42
TIGR02928365 orc1/cdc6 family replication initiation protein. M 99.41
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 99.41
TIGR00362405 DnaA chromosomal replication initiator protein Dna 99.41
PRK13342413 recombination factor protein RarA; Reviewed 99.4
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.39
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 99.39
KOG2028554 consensus ATPase related to the helicase subunit o 99.38
KOG0744 423 consensus AAA+-type ATPase [Posttranslational modi 99.37
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 99.37
TIGR00390441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.36
PLN03025319 replication factor C subunit; Provisional 99.36
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 99.36
PRK14088440 dnaA chromosomal replication initiation protein; P 99.35
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 99.34
PRK05201443 hslU ATP-dependent protease ATP-binding subunit Hs 99.34
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 99.33
PHA02544316 44 clamp loader, small subunit; Provisional 99.33
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 99.33
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 99.33
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 99.32
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 99.32
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 99.32
PTZ001121164 origin recognition complex 1 protein; Provisional 99.31
PRK06893229 DNA replication initiation factor; Validated 99.31
PRK12402337 replication factor C small subunit 2; Reviewed 99.3
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 99.3
PRK08084235 DNA replication initiation factor; Provisional 99.3
PRK08727233 hypothetical protein; Validated 99.29
PRK14086617 dnaA chromosomal replication initiation protein; P 99.29
PRK05342 412 clpX ATP-dependent protease ATP-binding subunit Cl 99.28
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 99.27
COG2255 332 RuvB Holliday junction resolvasome, helicase subun 99.27
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 99.27
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 99.26
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 99.26
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 99.26
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 99.26
PRK12422445 chromosomal replication initiation protein; Provis 99.25
TIGR00390 441 hslU ATP-dependent protease HslVU, ATPase subunit. 99.25
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 99.25
PRK08903227 DnaA regulatory inactivator Hda; Validated 99.23
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 99.23
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 99.23
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 99.23
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 99.23
PRK13341 725 recombination factor protein RarA/unknown domain f 99.22
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 99.22
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 99.21
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 99.21
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 99.21
TIGR00382 413 clpX endopeptidase Clp ATP-binding regulatory subu 99.2
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 99.2
PRK05642234 DNA replication initiation factor; Validated 99.19
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 99.19
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 99.19
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 99.19
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 99.18
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 99.18
COG2256 436 MGS1 ATPase related to the helicase subunit of the 99.16
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 99.16
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 99.16
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 99.16
PHA02244383 ATPase-like protein 99.15
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 99.15
PRK14087450 dnaA chromosomal replication initiation protein; P 99.14
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 99.14
PRK00440319 rfc replication factor C small subunit; Reviewed 99.13
COG1123 539 ATPase components of various ABC-type transport sy 99.12
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 99.12
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 99.1
COG0488 530 Uup ATPase components of ABC transporters with dup 99.1
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 99.09
PRK06620214 hypothetical protein; Validated 99.09
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 99.09
CHL00095 821 clpC Clp protease ATP binding subunit 99.09
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 99.08
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 99.08
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 99.08
smart00382148 AAA ATPases associated with a variety of cellular 99.07
COG0593408 DnaA ATPase involved in DNA replication initiation 99.06
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 99.06
KOG0927 614 consensus Predicted transporter (ABC superfamily) 99.06
KOG1969 877 consensus DNA replication checkpoint protein CHL12 99.06
COG1219 408 ClpX ATP-dependent protease Clp, ATPase subunit [P 99.04
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.02
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 99.02
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 99.01
PRK09087226 hypothetical protein; Validated 99.01
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 99.0
smart00382148 AAA ATPases associated with a variety of cellular 98.98
PRK09112351 DNA polymerase III subunit delta'; Validated 98.97
PRK11331459 5-methylcytosine-specific restriction enzyme subun 98.96
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.95
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.94
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.94
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 98.92
TIGR00635 305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.92
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Po 98.91
PRK10865 857 protein disaggregation chaperone; Provisional 98.91
COG0714329 MoxR-like ATPases [General function prediction onl 98.91
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 98.9
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.9
PRK05201 443 hslU ATP-dependent protease ATP-binding subunit Hs 98.9
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 98.89
PRK07471365 DNA polymerase III subunit delta'; Validated 98.88
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 98.88
COG4172 534 ABC-type uncharacterized transport system, duplica 98.88
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 98.87
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.86
PRK13342 413 recombination factor protein RarA; Reviewed 98.86
PRK05564313 DNA polymerase III subunit delta'; Validated 98.86
KOG0743 457 consensus AAA+-type ATPase [Posttranslational modi 98.85
TIGR02030337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 98.85
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 98.85
PRK07940 394 DNA polymerase III subunit delta'; Validated 98.85
KOG0745 564 consensus Putative ATP-dependent Clp-type protease 98.84
KOG0742 630 consensus AAA+-type ATPase [Posttranslational modi 98.84
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.83
KOG2004 906 consensus Mitochondrial ATP-dependent protease PIM 98.82
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 98.82
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 98.82
TIGR01650 327 PD_CobS cobaltochelatase, CobS subunit. This model 98.82
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 98.82
PF01078206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.82
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.82
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor t 98.81
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 98.8
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 98.8
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 98.79
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 98.79
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 98.79
PRK13531 498 regulatory ATPase RavA; Provisional 98.78
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 98.78
PRK10938 490 putative molybdenum transport ATP-binding protein 98.77
PRK04195 482 replication factor C large subunit; Provisional 98.77
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 98.77
COG0470325 HolB ATPase involved in DNA replication [DNA repli 98.77
PRK11147 635 ABC transporter ATPase component; Reviewed 98.76
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 98.76
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK 98.76
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 98.75
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 98.74
KOG0989 346 consensus Replication factor C, subunit RFC4 [Repl 98.74
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.73
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 98.73
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.73
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 98.72
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 98.72
PRK15064 530 ABC transporter ATP-binding protein; Provisional 98.72
PLN03025 319 replication factor C subunit; Provisional 98.72
KOG2028 554 consensus ATPase related to the helicase subunit o 98.71
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 98.71
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 98.71
PRK07399314 DNA polymerase III subunit delta'; Validated 98.71
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.71
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 98.7
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 98.7
PRK05707328 DNA polymerase III subunit delta'; Validated 98.7
PLN03073 718 ABC transporter F family; Provisional 98.69
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 98.69
PRK04132846 replication factor C small subunit; Provisional 98.68
PF07726131 AAA_3: ATPase family associated with various cellu 98.68
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 98.68
PRK08116268 hypothetical protein; Validated 98.67
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 98.65
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 98.65
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 98.64
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 98.64
PRK08058329 DNA polymerase III subunit delta'; Validated 98.63
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 98.63
PRK08181269 transposase; Validated 98.63
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 98.62
PHA02544 316 44 clamp loader, small subunit; Provisional 98.62
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 98.6
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 98.6
PRK13341 725 recombination factor protein RarA/unknown domain f 98.59
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 98.59
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 98.59
PRK13409 590 putative ATPase RIL; Provisional 98.58
PHA02244 383 ATPase-like protein 98.58
PRK10261 623 glutathione transporter ATP-binding protein; Provi 98.58
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 98.57
PRK06526254 transposase; Provisional 98.57
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 98.57
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.56
PRK09183259 transposase/IS protein; Provisional 98.56
PRK09302 509 circadian clock protein KaiC; Reviewed 98.56
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 98.55
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 98.55
PRK12402 337 replication factor C small subunit 2; Reviewed 98.55
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 98.55
PF13173128 AAA_14: AAA domain 98.55
COG1221403 PspF Transcriptional regulators containing an AAA- 98.54
PRK11608326 pspF phage shock protein operon transcriptional ac 98.54
PRK15424538 propionate catabolism operon regulatory protein Pr 98.54
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 98.54
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 98.53
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 98.53
TIGR02974329 phageshock_pspF psp operon transcriptional activat 98.53
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 98.53
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 98.52
KOG0745564 consensus Putative ATP-dependent Clp-type protease 98.51
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 98.51
PRK12377248 putative replication protein; Provisional 98.51
COG3829560 RocR Transcriptional regulator containing PAS, AAA 98.51
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.5
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 98.5
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 98.5
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 98.5
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 98.5
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.49
KOG0066 807 consensus eIF2-interacting protein ABC50 (ABC supe 98.49
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.48
PRK06921266 hypothetical protein; Provisional 98.46
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis 98.46
PRK06835329 DNA replication protein DnaC; Validated 98.45
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.44
COG0714 329 MoxR-like ATPases [General function prediction onl 98.44
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 98.44
PRK06871325 DNA polymerase III subunit delta'; Validated 98.44
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 98.44
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 98.43
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 98.43
smart00350509 MCM minichromosome maintenance proteins. 98.43
PRK07952244 DNA replication protein DnaC; Validated 98.42
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 98.42
TIGR03420 226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.41
PRK05022509 anaerobic nitric oxide reductase transcription reg 98.4
PRK11331 459 5-methylcytosine-specific restriction enzyme subun 98.4
TIGR01817534 nifA Nif-specific regulatory protein. This model r 98.4
PRK00149 450 dnaA chromosomal replication initiation protein; R 98.4
TIGR02329526 propionate_PrpR propionate catabolism operon regul 98.4
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.4
PRK06964342 DNA polymerase III subunit delta'; Validated 98.39
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 98.39
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 98.39
COG2204464 AtoC Response regulator containing CheY-like recei 98.39
PF07726131 AAA_3: ATPase family associated with various cellu 98.38
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 98.38
PF01078 206 Mg_chelatase: Magnesium chelatase, subunit ChlI; I 98.38
TIGR02031 589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 98.37
PRK09862506 putative ATP-dependent protease; Provisional 98.37
KOG1969 877 consensus DNA replication checkpoint protein CHL12 98.36
PRK07993334 DNA polymerase III subunit delta'; Validated 98.36
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 98.35
TIGR00362 405 DnaA chromosomal replication initiator protein Dna 98.34
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 98.34
PF06068 398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.34
PRK07952244 DNA replication protein DnaC; Validated 98.34
PRK08769319 DNA polymerase III subunit delta'; Validated 98.33
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 98.33
PRK08181269 transposase; Validated 98.33
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 98.33
PRK14088 440 dnaA chromosomal replication initiation protein; P 98.32
PRK08939306 primosomal protein DnaI; Reviewed 98.32
PRK06893 229 DNA replication initiation factor; Validated 98.32
KOG0062 582 consensus ATPase component of ABC transporters wit 98.32
PRK06851367 hypothetical protein; Provisional 98.31
PRK09183259 transposase/IS protein; Provisional 98.31
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 98.3
KOG2035351 consensus Replication factor C, subunit RFC3 [Cell 98.3
COG1126240 GlnQ ABC-type polar amino acid transport system, A 98.3
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 98.3
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein 98.3
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 98.29
cd03216163 ABC_Carb_Monos_I This family represents the domain 98.29
TIGR02237209 recomb_radB DNA repair and recombination protein R 98.29
PRK00440 319 rfc replication factor C small subunit; Reviewed 98.29
PRK08699325 DNA polymerase III subunit delta'; Validated 98.29
TIGR02902 531 spore_lonB ATP-dependent protease LonB. Members of 98.28
COG4619223 ABC-type uncharacterized transport system, ATPase 98.28
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 98.28
COG0606490 Predicted ATPase with chaperone activity [Posttran 98.28
KOG1514767 consensus Origin recognition complex, subunit 1, a 98.26
PRK00411 394 cdc6 cell division control protein 6; Reviewed 98.26
PRK06090319 DNA polymerase III subunit delta'; Validated 98.26
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 98.26
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.25
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.25
PF05729166 NACHT: NACHT domain 98.25
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 98.25
PRK12377248 putative replication protein; Provisional 98.23
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 98.22
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 98.22
PRK08116268 hypothetical protein; Validated 98.22
PRK12422 445 chromosomal replication initiation protein; Provis 98.22
PF13173128 AAA_14: AAA domain 98.22
PRK13531 498 regulatory ATPase RavA; Provisional 98.2
PRK06526254 transposase; Provisional 98.2
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 98.2
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 98.2
PRK08903 227 DnaA regulatory inactivator Hda; Validated 98.2
COG1136226 SalX ABC-type antimicrobial peptide transport syst 98.19
COG3842352 PotA ABC-type spermidine/putrescine transport syst 98.19
PRK08939306 primosomal protein DnaI; Reviewed 98.19
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 98.19
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 98.18
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 98.18
CHL00081 350 chlI Mg-protoporyphyrin IX chelatase 98.17
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 98.17
COG2884223 FtsE Predicted ATPase involved in cell division [C 98.16
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 98.16
PRK14086 617 dnaA chromosomal replication initiation protein; P 98.16
KOG2227529 consensus Pre-initiation complex, subunit CDC6, AA 98.16
PF05673 249 DUF815: Protein of unknown function (DUF815); Inte 98.16
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 98.16
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 98.16
PF06068398 TIP49: TIP49 C-terminus; InterPro: IPR010339 This 98.16
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 98.15
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 98.14
PF12774231 AAA_6: Hydrolytic ATP binding site of dynein motor 98.13
COG5245 3164 DYN1 Dynein, heavy chain [Cytoskeleton] 98.12
KOG1942456 consensus DNA helicase, TBP-interacting protein [R 98.12
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 98.12
TIGR02012321 tigrfam_recA protein RecA. This model describes or 98.12
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 98.11
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.11
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 98.1
PRK06921266 hypothetical protein; Provisional 98.1
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 98.1
KOG3595 1395 consensus Dyneins, heavy chain [Cytoskeleton] 98.1
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 98.09
PTZ00112 1164 origin recognition complex 1 protein; Provisional 98.09
cd03246173 ABCC_Protease_Secretion This family represents the 98.09
COG1484254 DnaC DNA replication protein [DNA replication, rec 98.08
PRK08084 235 DNA replication initiation factor; Provisional 98.08
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.07
cd00983325 recA RecA is a bacterial enzyme which has roles in 98.07
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 98.06
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 98.06
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 98.05
KOG1051898 consensus Chaperone HSP104 and related ATP-depende 98.05
COG0470 325 HolB ATPase involved in DNA replication [DNA repli 98.04
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 98.04
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 98.04
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 98.03
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 98.03
PRK09361225 radB DNA repair and recombination protein RadB; Pr 98.01
COG1119257 ModF ABC-type molybdenum transport system, ATPase 98.01
PRK06835329 DNA replication protein DnaC; Validated 98.0
PRK05564 313 DNA polymerase III subunit delta'; Validated 97.99
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.99
PRK08727 233 hypothetical protein; Validated 97.99
PRK08533230 flagellar accessory protein FlaH; Reviewed 97.99
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 97.98
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 97.98
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.98
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 97.97
KOG0990360 consensus Replication factor C, subunit RFC5 [Repl 97.97
PF03152176 UFD1: Ubiquitin fusion degradation protein UFD1; I 97.97
COG4525259 TauB ABC-type taurine transport system, ATPase com 97.96
PRK05642 234 DNA replication initiation factor; Validated 97.95
PRK08118167 topology modulation protein; Reviewed 97.95
COG1618179 Predicted nucleotide kinase [Nucleotide transport 97.95
TIGR00368 499 Mg chelatase-related protein. The N-terminal end m 97.94
PRK14087 450 dnaA chromosomal replication initiation protein; P 97.94
PRK06620214 hypothetical protein; Validated 97.93
KOG0991 333 consensus Replication factor C, subunit RFC2 [Repl 97.93
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 97.91
PRK09376 416 rho transcription termination factor Rho; Provisio 97.91
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 97.9
COG1117253 PstB ABC-type phosphate transport system, ATPase c 97.9
TIGR02030 337 BchI-ChlI magnesium chelatase ATPase subunit I. Th 97.9
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 97.89
PRK11823446 DNA repair protein RadA; Provisional 97.88
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.88
PRK00131175 aroK shikimate kinase; Reviewed 97.87
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 97.87
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 97.86
PF12774 231 AAA_6: Hydrolytic ATP binding site of dynein motor 97.86
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 97.86
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 97.85
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 97.85
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 97.85
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 97.85
PRK07261171 topology modulation protein; Provisional 97.84
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 97.84
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.84
cd03216163 ABC_Carb_Monos_I This family represents the domain 97.83
cd01131 198 PilT Pilus retraction ATPase PilT. PilT is a nucle 97.83
PRK07471 365 DNA polymerase III subunit delta'; Validated 97.83
PTZ00111915 DNA replication licensing factor MCM4; Provisional 97.82
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.82
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 97.82
PF00308 219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 97.82
KOG2680454 consensus DNA helicase TIP49, TBP-interacting prot 97.81
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.81
COG1127263 Ttg2A ABC-type transport system involved in resist 97.8
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 97.8
PRK06067234 flagellar accessory protein FlaH; Validated 97.79
PRK09354349 recA recombinase A; Provisional 97.79
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.79
cd01394218 radB RadB. The archaeal protein radB shares simila 97.79
PHA00729 226 NTP-binding motif containing protein 97.79
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 97.78
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 97.78
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=1.3e-94  Score=751.40  Aligned_cols=540  Identities=61%  Similarity=1.015  Sum_probs=500.9

Q ss_pred             CcchhHHhhhcCCCCeEEEccccCCCCcEEEECHHHHHhcCCCCCCEEEEeccCCceEEEEEEcCCCCCCCeEEeCHHHH
Q 007764           15 RDFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTMEKLQFFRGDTILIKGKKRKDTVCIALADDTCEEPKIRMNKVVR   94 (590)
Q Consensus        15 ~~~~~~~~~~~~~~~~~~v~~~~~~~~~~v~~~~~~~~~l~~~~g~~v~i~~~~~~~~~~~~~~~~~~~~~~i~~~~~~r   94 (590)
                      .+.+++|+..+.-+|.+.|.. .+++.+.+.+++..|..+++..|  |.+.|+++...++.+..++. ....+.+....|
T Consensus         2 ~~~~~~~~~~~~~~~~~~v~~-~~~~~~~~~~~~~~~~~~~l~~g--~~~~g~~~~~~~~~~~~~~~-~~~~~~~~~~~r   77 (693)
T KOG0730|consen    2 ESPSTAILPVKCPQNNLVVLS-INDDASVVVLSEGAMDKLGLLRG--VLLDGKKRREPVDAVVQDET-SELIGRQTMVSR   77 (693)
T ss_pred             CcccccccccccCCCCeEEec-CCCccchheecHHHHhhhcCCcc--eEEECccccCCccceeccCC-ccccchhhheec
Confidence            367899999988888999987 45556699999999999999999  99999876666655444444 778899999999


Q ss_pred             hhccccCCCeEEEEEccccCCCceEEeccccccccCcchhhHHHHhhHHhhhcCCcccCCcEEEEeecceeEEEEEEEeC
Q 007764           95 SNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETD  174 (590)
Q Consensus        95 ~~~~~~~~~~v~i~~~~~~~~a~~v~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~g~~~~~~~~~~~~~~~v~~~~  174 (590)
                      .++.++.|+.|.++.++.+..+..+.+.|+..+..++....++.+.+.|+...++++..|+++   .....+.|+++...
T Consensus        78 ~~l~~~~~~~~~~~~~p~v~~~~~i~~l~~~~~~~~i~~~~~d~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~~~~  154 (693)
T KOG0730|consen   78 SNLRLQLGRLLHSSDCPSVKRPARIAVLPVDDTSEGIAGELFDVLERPFLLEALRPLVKGDTF---AGLNPAEFKVLELD  154 (693)
T ss_pred             cchhhcccceecccCCCCccccceeeeeehhhccccchhhhhhhhhhhhhhhhhCccccccch---hhhhhhhhhccccc
Confidence            999999999999999888888888999999988888888888899999999999999889887   44456678888887


Q ss_pred             CCCeEEecCCceEEecCCCccccccccCCCCCcccccchHHHHHHHHHHHHcccCChhhhhhhCCCCCceEEEECCCCCc
Q 007764          175 PPEYCVVAPDTEIFCEGEPVRREDENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSG  254 (590)
Q Consensus       175 ~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~i~G~~~~~~~l~~~~~~~~~~~~~~~~l~i~~~~~vLL~GppGtG  254 (590)
                      |..  ++.++|.+.+.+++..+.... ..+++ .++||+..++..+++++.+|+++|.++..+|+++++++|+|||||||
T Consensus       155 ~~~--~v~~~t~~~~~~~~~~~~~~~-~~~~~-~~~gg~~~~~~~i~e~v~~pl~~~~~~~s~g~~~prg~Ll~gppg~G  230 (693)
T KOG0730|consen  155 PSP--QVTPDTELSYLGEPAKREEEE-LPEVG-DDIGGLKRQLSVIRELVELPLRHPALFKSIGIKPPRGLLLYGPPGTG  230 (693)
T ss_pred             cch--hcCccchhhhcCCCccccccc-ccccc-cccchhHHHHHHHHHHHHhhhcchhhhhhcCCCCCCCccccCCCCCC
Confidence            766  788899998888887765444 46778 89999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHhCCeEEEEechhhhhhccchhHHHHHHHHHHHHhcC-CeEEEEcccccccCCCCCCchhHHHHHHHHHH
Q 007764          255 KTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNA-PSIIFIDEIDSIAPKREKTHGEVERRIVSQLL  333 (590)
Q Consensus       255 KTtla~~la~~~~~~~~~v~~~~l~~~~~g~~~~~~~~~f~~a~~~~-p~iL~iDEid~l~~~~~~~~~~~~~~v~~~Ll  333 (590)
                      ||.+++++|++.++.++.+++++++.++.|++++.+|..|+++...+ |+++||||+|.+++++....+ +++|+..||+
T Consensus       231 kt~l~~aVa~e~~a~~~~i~~peli~k~~gEte~~LR~~f~~a~k~~~psii~IdEld~l~p~r~~~~~-~e~Rv~sqll  309 (693)
T KOG0730|consen  231 KTFLVRAVANEYGAFLFLINGPELISKFPGETESNLRKAFAEALKFQVPSIIFIDELDALCPKREGADD-VESRVVSQLL  309 (693)
T ss_pred             hHHHHHHHHHHhCceeEecccHHHHHhcccchHHHHHHHHHHHhccCCCeeEeHHhHhhhCCcccccch-HHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999 999999999999999987666 8899999999


Q ss_pred             HhhhccccCCeEEEEeecCCCCCCchhhhccCCCceEEEecCCCHHHHHHHHHHHhcCCCCCCccCHHHHHHhcCCCCHH
Q 007764          334 TLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGA  413 (590)
Q Consensus       334 ~~ld~~~~~~~v~vI~~tn~~~~ld~al~r~gRf~~~i~i~~P~~~~r~~Il~~~~~~~~~~~~~~l~~la~~t~g~~~~  413 (590)
                      ++||++....+++++++||+|+.||++++| |||++++++..|+..+|.+|++.+++.+.+.++.++..+|..+|||+|+
T Consensus       310 tL~dg~~~~~~vivl~atnrp~sld~alRR-gRfd~ev~IgiP~~~~RldIl~~l~k~~~~~~~~~l~~iA~~thGyvGa  388 (693)
T KOG0730|consen  310 TLLDGLKPDAKVIVLAATNRPDSLDPALRR-GRFDREVEIGIPGSDGRLDILRVLTKKMNLLSDVDLEDIAVSTHGYVGA  388 (693)
T ss_pred             HHHhhCcCcCcEEEEEecCCccccChhhhc-CCCcceeeecCCCchhHHHHHHHHHHhcCCcchhhHHHHHHHccchhHH
Confidence            999999999999999999999999999999 9999999999999999999999999999999889999999999999999


Q ss_pred             HHHHHHHHHHHHHHHhcccccccchhhhhHHHhhhhhccHHHHHhhhcCCCCCcccccccccCCcccccccccchhhhcc
Q 007764          414 DLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLENVKREL  493 (590)
Q Consensus       414 dl~~l~~~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~v~~~~~~~al~~~~p~~~~~~~~~~~~v~~~~iggl~~vk~~L  493 (590)
                      |+.++|++|++.+.++                      +.++|..|+..++|+++|+..+++|+++|+||||++++|++|
T Consensus       389 DL~~l~~ea~~~~~r~----------------------~~~~~~~A~~~i~psa~Re~~ve~p~v~W~dIGGlE~lK~el  446 (693)
T KOG0730|consen  389 DLAALCREASLQATRR----------------------TLEIFQEALMGIRPSALREILVEMPNVSWDDIGGLEELKREL  446 (693)
T ss_pred             HHHHHHHHHHHHHhhh----------------------hHHHHHHHHhcCCchhhhheeccCCCCChhhccCHHHHHHHH
Confidence            9999999999988765                      567899999999999999999999999999999999999999


Q ss_pred             cceeecccCChhhhhhcCCCCCceeEEECCCCCChhHHHHHHHHHhCCcEEEEeccchhhhhccchHHHHHHHHHHHhhC
Q 007764          494 QETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQS  573 (590)
Q Consensus       494 ~~~v~~~~~~~~~~~~~~~~~~~gvLL~GppGtGKTtLAkalA~~~~~~~i~v~~~el~~~~vGese~~ir~~f~~Ar~~  573 (590)
                      ++.|+||++|++.|.++|++|++|||||||||||||++||++|+++++||++|+||||++||||+||++||++|++||+.
T Consensus       447 q~~V~~p~~~pe~F~r~Gi~ppkGVLlyGPPGC~KT~lAkalAne~~~nFlsvkgpEL~sk~vGeSEr~ir~iF~kAR~~  526 (693)
T KOG0730|consen  447 QQAVEWPLKHPEKFARFGISPPKGVLLYGPPGCGKTLLAKALANEAGMNFLSVKGPELFSKYVGESERAIREVFRKARQV  526 (693)
T ss_pred             HHHHhhhhhchHHHHHhcCCCCceEEEECCCCcchHHHHHHHhhhhcCCeeeccCHHHHHHhcCchHHHHHHHHHHHhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCeEEEEccccccccc
Q 007764          574 APCVLFFDELDSIATQ  589 (590)
Q Consensus       574 ~p~vlf~DEid~l~~~  589 (590)
                      +||||||||||+++.+
T Consensus       527 aP~IiFfDEiDsi~~~  542 (693)
T KOG0730|consen  527 APCIIFFDEIDALAGS  542 (693)
T ss_pred             CCeEEehhhHHhHhhc
Confidence            9999999999999864

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02359 CDC48_N: Cell division protein 48 (CDC48), N-terminal domain; InterPro: IPR003338 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>PRK04132 replication factor C small subunit; Provisional Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1514 consensus Origin recognition complex, subunit 1, and related proteins [Replication, recombination and repair] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>KOG2227 consensus Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase [Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] Back     alignment and domain information
>KOG1942 consensus DNA helicase, TBP-interacting protein [Replication, recombination and repair] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3595 consensus Dyneins, heavy chain [Cytoskeleton] Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK05564 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair] Back     alignment and domain information
>PF03152 UFD1: Ubiquitin fusion degradation protein UFD1; InterPro: IPR004854 Post-translational ubiquitin-protein conjugates are recognised for degradation by the ubiquitin fusion degradation (UFD) pathway Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG2680 consensus DNA helicase TIP49, TBP-interacting protein [Transcription] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query590
1r7r_A 816 The Crystal Structure Of Murine P97VCP AT 3.6A Leng 0.0
3cf1_A 806 Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Len 0.0
3hu2_A489 Structure Of P97 N-D1 R86a Mutant In Complex With A 0.0
3hu2_A 489 Structure Of P97 N-D1 R86a Mutant In Complex With A 8e-28
3hu3_A489 Structure Of P97 N-D1 R155h Mutant In Complex With 0.0
3hu3_A 489 Structure Of P97 N-D1 R155h Mutant In Complex With 8e-28
3hu1_A489 Structure Of P97 N-D1 R95g Mutant In Complex With A 0.0
3hu1_A 489 Structure Of P97 N-D1 R95g Mutant In Complex With A 8e-28
1e32_A458 Structure Of The N-Terminal Domain And The D1 Aaa D 0.0
1e32_A 458 Structure Of The N-Terminal Domain And The D1 Aaa D 1e-27
3qwz_A211 Crystal Structure Of Faf1 Ubx-P97n-Domain Complex L 2e-85
2pjh_B193 Strctural Model Of The P97 N Domain- Npl4 Ubd Compl 6e-83
3qq7_A186 Crystal Structure Of The P97 N-Terminal Domain Leng 7e-78
3tiw_A187 Crystal Structure Of P97n In Complex With The C-Ter 1e-77
3qc8_A178 Crystal Structure Of Faf1 Ubx Domain In Complex Wit 3e-76
3h4m_A285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 2e-71
3h4m_A 285 Aaa Atpase Domain Of The Proteasome- Activating Nuc 6e-33
3cf0_A 301 Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH 2e-64
4b4t_J405 Near-Atomic Resolution Structural Model Of The Yeas 2e-55
4b4t_J 405 Near-Atomic Resolution Structural Model Of The Yeas 2e-28
4b4t_I437 Near-Atomic Resolution Structural Model Of The Yeas 4e-55
4b4t_I 437 Near-Atomic Resolution Structural Model Of The Yeas 1e-27
4b4t_L437 Near-Atomic Resolution Structural Model Of The Yeas 1e-54
4b4t_L 437 Near-Atomic Resolution Structural Model Of The Yeas 6e-26
2ce7_A476 Edta Treated Length = 476 9e-53
2ce7_A 476 Edta Treated Length = 476 9e-22
4b4t_H467 Near-Atomic Resolution Structural Model Of The Yeas 2e-52
4b4t_H 467 Near-Atomic Resolution Structural Model Of The Yeas 2e-28
3kds_E465 Apo-ftsh Crystal Structure Length = 465 4e-52
3kds_E 465 Apo-ftsh Crystal Structure Length = 465 4e-21
2x8a_A274 Human Nuclear Valosin Containing Protein Like (Nvl) 4e-51
2x8a_A 274 Human Nuclear Valosin Containing Protein Like (Nvl) 7e-37
4b4t_M434 Near-Atomic Resolution Structural Model Of The Yeas 3e-49
4b4t_M 434 Near-Atomic Resolution Structural Model Of The Yeas 2e-24
1lv7_A257 Crystal Structure Of The Aaa Domain Of Ftsh Length 4e-49
1lv7_A 257 Crystal Structure Of The Aaa Domain Of Ftsh Length 3e-23
2r62_A268 Crystal Structure Of Helicobacter Pylori Atp Depend 7e-49
2r62_A 268 Crystal Structure Of Helicobacter Pylori Atp Depend 2e-22
4b4t_K428 Near-Atomic Resolution Structural Model Of The Yeas 1e-48
4b4t_K 428 Near-Atomic Resolution Structural Model Of The Yeas 1e-29
2qz4_A262 Human Paraplegin, Aaa Domain In Complex With Adp Le 4e-43
2qz4_A 262 Human Paraplegin, Aaa Domain In Complex With Adp Le 6e-23
2dhr_A499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 4e-43
2dhr_A 499 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-20
4eiw_A508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 6e-43
4eiw_A 508 Whole Cytosolic Region Of Atp-Dependent Metalloprot 2e-20
1iy2_A278 Crystal Structure Of The Ftsh Atpase Domain From Th 8e-43
1iy2_A 278 Crystal Structure Of The Ftsh Atpase Domain From Th 2e-20
1ixz_A254 Crystal Structure Of The Ftsh Atpase Domain From Th 9e-43
1ixz_A 254 Crystal Structure Of The Ftsh Atpase Domain From Th 1e-20
3d8b_A357 Crystal Structure Of Human Fidgetin-Like Protein 1 4e-42
3d8b_A 357 Crystal Structure Of Human Fidgetin-Like Protein 1 1e-23
2rko_A331 Crystal Structure Of The Vps4p-Dimer Length = 331 8e-41
2rko_A 331 Crystal Structure Of The Vps4p-Dimer Length = 331 2e-27
2qp9_X355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 1e-40
2qp9_X 355 Crystal Structure Of S.Cerevisiae Vps4 Length = 355 1e-26
3eie_A322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 1e-40
3eie_A 322 Crystal Structure Of S.Cerevisiae Vps4 In The So4-B 2e-26
3eih_A340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 2e-40
3eih_A 340 Crystal Structure Of S.Cerevisiae Vps4 In The Prese 2e-26
2zam_A444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 1e-38
2zam_A 444 Crystal Structure Of Mouse Skd1VPS4B APO-Form Lengt 2e-24
1xwi_A322 Crystal Structure Of Vps4b Length = 322 1e-37
1xwi_A 322 Crystal Structure Of Vps4b Length = 322 2e-24
3b9p_A297 Spastin Length = 297 3e-37
3b9p_A 297 Spastin Length = 297 1e-21
3vfd_A389 Human Spastin Aaa Domain Length = 389 4e-36
3vfd_A 389 Human Spastin Aaa Domain Length = 389 2e-19
1ixs_B318 Structure Of Ruvb Complexed With Ruva Domain Iii Le 4e-07
1ixs_B 318 Structure Of Ruvb Complexed With Ruva Domain Iii Le 5e-04
1ixr_C312 Ruva-Ruvb Complex Length = 312 4e-07
1ixr_C 312 Ruva-Ruvb Complex Length = 312 4e-04
1hqc_A324 Structure Of Ruvb From Thermus Thermophilus Hb8 Len 5e-07
1hqc_A 324 Structure Of Ruvb From Thermus Thermophilus Hb8 Len 5e-04
2krk_A86 Solution Nmr Structure Of 26s Protease Regulatory S 8e-07
1ofh_A310 Asymmetric Complex Between Hslv And I-domain Delete 2e-06
3kw6_A78 Crystal Structure Of A Domain Of 26s Proteasome Reg 7e-06
4a3v_B95 Yeast Regulatory Particle Proteasome Assembly Chape 1e-04
3u5z_B324 Structure Of T4 Bacteriophage Clamp Loader Bound To 3e-04
1nsf_A273 D2 Hexamerization Domain Of N-Ethylmaleimide Sensit 3e-04
1d2n_A272 D2 Domain Of N-Ethylmaleimide-Sensitive Fusion Prot 3e-04
1in4_A 334 Thermotoga Maritima Ruvb Holliday Junction Branch M 5e-04
1in8_A 334 Thermotoga Maritima Ruvb T158v Length = 334 5e-04
1j7k_A 334 Thermotoga Maritima Ruvb P216g Mutant Length = 334 5e-04
1in5_A 334 Thermogota Maritima Ruvb A156s Mutant Length = 334 5e-04
1in7_A 334 Thermotoga Maritima Ruvb R170a Length = 334 5e-04
>pdb|1R7R|A Chain A, The Crystal Structure Of Murine P97VCP AT 3.6A Length = 816 Back     alignment and structure 
Iteration: 1

 Score = 1002 bits (2591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/584 (80%), Positives = 536/584 (91%), Gaps = 3/584 (0%)
Query: 5   AESSDAKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTMEKLQFFRGDTILI 64
           A  +D+KG   D STAIL++K  PNRL+VDEAIN+DNSVV L    M++LQ FRGDT+L+
Sbjct: 2   ASGADSKGD--DLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLL 59
Query: 65  KGKKRKDTVCIALADDTCEEPKIRMNKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPV 124
           KGKKR++ VCI L+DDTC + KIRMN+VVR+NLRVRLGDV+S+  C DVKYGKR+H+LP+
Sbjct: 60  KGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPI 119
Query: 125 DDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFKVIETDPPEYCVVAPD 184
           DDT+EG+TGNLF+ YLKPYF EAYRP+RKGD+FLVRGGMR+VEFKV+ETDP  YC+VAPD
Sbjct: 120 DDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPD 179
Query: 185 TEIFCEGEPVRREDENR-LDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPK 243
           T I CEGEP++REDE   L+EVGYDDVGG RKQ+AQI+E+VELPLRHP LFK+IGVKPP+
Sbjct: 180 TVIHCEGEPIKREDEEESLNEVGYDDVGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPR 239
Query: 244 GILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPS 303
           GILLYGPPG+GKTLIARAVANETGAFFF INGPEIMSKLAGESESNLRKAFEEAEKNAP+
Sbjct: 240 GILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPA 299
Query: 304 IIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRR 363
           IIFIDE+D+IAPKREKTHGEVERRIVSQLLTLMDGLK RAHVIV+ ATNRPNSIDPALRR
Sbjct: 300 IIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRR 359
Query: 364 FGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAA 423
           FGRFDRE+DIG+PD  GRLE+L+IHTKNMKL+DDVDLE++A +THG+VGADLAALC+EAA
Sbjct: 360 FGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAA 419
Query: 424 LQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDI 483
           LQ IR+KMD+IDLEDETIDAE++NS+AVT + F+ AL  SNPSALRETVVEVP V WEDI
Sbjct: 420 LQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDI 479
Query: 484 GGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANF 543
           GGLE+VKRELQE VQYPVEHP+KF KFGM+PSKGVLFYGPPGCGKTLLAKAIANECQANF
Sbjct: 480 GGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANF 539
Query: 544 ISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIA 587
           IS+KGPELLTMWFGESEANVREIFDKARQ+APCVLFFDELDSIA
Sbjct: 540 ISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIA 583
>pdb|3CF1|A Chain A, Structure Of P97VCP IN COMPLEX WITH ADPADP.ALFX Length = 806 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU2|A Chain A, Structure Of P97 N-D1 R86a Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU3|A Chain A, Structure Of P97 N-D1 R155h Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|3HU1|A Chain A, Structure Of P97 N-D1 R95g Mutant In Complex With Atpgs Length = 489 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|1E32|A Chain A, Structure Of The N-Terminal Domain And The D1 Aaa Domain Of Membrane Fusion Atpase P97 Length = 458 Back     alignment and structure
>pdb|3QWZ|A Chain A, Crystal Structure Of Faf1 Ubx-P97n-Domain Complex Length = 211 Back     alignment and structure
>pdb|2PJH|B Chain B, Strctural Model Of The P97 N Domain- Npl4 Ubd Complex Length = 193 Back     alignment and structure
>pdb|3QQ7|A Chain A, Crystal Structure Of The P97 N-Terminal Domain Length = 186 Back     alignment and structure
>pdb|3TIW|A Chain A, Crystal Structure Of P97n In Complex With The C-Terminus Of Gp78 Length = 187 Back     alignment and structure
>pdb|3QC8|A Chain A, Crystal Structure Of Faf1 Ubx Domain In Complex With P97VCP N DOMAIN Reveals The Conserved Fcisp Touch-Turn Motif Of Ubx Domain Suffering Conformational Change Length = 178 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3H4M|A Chain A, Aaa Atpase Domain Of The Proteasome- Activating Nucleotidase Length = 285 Back     alignment and structure
>pdb|3CF0|A Chain A, Structure Of D2 Subdomain Of P97VCP IN COMPLEX WITH ADP Length = 301 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|I Chain I, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|4B4T|L Chain L, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 437 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|2CE7|A Chain A, Edta Treated Length = 476 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|4B4T|H Chain H, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 467 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|3KDS|E Chain E, Apo-ftsh Crystal Structure Length = 465 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|2X8A|A Chain A, Human Nuclear Valosin Containing Protein Like (Nvl), C- Terminal Aaa-Atpase Domain Length = 274 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|4B4T|M Chain M, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 434 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|1LV7|A Chain A, Crystal Structure Of The Aaa Domain Of Ftsh Length = 257 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|2R62|A Chain A, Crystal Structure Of Helicobacter Pylori Atp Dependent Protease, Ftsh Length = 268 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|4B4T|K Chain K, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 428 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|2QZ4|A Chain A, Human Paraplegin, Aaa Domain In Complex With Adp Length = 262 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|2DHR|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 499 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|4EIW|A Chain A, Whole Cytosolic Region Of Atp-Dependent Metalloprotease Ftsh (G399l) Length = 508 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|1IY2|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 278 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|1IXZ|A Chain A, Crystal Structure Of The Ftsh Atpase Domain From Thermus Thermophilus Length = 254 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|3D8B|A Chain A, Crystal Structure Of Human Fidgetin-Like Protein 1 In Complex With Adp Length = 357 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|2RKO|A Chain A, Crystal Structure Of The Vps4p-Dimer Length = 331 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|2QP9|X Chain X, Crystal Structure Of S.Cerevisiae Vps4 Length = 355 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|3EIE|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The So4-Bound State Length = 322 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|3EIH|A Chain A, Crystal Structure Of S.Cerevisiae Vps4 In The Presence Of Atpgammas Length = 340 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|2ZAM|A Chain A, Crystal Structure Of Mouse Skd1VPS4B APO-Form Length = 444 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|1XWI|A Chain A, Crystal Structure Of Vps4b Length = 322 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|3B9P|A Chain A, Spastin Length = 297 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|3VFD|A Chain A, Human Spastin Aaa Domain Length = 389 Back     alignment and structure
>pdb|1IXS|B Chain B, Structure Of Ruvb Complexed With Ruva Domain Iii Length = 318 Back     alignment and structure
>pdb|1IXS|B Chain B, Structure Of Ruvb Complexed With Ruva Domain Iii Length = 318 Back     alignment and structure
>pdb|1IXR|C Chain C, Ruva-Ruvb Complex Length = 312 Back     alignment and structure
>pdb|1IXR|C Chain C, Ruva-Ruvb Complex Length = 312 Back     alignment and structure
>pdb|1HQC|A Chain A, Structure Of Ruvb From Thermus Thermophilus Hb8 Length = 324 Back     alignment and structure
>pdb|1HQC|A Chain A, Structure Of Ruvb From Thermus Thermophilus Hb8 Length = 324 Back     alignment and structure
>pdb|2KRK|A Chain A, Solution Nmr Structure Of 26s Protease Regulatory Subunit 8 From H.Sapiens, Northeast Structural Genomics Consortium Target Target Hr3102a Length = 86 Back     alignment and structure
>pdb|1OFH|A Chain A, Asymmetric Complex Between Hslv And I-domain Deleted Hslu (h. Influenzae) Length = 310 Back     alignment and structure
>pdb|3KW6|A Chain A, Crystal Structure Of A Domain Of 26s Proteasome Regulatory Subunit 8 From Homo Sapiens. Northeast Structural Genomics Consortium Target Id Hr3102a Length = 78 Back     alignment and structure
>pdb|4A3V|B Chain B, Yeast Regulatory Particle Proteasome Assembly Chaperone Hsm3 In Complex With Rpt1 C-Terminal Fragment Length = 95 Back     alignment and structure
>pdb|3U5Z|B Chain B, Structure Of T4 Bacteriophage Clamp Loader Bound To The T4 Clamp, Primer-Template Dna, And Atp Analog Length = 324 Back     alignment and structure
>pdb|1NSF|A Chain A, D2 Hexamerization Domain Of N-Ethylmaleimide Sensitive Factor (Nsf) Length = 273 Back     alignment and structure
>pdb|1D2N|A Chain A, D2 Domain Of N-Ethylmaleimide-Sensitive Fusion Protein Length = 272 Back     alignment and structure
>pdb|1IN4|A Chain A, Thermotoga Maritima Ruvb Holliday Junction Branch Migration Motor Length = 334 Back     alignment and structure
>pdb|1IN8|A Chain A, Thermotoga Maritima Ruvb T158v Length = 334 Back     alignment and structure
>pdb|1J7K|A Chain A, Thermotoga Maritima Ruvb P216g Mutant Length = 334 Back     alignment and structure
>pdb|1IN5|A Chain A, Thermogota Maritima Ruvb A156s Mutant Length = 334 Back     alignment and structure
>pdb|1IN7|A Chain A, Thermotoga Maritima Ruvb R170a Length = 334 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query590
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 0.0
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-131
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 0.0
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 1e-51
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 1e-132
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 1e-55
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 1e-122
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 3e-87
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 1e-119
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 5e-84
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 5e-98
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 6e-68
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 2e-97
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 7e-62
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 3e-97
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 1e-54
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 8e-96
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 3e-38
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 8e-95
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 3e-53
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 9e-93
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 8e-58
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 7e-91
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 1e-59
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 6e-89
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 3e-54
3qwz_A211 Transitional endoplasmic reticulum ATPase; UBX, P9 5e-83
3tiw_A187 Transitional endoplasmic reticulum ATPase; beta-ba 2e-78
2r62_A268 Cell division protease FTSH homolog; ATPase domain 1e-76
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 2e-28
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 7e-76
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 6e-29
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 7e-76
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 8e-29
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 1e-75
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 2e-28
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 3e-75
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 1e-28
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 1e-72
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 1e-24
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 6e-72
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 6e-25
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 2e-70
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 5e-44
1cz4_A185 VCP-like ATPase; double-PSI beta-barrel, beta-CLAM 1e-51
2krk_A86 26S protease regulatory subunit 8; structural geno 7e-25
3kw6_A78 26S protease regulatory subunit 8; structural geno 1e-23
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 5e-21
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 6e-21
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 4e-19
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 7e-19
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 3e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-12
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 5e-15
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 1e-09
2yuj_A190 Ubiquitin fusion degradation 1-like; ubiquitin-dep 8e-14
3pvs_A447 Replication-associated recombination protein A; ma 6e-11
3pvs_A 447 Replication-associated recombination protein A; ma 5e-09
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 3e-10
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 7e-08
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 2e-09
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 1e-08
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 2e-07
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 2e-05
2qgz_A308 Helicase loader, putative primosome component; str 5e-07
2qgz_A308 Helicase loader, putative primosome component; str 1e-05
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 7e-07
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 8e-07
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 1e-06
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 5e-06
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 2e-06
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 2e-06
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 4e-05
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 4e-06
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 4e-05
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 4e-06
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 3e-05
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 7e-06
3co5_A143 Putative two-component system transcriptional RES 3e-05
2v1u_A387 Cell division control protein 6 homolog; DNA repli 3e-05
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 6e-05
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 8e-05
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 1e-04
2chg_A 226 Replication factor C small subunit; DNA-binding pr 2e-04
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 3e-04
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 3e-04
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 3e-04
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 5e-04
2chq_A 319 Replication factor C small subunit; DNA-binding pr 3e-04
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 4e-04
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 4e-04
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 5e-04
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 8e-04
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Length = 285 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Length = 301 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Length = 274 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Length = 322 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Length = 297 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Length = 357 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Length = 389 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Length = 355 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Length = 444 Back     alignment and structure
>3qwz_A Transitional endoplasmic reticulum ATPase; UBX, P97 binding, transport protein; HET: MLY; 2.00A {Homo sapiens} PDB: 2pjh_B Length = 211 Back     alignment and structure
>3tiw_A Transitional endoplasmic reticulum ATPase; beta-barrel alpha-helix, transport protein ATPase ubiquitin ubiquitin, phosphorylation; 1.80A {Homo sapiens} PDB: 3qq8_A 3qq7_A 3qc8_A Length = 187 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Length = 268 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Length = 262 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Length = 278 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Length = 254 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Length = 257 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Length = 476 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Length = 499 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293 Back     alignment and structure
>1cz4_A VCP-like ATPase; double-PSI beta-barrel, beta-CLAM, substrate recognition DOM hydrolase; NMR {Thermoplasma acidophilum} SCOP: b.52.2.3 d.31.1.1 PDB: 1cz5_A Length = 185 Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Length = 78 Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Length = 88 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Length = 83 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Length = 82 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456 Back     alignment and structure
>2yuj_A Ubiquitin fusion degradation 1-like; ubiquitin-dependent proteolytic, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 190 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Length = 310 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 384 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Length = 180 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Length = 412 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Length = 389 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Length = 324 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Length = 386 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Length = 202 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Length = 338 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Length = 338 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Length = 334 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Length = 334 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Length = 199 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Length = 143 Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Length = 387 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Length = 377 Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Length = 178 Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Length = 500 Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Length = 226 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Length = 253 Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Length = 350 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Length = 319 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Length = 327 Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Length = 376 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Length = 363 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query590
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 100.0
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 100.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 100.0
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 100.0
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 100.0
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 100.0
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 100.0
3cf2_A806 TER ATPase, transitional endoplasmic reticulum ATP 100.0
3qwz_A211 Transitional endoplasmic reticulum ATPase; UBX, P9 100.0
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 100.0
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 100.0
3tiw_A187 Transitional endoplasmic reticulum ATPase; beta-ba 100.0
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 100.0
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 100.0
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 100.0
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 100.0
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 100.0
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.98
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.97
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.97
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.97
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 99.97
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.97
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.97
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.97
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 99.96
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.96
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 99.96
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.96
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 99.96
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 99.96
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 99.95
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 99.95
2r62_A268 Cell division protease FTSH homolog; ATPase domain 99.95
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 99.95
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.95
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 99.95
1cz4_A185 VCP-like ATPase; double-PSI beta-barrel, beta-CLAM 99.91
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.9
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 99.9
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 99.88
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 99.87
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 99.86
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 99.84
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.83
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 99.83
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.81
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 99.8
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 99.78
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 99.78
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 99.78
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 99.77
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 99.77
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 99.77
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 99.77
1wlf_A179 PEX1, peroxisome biogenesis factor 1; N-terminal d 99.76
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 99.75
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.75
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 99.73
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 99.72
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 99.72
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 99.71
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.7
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.69
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 99.69
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 99.69
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.68
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 99.68
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 99.67
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 99.65
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.65
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 99.64
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 99.64
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.62
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 99.61
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 99.6
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 99.6
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 99.59
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.57
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 99.57
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 99.55
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 99.55
2v1u_A387 Cell division control protein 6 homolog; DNA repli 99.53
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 99.53
2chg_A226 Replication factor C small subunit; DNA-binding pr 99.53
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 99.52
3bos_A242 Putative DNA replication factor; P-loop containing 99.52
3pvs_A447 Replication-associated recombination protein A; ma 99.51
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 99.49
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 99.49
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 99.48
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 99.47
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 99.46
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 99.46
2r44_A331 Uncharacterized protein; putative ATPase, structur 99.45
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 99.43
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 99.43
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 99.43
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 99.42
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 99.41
2chq_A319 Replication factor C small subunit; DNA-binding pr 99.41
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 99.41
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 99.41
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 99.4
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 99.4
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.37
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 99.34
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 99.33
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 99.32
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 99.3
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 99.3
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 99.28
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 99.27
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 99.26
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 99.26
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 99.25
3co5_A143 Putative two-component system transcriptional RES 99.25
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.25
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 99.22
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 99.21
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 99.21
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 99.18
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 99.18
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.15
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 99.11
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 99.07
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 99.06
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 99.06
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 99.05
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 99.03
3pvs_A 447 Replication-associated recombination protein A; ma 99.02
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 99.02
3co5_A143 Putative two-component system transcriptional RES 98.99
2gno_A305 DNA polymerase III, gamma subunit-related protein; 98.98
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 98.96
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 98.94
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 98.93
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 98.91
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.91
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 98.91
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 98.9
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.89
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.88
2krk_A86 26S protease regulatory subunit 8; structural geno 98.87
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.84
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 98.83
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 98.83
3kw6_A78 26S protease regulatory subunit 8; structural geno 98.8
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 98.79
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 98.77
2chg_A 226 Replication factor C small subunit; DNA-binding pr 98.75
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 98.74
3vlf_B88 26S protease regulatory subunit 7 homolog; heat re 98.69
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 98.68
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.67
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.67
2qen_A350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.67
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.66
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 98.66
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.65
2chq_A 319 Replication factor C small subunit; DNA-binding pr 98.65
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 98.65
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 98.63
1ojl_A 304 Transcriptional regulatory protein ZRAR; response 98.63
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 98.62
2fna_A357 Conserved hypothetical protein; structural genomic 98.62
3aji_B83 S6C, proteasome (prosome, macropain) 26S subunit, 98.61
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 98.61
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 98.6
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 98.59
3bos_A 242 Putative DNA replication factor; P-loop containing 98.58
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.57
2r44_A 331 Uncharacterized protein; putative ATPase, structur 98.57
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 98.55
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 98.54
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 98.5
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.5
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 98.49
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 98.49
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.48
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 98.48
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 98.48
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 98.46
2qgz_A308 Helicase loader, putative primosome component; str 98.43
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 98.41
1cr5_A189 SEC18P (residues 22 - 210); double-PSI beta barrel 98.4
1qcs_A211 N-ethylmaleimide sensitive factor (NSF-N); double- 98.4
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 98.39
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 98.38
2qgz_A308 Helicase loader, putative primosome component; str 98.36
2jv2_A83 Putative uncharacterized protein PH1500; AAA ATPas 98.32
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.29
2dzn_B82 26S protease regulatory subunit 6B homolog; ankyri 98.27
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 98.25
1tue_A212 Replication protein E1; helicase, replication, E1E 98.25
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 98.21
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 98.21
1ye8_A 178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.19
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.18
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 98.18
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.13
2yuj_A190 Ubiquitin fusion degradation 1-like; ubiquitin-dep 98.07
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 98.07
1zc1_A208 Ubiquitin fusion degradation protein 1; UFD1, doub 98.06
1tue_A212 Replication protein E1; helicase, replication, E1E 98.06
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.06
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.04
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 98.02
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 98.02
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 97.99
2eyu_A 261 Twitching motility protein PILT; pilus retraction 97.98
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 97.96
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.96
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.96
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 97.95
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.94
1xp8_A366 RECA protein, recombinase A; recombination, radior 97.94
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 97.94
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.93
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 97.93
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 97.92
2z43_A324 DNA repair and recombination protein RADA; archaea 97.92
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 97.9
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 97.89
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 97.89
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 97.87
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 97.87
1n0w_A 243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.87
1u94_A356 RECA protein, recombinase A; homologous recombinat 97.85
2cvh_A 220 DNA repair and recombination protein RADB; filamen 97.84
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 97.83
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.82
2w0m_A 235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 97.82
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 97.81
3io5_A333 Recombination and repair protein; storage dimer, i 97.8
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 97.8
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 97.79
2fna_A 357 Conserved hypothetical protein; structural genomic 97.78
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 97.78
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 97.78
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.78
4a74_A 231 DNA repair and recombination protein RADA; hydrola 97.77
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 97.77
1g6h_A257 High-affinity branched-chain amino acid transport 97.76
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 97.75
3f8t_A506 Predicted ATPase involved in replication control, 97.75
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 97.74
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.72
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 97.72
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 97.69
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 97.68
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.67
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 97.67
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 97.66
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPa 97.66
1zp6_A 191 Hypothetical protein ATU3015; alpha-beta protein., 97.66
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 97.66
1z6t_A591 APAF-1, apoptotic protease activating factor 1; ca 97.66
2i3b_A 189 HCR-ntpase, human cancer-related ntpase; AAA, ross 97.64
2ewv_A 372 Twitching motility protein PILT; pilus retraction 97.62
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 97.62
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 97.61
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 97.6
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 97.59
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 97.59
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 97.58
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 97.58
3trf_A 185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.58
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 97.58
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.58
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.57
1b0u_A262 Histidine permease; ABC transporter, transport pro 97.56
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.55
1xp8_A 366 RECA protein, recombinase A; recombination, radior 97.54
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 97.54
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 97.54
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 97.53
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 97.53
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 97.53
2ghi_A260 Transport protein; multidrug resistance protein, M 97.52
1ji0_A240 ABC transporter; ATP binding protein, structural g 97.51
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 97.51
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.5
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.49
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.48
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 97.48
1u94_A 356 RECA protein, recombinase A; homologous recombinat 97.47
2rhm_A 193 Putative kinase; P-loop containing nucleoside trip 97.47
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.45
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 97.45
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.43
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 97.43
1via_A175 Shikimate kinase; structural genomics, transferase 97.42
2z43_A 324 DNA repair and recombination protein RADA; archaea 97.4
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 97.4
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.4
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.39
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 a 97.39
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.39
2r6a_A454 DNAB helicase, replicative helicase; replication, 97.37
3a4m_A 260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.37
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.37
2ewv_A372 Twitching motility protein PILT; pilus retraction 97.36
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 97.36
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.34
2ze6_A 253 Isopentenyl transferase; crown GALL tumor, cytokin 97.32
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.31
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.31
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.31
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.31
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 97.31
3cm0_A 186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.3
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.3
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 97.29
2iyv_A 184 Shikimate kinase, SK; transferase, aromatic amino 97.29
1aky_A 220 Adenylate kinase; ATP:AMP phosphotransferase, myok 97.29
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.28
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.28
2dr3_A 247 UPF0273 protein PH0284; RECA superfamily ATPase, h 97.27
3sr0_A 206 Adenylate kinase; phosphoryl transfer analogue, AL 97.27
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.26
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.25
2a5y_B549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 97.24
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.24
2cdn_A 201 Adenylate kinase; phosphoryl transfer, associative 97.23
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.23
2c95_A 196 Adenylate kinase 1; transferase, AP4A, nucleotide 97.23
3lw7_A 179 Adenylate kinase related protein (ADKA-like); AMP, 97.22
3t61_A 202 Gluconokinase; PSI-biology, structural genomics, p 97.22
1tev_A 196 UMP-CMP kinase; ploop, NMP binding region, LID reg 97.21
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 97.21
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 97.21
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 97.21
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 97.21
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 97.2
1vma_A306 Cell division protein FTSY; TM0570, structural gen 97.19
3be4_A 217 Adenylate kinase; malaria, cryptosporidium parvum 97.19
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.19
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 97.19
1zd8_A 227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 97.19
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 97.19
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 97.18
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.18
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.17
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 97.17
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 97.16
1qf9_A 194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 97.16
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 97.16
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.15
1ak2_A 233 Adenylate kinase isoenzyme-2; nucleoside monophosp 97.14
1kht_A 192 Adenylate kinase; phosphotransferase, signaling pr 97.14
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 97.14
1cke_A 227 CK, MSSA, protein (cytidine monophosphate kinase); 97.14
2vli_A 183 Antibiotic resistance protein; transferase, tunica 97.14
3dl0_A 216 Adenylate kinase; phosphotransferase, zinc coordin 97.13
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.13
3io5_A 333 Recombination and repair protein; storage dimer, i 97.12
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.12
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 97.12
3fb4_A 216 Adenylate kinase; psychrophIle, phosphotransferase 97.11
1via_A175 Shikimate kinase; structural genomics, transferase 97.11
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 97.11
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 97.1
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 97.1
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.1
2bwj_A 199 Adenylate kinase 5; phosphoryl transfer reaction, 97.1
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 97.09
1ly1_A 181 Polynucleotide kinase; PNK, phosphatase, transfera 97.08
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 97.07
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 97.07
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 97.07
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 97.06
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.06
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.06
2bbw_A 246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 97.05
1ukz_A 203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.05
1zak_A 222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.05
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 97.05
3tr0_A 205 Guanylate kinase, GMP kinase; purines, pyrimidines 97.05
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 97.02
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 97.02
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 97.02
4e22_A 252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.01
2if2_A 204 Dephospho-COA kinase; alpha-beta protein, structur 96.99
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 96.98
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 96.98
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 96.98
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.98
3c8u_A 208 Fructokinase; YP_612366.1, putative fructose trans 96.98
1jjv_A 206 Dephospho-COA kinase; P-loop nucleotide-binding fo 96.98
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 96.98
1z6g_A 218 Guanylate kinase; structural genomics, SGC, struct 96.98
1e4v_A 214 Adenylate kinase; transferase(phosphotransferase); 96.97
2jaq_A 205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.97
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.97
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.96
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.96
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 96.96
3asz_A 211 Uridine kinase; cytidine phosphorylation, transfer 96.96
1znw_A 207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.96
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.95
2xb4_A 223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.94
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.94
2j41_A 207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.94
2v54_A 204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.94
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 96.93
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 96.93
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.92
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 96.92
3crm_A 323 TRNA delta(2)-isopentenylpyrophosphate transferase 96.91
1m7g_A 211 Adenylylsulfate kinase; APS kinase, transferase, s 96.91
1lvg_A 198 Guanylate kinase, GMP kinase; transferase; HET: AD 96.9
1b0u_A 262 Histidine permease; ABC transporter, transport pro 96.9
2ga8_A 359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 96.9
3r20_A 233 Cytidylate kinase; structural genomics, seattle st 96.9
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 96.9
2pbr_A 195 DTMP kinase, thymidylate kinase; transferase, nucl 96.9
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 96.89
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.89
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.88
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.88
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.88
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.88
2z0h_A 197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.87
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.86
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.86
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 96.86
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 96.86
1nks_A 194 Adenylate kinase; thermophilic, transferase; HET: 96.86
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 96.86
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.85
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 96.85
2jeo_A 245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.85
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 96.83
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.83
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 96.83
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 96.82
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 96.82
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.81
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.8
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 96.8
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 96.8
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 96.8
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 96.79
2bdt_A 189 BH3686; alpha-beta protein, structural genomics, P 96.79
1p9r_A418 General secretion pathway protein E; bacterial typ 96.79
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.78
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 96.78
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 96.78
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 96.78
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 96.77
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 96.77
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 96.76
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.76
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 96.76
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 96.76
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.75
2wwf_A 212 Thymidilate kinase, putative; transferase, malaria 96.75
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.75
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 96.75
1nn5_A 215 Similar to deoxythymidylate kinase (thymidylate K; 96.75
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.75
2plr_A 213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.75
3a00_A 186 Guanylate kinase, GMP kinase; domain movement, dim 96.74
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.74
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.74
1sgw_A 214 Putative ABC transporter; structural genomics, P p 96.73
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 96.73
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 96.73
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.73
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.73
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.72
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.72
3ake_A 208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.72
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 96.72
2grj_A 192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 96.72
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 96.71
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 96.71
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 96.71
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 96.71
1ji0_A 240 ABC transporter; ATP binding protein, structural g 96.69
1g6h_A 257 High-affinity branched-chain amino acid transport 96.69
1p9r_A 418 General secretion pathway protein E; bacterial typ 96.69
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 96.68
2qt1_A 207 Nicotinamide riboside kinase 1; non-protein kinase 96.68
3tau_A 208 Guanylate kinase, GMP kinase; structural genomics, 96.68
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 96.68
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 96.68
1q3t_A 236 Cytidylate kinase; nucleotide monophosphate kinase 96.67
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 96.67
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.67
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 96.67
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 96.67
1jr3_D343 DNA polymerase III, delta subunit; processivity, p 96.67
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 96.66
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 96.66
3lnc_A 231 Guanylate kinase, GMP kinase; ALS collaborative cr 96.66
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 96.65
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
Probab=100.00  E-value=1.1e-106  Score=906.07  Aligned_cols=580  Identities=81%  Similarity=1.302  Sum_probs=536.2

Q ss_pred             ccCCCCcchhHHhhhcCCCCeEEEccccCCCCcEEEECHHHHHhcCCCCCCEEEEeccCCceEEEEEEcCCCCCCCeEEe
Q 007764           10 AKGTKRDFSTAILERKKAPNRLVVDEAINDDNSVVVLHPDTMEKLQFFRGDTILIKGKKRKDTVCIALADDTCEEPKIRM   89 (590)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~v~~~~~~~~~l~~~~g~~v~i~~~~~~~~~~~~~~~~~~~~~~i~~   89 (590)
                      +..++.+++|||++.++.||+|+|+++.++++++|+|+|++|++||+.+||+|+|+|++++.+++|++++++++.+.|+|
T Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~d~~~~~~~~~~~~~l~~~~gd~v~i~g~~~~~~~~~~~~~~~~~~~~i~~   84 (806)
T 3cf2_A            5 ADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRM   84 (806)
T ss_dssp             ----------------CCTTEEECBCCSSCCTTEEEECHHHHHHTTCCSSCEEEEECGGGCBCCEEEEECTTSBTTBCEE
T ss_pred             cCCCCCCchhhhhhccCCCceEEEccCCCCCCCEEEECHHHHHHcCCCCCCEEEEEcCCCceEEEEEcCCCCCCCCEEEe
Confidence            44455689999999999999999999988899999999999999999999999999999889999999999999999999


Q ss_pred             CHHHHhhccccCCCeEEEEEccccCCCceEEeccccccccCcchhhHHHHhhHHhhhcCCcccCCcEEEEeecceeEEEE
Q 007764           90 NKVVRSNLRVRLGDVVSVHQCADVKYGKRVHILPVDDTIEGVTGNLFDAYLKPYFTEAYRPVRKGDLFLVRGGMRSVEFK  169 (590)
Q Consensus        90 ~~~~r~~~~~~~~~~v~i~~~~~~~~a~~v~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~g~~~~~~~~~~~~~~~  169 (590)
                      ++.+|+|+|+++||.|+|+++..+++|++|++.|+..+.....+..+..++++||...++||..||+|.+...+..+.|+
T Consensus        85 ~~~~r~n~~v~~gd~V~v~~~~~~~~a~~v~l~p~~~~~~~~~~~~~~~~l~~~~~~~~~~v~~gd~~~v~~~~~~~~f~  164 (806)
T 3cf2_A           85 NRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFK  164 (806)
T ss_dssp             CHHHHHTTTCCTTCEEEEEECCCCCBCSBEEEEEBTTTSTTCCSCHHHHTHHHHHTTTCCEEETTCEEEECCTTSCEEEE
T ss_pred             CHHHHHhcCCCCCCEEEEEECCCCCcCCEEEEeccccchhccchhHHHHHHHHHHHhcCCcccCCCEEEEecCCcEEEEE
Confidence            99999999999999999999878899999999999887777777888899999998888999999999999888899999


Q ss_pred             EEEeCCCCeEEecCCceEEecCCCccccc-cccCCCCCcccccchHHHHHHHHHHHHcccCChhhhhhhCCCCCceEEEE
Q 007764          170 VIETDPPEYCVVAPDTEIFCEGEPVRRED-ENRLDEVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLY  248 (590)
Q Consensus       170 v~~~~~~~~~~~~~~t~~~~~~~~~~~~~-~~~~~~~~~~~i~G~~~~~~~l~~~~~~~~~~~~~~~~l~i~~~~~vLL~  248 (590)
                      |++++|.++++++++|.|.+.+.|..+.. ....+.++|+||||+++++++|++++.+|+++|++|..+|+.++++||||
T Consensus       165 V~~~~P~~~~~v~~~T~i~~~~~~~~~~~~~~~~~~v~~~dIgGl~~~~~~l~e~v~~pl~~p~~f~~~g~~~p~GILL~  244 (806)
T 3cf2_A          165 VVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLY  244 (806)
T ss_dssp             EEEESSSSEEECCTTSBCCBCSCCBCCCTTSCCSSSCCGGGCCSCCTTHHHHHHHHHHHHHCCGGGTSCCCCCCCEEEEE
T ss_pred             EEEEeCCCCeEECCCcEEEEeccccCcccccccCCCCChhhhcCHHHHHHHHHHHHHHHccCHHHHhhcCCCCCCeEEEE
Confidence            99999999999999999998887765432 33568899999999999999999999999999999999999999999999


Q ss_pred             CCCCCcHHHHHHHHHHHhCCeEEEEechhhhhhccchhHHHHHHHHHHHHhcCCeEEEEcccccccCCCCCCchhHHHHH
Q 007764          249 GPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRI  328 (590)
Q Consensus       249 GppGtGKTtla~~la~~~~~~~~~v~~~~l~~~~~g~~~~~~~~~f~~a~~~~p~iL~iDEid~l~~~~~~~~~~~~~~v  328 (590)
                      ||||||||+||+++|++++.+++.++++++.+++.|+++..++.+|+.|+...|+||||||+|.++++++...++..+++
T Consensus       245 GPPGTGKT~LAraiA~elg~~~~~v~~~~l~sk~~gese~~lr~lF~~A~~~~PsIIfIDEiDal~~~r~~~~~~~~~ri  324 (806)
T 3cf2_A          245 GPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRI  324 (806)
T ss_dssp             CCTTSCHHHHHHHHHTTTTCEEEEEEHHHHHSSCTTHHHHHHHHHHHHHTTSCSEEEEEESGGGTCCTTTTCCCTTHHHH
T ss_pred             CCCCCCHHHHHHHHHHHhCCeEEEEEhHHhhcccchHHHHHHHHHHHHHHHcCCeEEEEehhcccccccCCCCChHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999988888888999


Q ss_pred             HHHHHHhhhccccCCeEEEEeecCCCCCCchhhhccCCCceEEEecCCCHHHHHHHHHHHhcCCCCCCccCHHHHHHhcC
Q 007764          329 VSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTH  408 (590)
Q Consensus       329 ~~~Ll~~ld~~~~~~~v~vI~~tn~~~~ld~al~r~gRf~~~i~i~~P~~~~r~~Il~~~~~~~~~~~~~~l~~la~~t~  408 (590)
                      +++|+.+|+++..+.+|+||++||+++.+|++++|+|||+++|+++.|+..+|.+||+.+++++.+..++++..+|..|+
T Consensus       325 v~~LL~~mdg~~~~~~V~VIaaTN~~d~LD~ALrR~GRFd~~I~i~~Pd~~~R~~IL~~~l~~~~~~~dvdl~~lA~~T~  404 (806)
T 3cf2_A          325 VSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETH  404 (806)
T ss_dssp             HHHHHTHHHHCCGGGCEEEEEECSSTTTSCTTTTSTTSSCEEEECCCCCHHHHHHHHHHTCSSSEECTTCCHHHHHHHCC
T ss_pred             HHHHHHHHhcccccCCEEEEEecCChhhcCHHHhCCcccceEEecCCCCHHHHHHHHHHHhcCCCCCcccCHHHHHHhcC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHHHHHhcccccccchhhhhHHHhhhhhccHHHHHhhhcCCCCCcccccccccCCcccccccccch
Q 007764          409 GYVGADLAALCTEAALQCIREKMDVIDLEDETIDAEILNSMAVTDEHFKTALGTSNPSALRETVVEVPNVNWEDIGGLEN  488 (590)
Q Consensus       409 g~~~~dl~~l~~~a~~~~~~~~~~~~~~~~~~i~~~~~~~~~v~~~~~~~al~~~~p~~~~~~~~~~~~v~~~~iggl~~  488 (590)
                      ||+|+|+..+|.+|++.++++..+.+...+.....+......++.+||..|+....|+.+++..++.|+++|+++||+++
T Consensus       405 GfsgaDL~~Lv~eA~~~A~~r~~~~i~~~~~~~~~e~~~~~~v~~~Df~~Al~~~~ps~~r~~~~~~p~v~w~diggl~~  484 (806)
T 3cf2_A          405 GHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLED  484 (806)
T ss_dssp             SCCHHHHHHHHHHHHHHHHHHHHHHGGGTCCCCSHHHHHHCEECTTHHHHHHSSSSCCCCCCCCCBCCCCCSTTCCSCHH
T ss_pred             CCCHHHHHHHHHHHHHHHHHhccccccccccccchhhhccceeeHHHHHHHHHhCCCcccccccccCCCCCHHHhCCHHH
Confidence            99999999999999999999887766666666666666778899999999999999999999999999999999999999


Q ss_pred             hhhcccceeecccCChhhhhhcCCCCCceeEEECCCCCChhHHHHHHHHHhCCcEEEEeccchhhhhccchHHHHHHHHH
Q 007764          489 VKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFD  568 (590)
Q Consensus       489 vk~~L~~~v~~~~~~~~~~~~~~~~~~~gvLL~GppGtGKTtLAkalA~~~~~~~i~v~~~el~~~~vGese~~ir~~f~  568 (590)
                      +|+.|++.+.||+.+++.|.++++++++|+|||||||||||++||++|++++.+|+.+++++++++|+|+||+++|++|+
T Consensus       485 ~k~~l~e~v~~p~~~p~~f~~~g~~~~~gvLl~GPPGtGKT~lAkaiA~e~~~~f~~v~~~~l~s~~vGese~~vr~lF~  564 (806)
T 3cf2_A          485 VKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFD  564 (806)
T ss_dssp             HHHHHTTTTTTTTTCSGGGSSSCCCCCSCCEEESSTTSSHHHHHHHHHHTTTCEEEECCHHHHHTTTCSSCHHHHHHHHH
T ss_pred             HHHHHHHHHHhhhhCHHHHHhcCCCCCceEEEecCCCCCchHHHHHHHHHhCCceEEeccchhhccccchHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhCCCeEEEEccccccccc
Q 007764          569 KARQSAPCVLFFDELDSIATQ  589 (590)
Q Consensus       569 ~Ar~~~p~vlf~DEid~l~~~  589 (590)
                      .||+.+||||||||||++++.
T Consensus       565 ~Ar~~~P~IifiDEiDsl~~~  585 (806)
T 3cf2_A          565 KARQAAPCVLFFDELDSIAKA  585 (806)
T ss_dssp             HHHTTCSEEEECSCGGGCC--
T ss_pred             HHHHcCCceeechhhhHHhhc
Confidence            999999999999999999863
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>3qwz_A Transitional endoplasmic reticulum ATPase; UBX, P97 binding, transport protein; HET: MLY; 2.00A {Homo sapiens} PDB: 2pjh_B Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>3tiw_A Transitional endoplasmic reticulum ATPase; beta-barrel alpha-helix, transport protein ATPase ubiquitin ubiquitin, phosphorylation; 1.80A {Homo sapiens} PDB: 3qq8_A 3qq7_A 3qc8_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1cz4_A VCP-like ATPase; double-PSI beta-barrel, beta-CLAM, substrate recognition DOM hydrolase; NMR {Thermoplasma acidophilum} SCOP: b.52.2.3 d.31.1.1 PDB: 1cz5_A Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1wlf_A PEX1, peroxisome biogenesis factor 1; N-terminal domain, protein transport; 2.05A {Mus musculus} SCOP: b.52.2.3 d.31.1.1 Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2krk_A 26S protease regulatory subunit 8; structural genomics, northeast structural genomics consortium (NESG), target HR3102A, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>3kw6_A 26S protease regulatory subunit 8; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Homo sapiens} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3vlf_B 26S protease regulatory subunit 7 homolog; heat repeat, chaperone, chaperone-protein binding complex; HET: DNA; 3.80A {Saccharomyces cerevisiae} PDB: 4a3v_B* Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3aji_B S6C, proteasome (prosome, macropain) 26S subunit, ATPA; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dwz_B* 2dvw_B* Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1cr5_A SEC18P (residues 22 - 210); double-PSI beta barrel, vesicle fusion, endocytosis/exocytosis complex; 2.30A {Saccharomyces cerevisiae} SCOP: b.52.2.3 d.31.1.1 Back     alignment and structure
>1qcs_A N-ethylmaleimide sensitive factor (NSF-N); double-PSI beta barrel alpha beta roll, fusion protein; 1.90A {Cricetulus griseus} SCOP: b.52.2.3 d.31.1.1 PDB: 1qdn_A Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2jv2_A Putative uncharacterized protein PH1500; AAA ATPase NC-domain-like, unknown function; NMR {Pyrococcus horikoshii} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2dzn_B 26S protease regulatory subunit 6B homolog; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} PDB: 2dzo_B Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2yuj_A Ubiquitin fusion degradation 1-like; ubiquitin-dependent proteolytic, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1zc1_A Ubiquitin fusion degradation protein 1; UFD1, double-PSI-beta-barrel, protein turnover; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 590
d1lv7a_256 c.37.1.20 (A:) AAA domain of cell division protein 3e-99
d1lv7a_ 256 c.37.1.20 (A:) AAA domain of cell division protein 1e-47
d1ixza_247 c.37.1.20 (A:) AAA domain of cell division protein 8e-99
d1ixza_ 247 c.37.1.20 (A:) AAA domain of cell division protein 8e-49
d1e32a2258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 3e-82
d1e32a2 258 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p 7e-34
d1r7ra3265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 4e-76
d1r7ra3 265 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p 2e-40
d1w44a_321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 6e-52
d1w44a_ 321 c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta 2e-29
d1e32a394 d.31.1.1 (A:107-200) Membrane fusion atpase p97 do 5e-49
d1d2na_246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 4e-42
d1d2na_ 246 c.37.1.20 (A:) Hexamerization domain of N-ethylmal 2e-13
d1gvnb_273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 1e-37
d1gvnb_ 273 c.37.1.21 (B:) Plasmid maintenance system epsilon/ 1e-13
d1e32a186 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-t 5e-35
d1svma_362 c.37.1.20 (A:) Papillomavirus large T antigen heli 8e-33
d1svma_ 362 c.37.1.20 (A:) Papillomavirus large T antigen heli 1e-19
d1ixsb2239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 6e-26
d1ixsb2 239 c.37.1.20 (B:4-242) Holliday junction helicase Ruv 1e-11
d1cz5a191 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT- 2e-22
d1ofha_309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 3e-22
d1ofha_ 309 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 7e-12
d1fnna2276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 4e-22
d1fnna2 276 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob 7e-08
d1cz5a294 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VA 1e-20
d1in4a2238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 1e-18
d1in4a2 238 c.37.1.20 (A:17-254) Holliday junction helicase Ru 7e-09
d1w5sa2287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 7e-15
d1w5sa2 287 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t 8e-06
d1sxja2253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 3e-12
d1sxja2 253 c.37.1.20 (A:295-547) Replication factor C1 {Baker 5e-10
d1g41a_443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 8e-09
d1g41a_ 443 c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId 3e-05
d1njfa_239 c.37.1.20 (A:) delta prime subunit of DNA polymera 9e-09
d1ny5a2247 c.37.1.20 (A:138-384) Transcriptional activator si 2e-07
d2fnaa2283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 4e-06
d2fnaa2 283 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfo 7e-04
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 6e-06
d1zp6a1176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 0.001
d1lw7a2 192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 1e-04
d1lw7a2192 c.37.1.1 (A:220-411) Transcriptional regulator Nad 0.003
d1sxje2 252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 1e-04
d1sxje2252 c.37.1.20 (E:4-255) Replication factor C5 {Baker's 0.003
d1a5ta2207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 2e-04
d1a5ta2 207 c.37.1.20 (A:1-207) delta prime subunit of DNA pol 7e-04
d1um8a_364 c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 2 2e-04
d1g8pa_ 333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 2e-04
d1g8pa_333 c.37.1.20 (A:) ATPase subunit of magnesium chelata 0.002
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 4e-04
d1qhxa_178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 0.003
d2gnoa2 198 c.37.1.20 (A:11-208) gamma subunit of DNA polymera 6e-04
d2gnoa2198 c.37.1.20 (A:11-208) gamma subunit of DNA polymera 0.001
d2i3ba1 189 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 6e-04
d1iqpa2231 c.37.1.20 (A:2-232) Replication factor C {Archaeon 7e-04
d1y63a_174 c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma 8e-04
d1kaga_169 c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia 9e-04
d1yj5a2172 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' p 0.001
d1sxjd2 237 c.37.1.20 (D:26-262) Replication factor C2 {Baker' 0.002
d1e6ca_170 c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr 0.002
d1viaa_161 c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobact 0.002
d1zaka1 189 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Mai 0.003
d3adka_194 c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [ 0.003
d1rkba_173 c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien 0.003
d1m8pa3183 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d 0.003
d1knqa_171 c.37.1.17 (A:) Gluconate kinase {Escherichia coli 0.003
d2iyva1165 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycoba 0.004
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: AAA domain of cell division protein FtsH
species: Escherichia coli [TaxId: 562]

 Score =  300 bits (769), Expect = 3e-99
 Identities = 101/238 (42%), Positives = 149/238 (62%), Gaps = 4/238 (1%)

Query: 204 EVGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVA 263
           +  + DV G  +   ++ ELVE  LR P  F+ +G K PKG+L+ GPPG+GKTL+A+A+A
Sbjct: 8   KTTFADVAGCDEAKEEVAELVEY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIA 66

Query: 264 NETGAFFFCINGPEIMSKLAGESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHG- 322
            E    FF I+G + +    G   S +R  FE+A+K AP IIFIDEID++  +R    G 
Sbjct: 67  GEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGG 126

Query: 323 --EVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRFGRFDREIDIGVPDEVG 380
             +   + ++Q+L  MDG +    +IVI ATNRP+ +DPAL R GRFDR++ +G+PD  G
Sbjct: 127 GHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRG 186

Query: 381 RLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLED 438
           R ++L++H + + L+ D+D   IA+ T G+ GADLA L  EAAL   R    V+ + +
Sbjct: 187 REQILKVHMRRVPLAPDIDAAIIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVE 244
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Back     information, alignment and structure
>d1e32a3 d.31.1.1 (A:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273 Back     information, alignment and structure
>d1e32a1 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239 Back     information, alignment and structure
>d1cz5a1 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT-Nn {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276 Back     information, alignment and structure
>d1cz5a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 94 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 443 Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 239 Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 247 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Length = 283 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 252 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Length = 364 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Length = 333 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Length = 198 Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Length = 198 Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189 Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 231 Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174 Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169 Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237 Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170 Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Length = 161 Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Length = 189 Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194 Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183 Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 165 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query590
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 100.0
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 100.0
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 100.0
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 99.93
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 99.92
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.91
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.9
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 99.89
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 99.88
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 99.84
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 99.83
d1e32a186 Membrane fusion ATPase p97 N-terminal domain , P97 99.82
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 99.78
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 99.75
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 99.72
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 99.7
d1cz5a191 N-terminal domain of VAT-N, VAT-Nn {Archaeon Therm 99.66
d1e32a394 Membrane fusion atpase p97 domain 2, P97-Nc {Mouse 99.64
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.62
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 99.61
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 99.61
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 99.52
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 99.51
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 99.48
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 99.46
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.45
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 99.44
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 99.44
d1svma_362 Papillomavirus large T antigen helicase domain {Si 99.42
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 99.41
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 99.41
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 99.41
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 99.37
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 99.33
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.28
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.2
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 99.2
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 99.17
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 99.17
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 99.14
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 99.09
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 99.07
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 99.06
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 99.03
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 99.02
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 99.0
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 98.91
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 98.91
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 98.89
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 98.88
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 98.87
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 98.79
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 98.79
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 98.78
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 98.72
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 98.71
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 98.65
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 98.57
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 98.53
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 98.51
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.38
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.36
d1cz5a294 C-terminal domain of VAT-N, VAT-Nc {Archaeon Therm 98.36
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 98.35
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.33
d2awna2232 Maltose transport protein MalK, N-terminal domain 98.26
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 98.24
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 98.23
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 98.22
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 98.21
d1g2912240 Maltose transport protein MalK, N-terminal domain 98.2
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 98.19
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 98.18
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 98.17
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 98.13
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 98.11
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 98.11
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 98.08
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 98.07
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 98.04
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.98
d1cr5a182 N-terminal domain of NSF-N, NSF-Nn {Baker's yeast 97.97
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.96
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.96
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.96
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.95
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 97.93
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.93
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.92
d1qcsa186 N-terminal domain of NSF-N, NSF-Nn {Hamster (Crice 97.92
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.91
d1ny5a2 247 Transcriptional activator sigm54 (NtrC1), C-termin 97.91
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.88
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.88
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.87
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.87
d2gnoa2 198 gamma subunit of DNA polymerase III, N-domain {The 97.85
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.85
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 97.81
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.81
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 97.77
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.76
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.74
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.74
d1zaka1 189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.73
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 97.73
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 97.72
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.72
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.72
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 97.71
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.71
d1ak2a1 190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.69
d1qf9a_ 194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.68
d1zina1 182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.66
d1ukza_ 196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.64
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.63
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 97.62
d2cdna1 181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.61
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 97.6
d2ak3a1 189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.6
d2i3ba1 189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.6
d1m8pa3 183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.59
d1akya1 180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.59
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.59
d1s3ga1 182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.58
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 97.57
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.57
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 97.57
d1g2912 240 Maltose transport protein MalK, N-terminal domain 97.57
d3adka_ 194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.55
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.53
d1ckea_ 225 CMP kinase {Escherichia coli [TaxId: 562]} 97.52
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.5
d1q3ta_ 223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 97.5
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.49
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.49
d1e4va1 179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.49
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.48
d1teva_ 194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.47
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.47
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.47
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 97.46
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.45
d3d31a2 229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.44
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.43
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 97.42
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.41
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 97.39
d2qy9a2211 GTPase domain of the signal recognition particle r 97.39
d1vpla_ 238 Putative ABC transporter TM0544 {Thermotoga mariti 97.37
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.37
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.36
d1x6va3 195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.36
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.35
d2qy9a2 211 GTPase domain of the signal recognition particle r 97.33
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.3
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.27
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 97.26
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.24
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.23
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 97.22
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.22
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.2
d1j8yf2211 GTPase domain of the signal sequence recognition p 97.2
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 97.19
d1bifa1 213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.19
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.17
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.17
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.12
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 97.11
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.1
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.09
d1tf7a2 242 Circadian clock protein KaiC {Synechococcus sp. st 97.07
d1j8yf2 211 GTPase domain of the signal sequence recognition p 97.07
d1okkd2207 GTPase domain of the signal recognition particle r 97.06
d1m7ga_ 208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 97.04
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.04
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 97.04
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 97.02
d1vmaa2213 GTPase domain of the signal recognition particle r 97.02
d1mv5a_ 242 Multidrug resistance ABC transporter LmrA, C-termi 97.01
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 97.0
d1ls1a2 207 GTPase domain of the signal sequence recognition p 97.0
d1okkd2 207 GTPase domain of the signal recognition particle r 96.99
d1khta_ 190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.99
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.95
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 96.94
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 96.92
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.91
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 96.89
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.88
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 96.88
d2awna2 232 Maltose transport protein MalK, N-terminal domain 96.88
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 96.88
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.86
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 96.85
d1vmaa2 213 GTPase domain of the signal recognition particle r 96.84
d1rz3a_ 198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.82
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 96.8
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 96.77
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 96.74
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 96.7
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.69
d1nksa_ 194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.68
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.67
d2onka1 240 Molybdate/tungstate import ATP-binding protein Wtp 96.66
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 96.63
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 96.62
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 96.6
d1lvga_ 190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.56
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.56
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 96.56
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.55
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.54
d1b0ua_ 258 ATP-binding subunit of the histidine permease {Sal 96.5
d1gkya_ 186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.49
d1tf7a1 242 Circadian clock protein KaiC {Synechococcus sp. st 96.44
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 96.42
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 96.39
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 96.39
d1n0wa_ 242 DNA repair protein Rad51, catalytic domain {Human 96.38
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.36
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.33
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.31
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.29
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 96.25
d1l7vc_ 231 ABC transporter involved in vitamin B12 uptake, Bt 96.23
d1uj2a_ 213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.22
d1znwa1 182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.21
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.2
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 96.19
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.17
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.17
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 96.08
d1tuea_205 Replication protein E1 helicase domain {Human papi 96.06
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 96.05
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 96.0
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 96.0
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.97
d2iv2x1151 Formate dehydrogenase H {Escherichia coli [TaxId: 95.83
d2jioa1123 Periplasmic nitrate reductase alpha chain, NapA {D 95.77
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.77
d1ogya1120 Periplasmic nitrate reductase alpha chain, NapA {R 95.75
d1uf9a_ 191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.75
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 95.74
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 95.69
d1g8ka1143 Arsenite oxidase large subunit {Alcaligenes faecal 95.68
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.67
d1eu1a1155 Dimethylsulfoxide reductase (DMSO reductase) {Rhod 95.66
d1tuea_205 Replication protein E1 helicase domain {Human papi 95.64
d2fug3182 NADH-quinone oxidoreductase chain 3, Nqo3, C-termi 95.61
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.61
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 95.57
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 95.56
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 95.55
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 95.55
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.55
d1vlfm1147 Transhydroxylase alpha subunit, AthL {Pelobacter a 95.49
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 95.47
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 95.41
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.39
d1wlfa287 Peroxisome biogenesis factor 1 (PEX-1), N-terminal 95.39
d1nn5a_ 209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.37
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 95.35
d1tmka_ 214 Thymidylate kinase {Baker's yeast (Saccharomyces c 95.34
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.31
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 95.24
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 95.15
d1tmoa1167 Trimethylamine N-oxide reductase {Shewanella massi 95.15
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 95.13
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 95.12
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 95.09
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.09
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 95.08
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 95.07
d1y5ia1170 Respiratory nitrate reductase 1 alpha chain {Esche 95.04
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 94.91
d1jjva_ 205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 94.87
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.77
d1s96a_ 205 Guanylate kinase {Escherichia coli [TaxId: 562]} 94.76
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 94.74
g1f2t.1 292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.73
d1gsia_ 208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.7
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.7
d1vhta_ 208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 94.63
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 94.61
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 94.56
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 94.5
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 94.49
d2vp4a1 197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 94.49
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.47
d1yrba1 244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.47
d1odfa_ 286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.45
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.44
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 94.43
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.38
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 94.36
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.32
d2fh5b1207 Signal recognition particle receptor beta-subunit 94.32
d1kqfa1165 Formate dehydrogenase N, alpha subunit {Escherichi 94.3
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 94.3
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 94.29
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 94.29
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 94.26
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 94.18
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.12
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.12
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.11
d4tmka_ 210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.09
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 94.04
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 94.01
d2fh5b1 207 Signal recognition particle receptor beta-subunit 94.01
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 94.01
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 93.97
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 93.94
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 93.92
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 93.91
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.87
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 93.87
d1deka_ 241 Deoxynucleoside monophosphate kinase {Bacteriophag 93.83
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 93.8
d1qhla_ 222 Cell division protein MukB {Escherichia coli [TaxI 93.78
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.71
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.68
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.67
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 93.65
d1a7ja_ 288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 93.63
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.63
d1nrjb_209 Signal recognition particle receptor beta-subunit 93.63
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 93.58
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 93.54
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 93.44
d2ocpa1 241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 93.43
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.4
d1h0ha1165 Tungsten containing formate dehydrogenase, large s 93.39
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.39
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.38
d1e69a_ 308 Smc head domain {Thermotoga maritima [TaxId: 2336] 93.32
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 93.32
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 93.3
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.28
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 93.26
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 93.25
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 93.21
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 93.2
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 93.19
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.19
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 93.18
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 93.17
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 93.15
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 93.13
d1nrjb_ 209 Signal recognition particle receptor beta-subunit 93.13
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.06
d2f7sa1 186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 93.03
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 93.02
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.99
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 92.99
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.98
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.97
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 92.94
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.88
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 92.86
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 92.86
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 92.85
d1p5zb_ 241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 92.84
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 92.83
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.83
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.81
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.8
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.79
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 92.77
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.68
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 92.67
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 92.67
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 92.66
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.64
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.64
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 92.6
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 92.59
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 92.52
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 92.49
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.49
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.48
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 92.45
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.44
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 92.43
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 92.42
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 92.41
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.4
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.39
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 92.36
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.3
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 92.27
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.25
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 92.21
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.2
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 92.2
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 92.2
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.16
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 92.14
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 92.13
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 92.11
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.09
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 92.09
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 92.07
d1vg8a_ 184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.06
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 92.05
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 92.03
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 92.03
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.02
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.02
d1xpua3 289 Transcription termination factor Rho, ATPase domai 91.98
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 91.97
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 91.95
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 91.94
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 91.9
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 91.88
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 91.88
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 91.86
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.86
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 91.85
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.84
d2cxxa1 184 GTP-binding protein engB {Pyrococcus horikoshii [T 91.84
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 91.78
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 91.75
d1wlfa180 Peroxisome biogenesis factor 1 (PEX-1), domain 2 { 91.74
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.72
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 91.72
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.67
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 91.58
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 91.57
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 91.5
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.5
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 91.49
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 91.46
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 91.44
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 91.41
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 91.37
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 91.27
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 91.27
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 91.22
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 91.22
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 91.2
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 91.19
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 91.19
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 91.15
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 91.1
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 91.09
d2bcgy1 194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 91.08
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 91.04
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 90.82
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 90.78
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 90.77
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 90.73
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 90.73
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 90.67
d1m7ba_ 179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 90.67
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.6
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 90.52
d1mh1a_ 183 Rac {Human (Homo sapiens) [TaxId: 9606]} 90.5
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 90.4
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 90.38
d2bv3a2 276 Elongation factor G (EF-G), N-terminal (G) domain 90.38
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.33
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 90.27
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 90.24
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 90.18
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 90.17
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 90.14
d1lnza2 185 Obg GTP-binding protein middle domain {Bacillus su 90.12
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 90.1
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 89.97
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 89.91
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 89.84
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 89.76
d2atxa1 185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 89.66
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 89.61
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 89.61
d2ngra_ 191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 89.58
d1udxa2 180 Obg GTP-binding protein middle domain {Thermus the 89.56
d1xpua3289 Transcription termination factor Rho, ATPase domai 89.5
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 89.5
d1mkya2 186 Probable GTPase Der, N-terminal and middle domains 89.43
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 89.25
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 89.01
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 88.81
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 88.79
d1zcba2 200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.09
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 87.98
d1ppya_118 Pyruvoyl dependent aspartate decarboxylase, ADC {E 87.83
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 87.47
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 87.46
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 87.35
g1uhe.1121 Pyruvoyl dependent aspartate decarboxylase, ADC {H 87.32
d1azta2 221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 87.29
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 86.63
d1wp9a1 200 putative ATP-dependent RNA helicase PF2015 {Pyroco 86.62
d1nija1 222 Hypothetical protein YjiA, N-terminal domain {Esch 86.59
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 86.52
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Membrane fusion ATPase VCP/p97
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=2.7e-43  Score=347.46  Aligned_cols=258  Identities=84%  Similarity=1.281  Sum_probs=241.7

Q ss_pred             CCcccccchHHHHHHHHHHHHcccCChhhhhhhCCCCCceEEEECCCCCcHHHHHHHHHHHhCCeEEEEechhhhhhccc
Q 007764          205 VGYDDVGGVRKQMAQIRELVELPLRHPQLFKSIGVKPPKGILLYGPPGSGKTLIARAVANETGAFFFCINGPEIMSKLAG  284 (590)
Q Consensus       205 ~~~~~i~G~~~~~~~l~~~~~~~~~~~~~~~~l~i~~~~~vLL~GppGtGKTtla~~la~~~~~~~~~v~~~~l~~~~~g  284 (590)
                      ++|+||||+++++++|++.+.+|+.+|+.+.++|+.+++++|||||||||||++++++|++++.+++.++++++.+.+.|
T Consensus         1 ~~~~dv~G~~~~k~~l~~~i~~~l~~~~~~~~~g~~~~~giLL~GppGtGKT~l~~ala~~~~~~~~~i~~~~l~~~~~g   80 (258)
T d1e32a2           1 VGYDDVGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAG   80 (258)
T ss_dssp             CCGGGCCSCSHHHHHHHHHHHHHHHCHHHHHHCCCCCCCEEEEECCTTSSHHHHHHHHHHHTTCEEEEECHHHHTTSCTT
T ss_pred             CChhhhccHHHHHHHHHHHHHHHhcCHHHHHhCCCCCCceeEEecCCCCCchHHHHHHHHHhCCeEEEEEchhhcccccc
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHHHHhcCCeEEEEcccccccCCCCCCchhHHHHHHHHHHHhhhccccCCeEEEEeecCCCCCCchhhhcc
Q 007764          285 ESESNLRKAFEEAEKNAPSIIFIDEIDSIAPKREKTHGEVERRIVSQLLTLMDGLKSRAHVIVIGATNRPNSIDPALRRF  364 (590)
Q Consensus       285 ~~~~~~~~~f~~a~~~~p~iL~iDEid~l~~~~~~~~~~~~~~v~~~Ll~~ld~~~~~~~v~vI~~tn~~~~ld~al~r~  364 (590)
                      +.+..++.+|+.|....|+||||||+|.+++++....++...+++..++..++......++++|+|||+++.+|++++|+
T Consensus        81 ~~~~~l~~~f~~A~~~~p~il~iDeid~l~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~vlvi~tTn~~~~ld~al~r~  160 (258)
T d1e32a2          81 ESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRF  160 (258)
T ss_dssp             HHHHHHHHHHHHHHHTCSEEEEESSGGGTCCHHHHCCCTTHHHHHHHHHHHHHTCCCSSCEEEEEEESCGGGSCGGGTST
T ss_pred             cHHHHHHHHHHHHHhcCCeEEEehhhhhhccCCCCCCCchHHHHHHHhccccccccccCCccEEEeCCCccccchhhhhc
Confidence            99999999999999999999999999999998877666777888899999999988889999999999999999999999


Q ss_pred             CCCceEEEecCCCHHHHHHHHHHHhcCCCCCCccCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhcccccccchhhhhHH
Q 007764          365 GRFDREIDIGVPDEVGRLEVLRIHTKNMKLSDDVDLERIAKDTHGYVGADLAALCTEAALQCIREKMDVIDLEDETIDAE  444 (590)
Q Consensus       365 gRf~~~i~i~~P~~~~r~~Il~~~~~~~~~~~~~~l~~la~~t~g~~~~dl~~l~~~a~~~~~~~~~~~~~~~~~~i~~~  444 (590)
                      |||+.+|+++.|+.++|.+||+.++++..+..+.++..++..|+||+++|+..+|++|++.++++....++.++..+..+
T Consensus       161 gRfd~~i~~~~P~~~~R~~il~~~l~~~~~~~~~~~~~la~~t~G~s~adl~~lv~~A~~~a~~~~~~~~~~~~~~~~~~  240 (258)
T d1e32a2         161 GRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAE  240 (258)
T ss_dssp             TSSCEEEECCCCCHHHHHHHHHHTTTTSCBCTTCCHHHHHHHCTTCCHHHHHHHHHHHHHHHHHHHHHHHCCCSSCCBHH
T ss_pred             ccccceeECCCCCHHHHHHHhhhhccCcccccccchhhhhhcccCCCHHHHHHHHHHHHHHHHHhhccccchhhhhhhhh
Confidence            99999999999999999999999999999888999999999999999999999999999999988776666666666666


Q ss_pred             HhhhhhccHHHHHhhhcC
Q 007764          445 ILNSMAVTDEHFKTALGT  462 (590)
Q Consensus       445 ~~~~~~v~~~~~~~al~~  462 (590)
                      ......++.+||..|+.+
T Consensus       241 ~~~~~~it~~Df~~AL~~  258 (258)
T d1e32a2         241 VMNSLAVTMDDFRWALSQ  258 (258)
T ss_dssp             HHHHCCBCHHHHHHHHTC
T ss_pred             hhccCccCHHHHHHHhCc
Confidence            677788999999999863
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1e32a1 b.52.2.3 (A:21-106) Membrane fusion ATPase p97 N-terminal domain , P97-Nn {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cz5a1 b.52.2.3 (A:1-91) N-terminal domain of VAT-N, VAT-Nn {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1e32a3 d.31.1.1 (A:107-200) Membrane fusion atpase p97 domain 2, P97-Nc {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1cz5a2 d.31.1.1 (A:92-185) C-terminal domain of VAT-N, VAT-Nc {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1cr5a1 b.52.2.3 (A:26-107) N-terminal domain of NSF-N, NSF-Nn {Baker's yeast (Saccharomyces cerevisiae), sec18p [TaxId: 4932]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qcsa1 b.52.2.3 (A:0-85) N-terminal domain of NSF-N, NSF-Nn {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2iv2x1 b.52.2.2 (X:565-715) Formate dehydrogenase H {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jioa1 b.52.2.2 (A:601-723) Periplasmic nitrate reductase alpha chain, NapA {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1ogya1 b.52.2.2 (A:682-801) Periplasmic nitrate reductase alpha chain, NapA {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g8ka1 b.52.2.2 (A:683-825) Arsenite oxidase large subunit {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1eu1a1 b.52.2.2 (A:626-780) Dimethylsulfoxide reductase (DMSO reductase) {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2fug31 b.52.2.2 (3:686-767) NADH-quinone oxidoreductase chain 3, Nqo3, C-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlfm1 b.52.2.2 (M:729-875) Transhydroxylase alpha subunit, AthL {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wlfa2 b.52.2.3 (A:13-99) Peroxisome biogenesis factor 1 (PEX-1), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1tmoa1 b.52.2.2 (A:632-798) Trimethylamine N-oxide reductase {Shewanella massilia [TaxId: 76854]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1y5ia1 b.52.2.2 (A:1075-1244) Respiratory nitrate reductase 1 alpha chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kqfa1 b.52.2.2 (A:851-1015) Formate dehydrogenase N, alpha subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1h0ha1 b.52.2.2 (A:813-977) Tungsten containing formate dehydrogenase, large subunit {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlfa1 d.31.1.1 (A:100-179) Peroxisome biogenesis factor 1 (PEX-1), domain 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ppya_ b.52.2.1 (A:) Pyruvoyl dependent aspartate decarboxylase, ADC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure