Citrus Sinensis ID: 008235

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570---

MTKGDDAVMRRRNKAKIKKLNNKNTSSNVSARVAAVIAAKKRRKSGKRRQCQGMCFSLPTLDDPFNDRYDKRETETKATKKRNSLQLDKNKNAFVKGKSAVSKKETKRDNNEKPGHLEQTKEKAINLKNSQDKSLLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTGSNCIVSHIKNSVEADGRKRPAVSMIDKDHISTAELEEYEVVIVPDFIISMKNYVEILTSMARHTVSGILHSFFTKDDAAHAGQMIEILEQCGQVVPDALRDLCHTSPMLE

cccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHcccHHHccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccHHccccccccccccccccccccccHHHHHcHHHHHHHHHHcccccccccccccccccccccccccccEEEcccccHHHHHHHHHHHHHHcccHHHccccccccccEEEEEcccHHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHcccccEEEEcccHHHHHHHccccccccccEEEEEccccccccccHHHHHHHccccccEEEEEcccccHHHHHHHHHHccccEEEEcccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHcccccccccEEEEEEcccHHHHHHHHHHHHccccEEEccccccHHHHHHHHHccccccccEEEEEccccccccccccEEEcccccccccccEEEccccccccccEEEEEEEccccHHcHHHHHHHHHHccccccHHHHHHHHHccccc

cccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccEEcccccccccEEEEEcccEEccccccEEEEEEccccccccccccccccccccccEEEEcHHHHHHHHHHcccccccHHHcccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHccHHcccccccccccEEEEEccHHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHcccEEEEEccHHHHHHHHcccccccHEEEEEHHHHHHHHHccccHHHHHHEcccccEEEEEccccHHHHHHHHHHHcccEEEEEccHHHHHHccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHcccccEEEEcHHHcccccccEEEEEEcccccccHHEEEEEccccccccccEEEEEEcccHHHHHHHHHHHHHHccccccHHHHHHHHcccccc

MTKGDDAVMRRRNKAKIKklnnkntssNVSARVAAVIAAKKRrksgkrrqcqgmcfslptlddpfndrydkretetkatkkrnslqldknknafvkgksavskketkrdnnekpghleQTKEKAINlknsqdkslLFIDGVekrtgnveraevhlngkscanghhgqacekldcpsKFLILCLNAIENAmrhdgveqdnplfvnswgIEFWKCYSSAKdiletsgssstIVQIAWIVATAADSIArkekegfsftgpFLLFLVSSQEKAAKVRSVCKplkafgihtvslhpgaaidhqitglrscepeflvstpERLLKLVSLKAIDVSGVSLLVVDRldslskgdtlSLIRqsisgkphtvvfndcltytsvpaVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLdhaygdhfhsepLKVLYIVGKDSKFQNLVSTLKCkgysistgsnciVSHIKNsveadgrkrpavsmidkdhistaeleeyevvivPDFIISMKNYVEILTSMARHTVSGILhsfftkddaAHAGQMIEILEQCGqvvpdalrdlchtspmle

mtkgddavmrrrnkakikklnnkntssnvsaRVAAVIAakkrrksgkrrqcqgmcfslptlddpfndrydkretetkatkkrnslqldknknafvkgksavskketkrdnnekpghleqtkekainlknsqdkslLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTlslirqsisgkpHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGysistgsnciVSHIKNsveadgrkrpavsMIDKDhistaeleeyevVIVPDFIISMKNYVEILTSMARHTVSGILHSFFTKDDAAHAGQMIEILEQCGQVVPDALRDLCHTSPMLE

MTKGDDAVMrrrnkakikklnnknTssnvsarvaaviaakkrrksgkrrQCQGMCFSLPTLDDPFNDRYDkretetkatkkrNSLQLDKNKNAFVKGKSAVSKKETKRDNNEKPGHLEQTKEKAINLKNSQDKSLLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIdvsgvsllvvdrldslsKGDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTGSNCIVSHIKNSVEADGRKRPAVSMIDKDHISTAELEEYEVVIVPDFIISMKNYVEILTSMARHTVSGILHSFFTKDDAAHAGQMIEILEQCGQVVPDALRDLCHTSPMLE

*****************************************************MCFS*****************************************************************************LLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTGSNCIVSHIKNSV*********VSMIDKDHISTAELEEYEVVIVPDFIISMKNYVEILTSMARHTVSGILHSFFTKDDAAHAGQMIEILEQCGQVVPDALRDLC*******

*********************************************************************************************************************************************************************GQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAAD**************PFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYG****SEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTGSNCIVSHIKNSVEADGRKRPAVSMIDKDHISTAELEEYEVVIVPDFIISMKNYVEILTSMARHTVSGILHSFFTKDDAAHAGQMIEILEQCGQVVPDALRDLCHT*P***

********MRRRNKAKIKKLNNKNTSSNVSARVAAVI*************CQGMCFSLPTLDDPFNDRYDKRETETKATKKRNSLQLDKNKNAFV********************HLEQTKEKAINLKNSQDKSLLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTGSNCIVSHIKNSVEADGRKRPAVSMIDKDHISTAELEEYEVVIVPDFIISMKNYVEILTSMARHTVSGILHSFFTKDDAAHAGQMIEILEQCGQVVPDALRDLCHTSPMLE

*****DAVMRR******************************R***GKRR*C***CFSLPTLDDPFND*****************************GKS*VSKKETKRDNNEKPGHLEQTKEKAINLKNSQDKSLLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTGSNCIVSHIKNSVEADGRKRPAVSMIDKDHISTAELEEYEVVIVPDFIISMKNYVEILTSMARHTVSGILHSFFTKDDAAHAGQMIEILEQCGQVVPDALRDLCHT*****

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		573	2.2.26 [Sep-21-2011]
Q8SRB2		495	ATP-dependent RNA helicas	yes	no	0.593	0.686	0.261	5e-14
Q6YS30		512	DEAD-box ATP-dependent RN	no	no	0.600	0.671	0.235	1e-12
Q5BDW4		1173	Pre-mRNA-processing ATP-d	yes	no	0.527	0.257	0.244	4e-11
A6RW79		1151	Pre-mRNA-processing ATP-d	N/A	no	0.521	0.259	0.242	1e-10
Q4IP34		1207	Pre-mRNA-processing ATP-d	yes	no	0.518	0.246	0.237	2e-10
A7ENE0		1114	Pre-mRNA-processing ATP-d	N/A	no	0.521	0.268	0.239	3e-10
Q1DHB2		1197	Pre-mRNA-processing ATP-d	N/A	no	0.527	0.252	0.241	4e-10
Q4PDT1		585	ATP-dependent RNA helicas	N/A	no	0.520	0.509	0.253	5e-10
Q54CD6		697	Probable ATP-dependent RN	no	no	0.268	0.220	0.305	1e-09
A2QQA8		1180	Pre-mRNA-processing ATP-d	yes	no	0.523	0.254	0.24	1e-09

>sp\|Q8SRB2\|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1	Back alignment and function desciption

 Score = 79.7 bits (195), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 97/371 (26%), Positives = 163/371 (43%), Gaps = 31/371 (8%)

Query: 211 WKCYSSAKDI--LETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEK 268
           W    S +D+  +  +GS  T+  I   +  A D    +  +G     P +L L  ++E 
Sbjct: 118 WPMALSGRDMVGIAQTGSGKTLSFILPALVHAKDQQPLRRGDG-----PIVLVLAPTREL 172

Query: 269 AAKVRSVCKPL-KAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAID 327
             +++ V       F + + +++ GA+   QI  L     E +++TP RL+ L       
Sbjct: 173 VMQIKKVVDEFCGMFNLRSTAVYGGASSQPQIRALHEGA-EVVIATPGRLIDLHDQGHAP 231

Query: 328 VSGVSLLVVDRLDSLSKGDTLSLIRQSISGKPHTVVFNDCLTYTSV--PAVQNLLLGSIN 385
           +S V+ LV+D  D +        +R+ I   P T      L +++     V+ L    +N
Sbjct: 232 LSRVTFLVLDEADRMLDMGFEPQLRKII---PKTNANRQTLMWSATWPREVRGLAESYMN 288

Query: 386 R----LSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVG 441
                +  N+ + + S  I Q V VC S  EK  K I VLD+  GD       KV+    
Sbjct: 289 EYIQVVVGNEELKTNSK-IKQIVEVC-SGREKEDKLIGVLDNFKGD-------KVIVFCN 339

Query: 442 KDSKFQNLVSTLKCKGYSISTGSNCIVSHIKNSVEADGR--KRPAVSMIDKDHISTAELE 499
                 +L   L   GY  +        +I++ V  D R  +RP + +  +      ++ 
Sbjct: 340 MKRTCDDLEYVLNRSGYGAAALHGDKSQNIRDKVLDDFRSGRRP-ILIATEVAGRGLDVN 398

Query: 500 EYEVVIVPDFIISMKNYVEILTSMAR-HTVSGILHSFFTKDDAAHAGQMIEILEQCGQVV 558
           + ++VI  DF  S ++YV  +   AR +T  GI H+FFT  D A+A ++I +L +  Q V
Sbjct: 399 DVKLVINFDFPGSCEDYVHRIGRTARGNTKEGISHTFFTVGDKANARELIRMLREANQTV 458

Query: 559 PDALRDLCHTS 569
           P  L D+   S
Sbjct: 459 PSDLEDMVRVS 469

ATP-dependent RNA helicase involved nonsense-mediated mRNA decay and ribosome biogenesis through rRNA processing.
Encephalitozoon cuniculi (strain GB-M1) (taxid: 284813)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3

>sp\|Q6YS30\|RH5_ORYSJ DEAD-box ATP-dependent RNA helicase 5 OS=Oryza sativa subsp. japonica GN=Os07g0301200 PE=2 SV=1	Back alignment and function description

>sp\|Q5BDW4\|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1	Back alignment and function description

>sp\|A6RW79\|PRP5_BOTFB Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Botryotinia fuckeliana (strain B05.10) GN=prp5 PE=3 SV=1	Back alignment and function description

>sp\|Q4IP34\|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2	Back alignment and function description

>sp\|A7ENE0\|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1	Back alignment and function description

>sp\|Q1DHB2\|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1	Back alignment and function description

>sp\|Q4PDT1\|DBP3_USTMA ATP-dependent RNA helicase DBP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP3 PE=3 SV=1	Back alignment and function description

>sp\|Q54CD6\|DDX5_DICDI Probable ATP-dependent RNA helicase ddx5 OS=Dictyostelium discoideum GN=ddx5 PE=3 SV=1	Back alignment and function description

>sp\|A2QQA8\|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		573
449441810		562	PREDICTED: pre-mRNA-processing ATP-depen	0.961	0.980	0.539	1e-166
224109924		491	predicted protein [Populus trichocarpa]	0.841	0.981	0.507	1e-140
255580126		493	dead box ATP-dependent RNA helicase, put	0.705	0.819	0.599	1e-137
356500419		563	PREDICTED: pre-mRNA-processing ATP-depen	0.877	0.893	0.496	1e-136
357439969		532	DEAD-box ATP-dependent RNA helicase [Med	0.897	0.966	0.500	1e-132
15226904		502	P-loop containing nucleoside triphosphat	0.841	0.960	0.442	1e-118
20259502		522	putative ATP-dependent RNA helicase [Ara	0.846	0.929	0.444	1e-117
225449714		407	PREDICTED: uncharacterized protein LOC10	0.696	0.980	0.575	1e-109
297822571		505	ATP binding protein [Arabidopsis lyrata	0.666	0.756	0.497	1e-107
296090406		370	unnamed protein product [Vitis vinifera]	0.631	0.978	0.546	1e-101

>gi\|449441810\|ref\|XP_004138675.1\| PREDICTED: pre-mRNA-processing ATP-dependent RNA helicase prp5-like [Cucumis sativus] gi\|449517699\|ref\|XP_004165882.1\| PREDICTED: pre-mRNA-processing ATP-dependent RNA helicase prp5-like [Cucumis sativus]	Back alignment and taxonomy information

 Score =  590 bits (1521), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 309/573 (53%), Positives = 399/573 (69%), Gaps = 22/573 (3%)

Query: 1   MTKGDDAVMRRRNKAKIKKLNNKNT-SSNVSARVAAVIAAKKRRKSGKRRQCQGMCFSLP 59
           M KGDDA+ R+RNKA  KKL +K+  SS VSARVA++IAAKKRR SGKRRQCQGMCFSLP
Sbjct: 1   MAKGDDALTRKRNKASRKKLRSKSGDSSAVSARVASIIAAKKRRMSGKRRQCQGMCFSLP 60

Query: 60  TLDDPFNDRYDKRETETKATKKRNSLQLDKNKNAFVKGKSAVSKKETKRDNNEKPGHLEQ 119
           T DDP+NDR  K++T+ K +K         +K  F K KS  +   T RD          
Sbjct: 61  TPDDPYNDRNGKKDTKVKPSKS--------SKREFPKEKSTSAPNGTLRD---------V 103

Query: 120 TKEKAINLKNSQDKSLLFIDGVEKRTGNVERAEVHLNGKSCANGHHGQACEKLDCPSKFL 179
             E A + K     +L      ++   + ER + + N K    G   +  E    PSKFL
Sbjct: 104 CFENARSSKEGSGGTLPSGRVAKRSKTDPERTKEYGNAKGSVQGFQEEDSESSVAPSKFL 163

Query: 180 ILCLNAIENAMRHDGVEQDN-PLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVA 238
           ILCL+AIENA+ HD ++  N PLF ++WGIEFWKCYSS KDIL+TSG SST  +IAW+V+
Sbjct: 164 ILCLSAIENALYHDSIKSINKPLFADTWGIEFWKCYSSGKDILDTSGLSSTDEKIAWVVS 223

Query: 239 TAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAFGIHTVSLHPGAAIDHQ 298
           +AADSIARKEKEG SF+ PFLLFLV +QEKA ++RS+CKPLKA G+HTVS+HPGA++ HQ
Sbjct: 224 SAADSIARKEKEGSSFSSPFLLFLVPNQEKATQIRSMCKPLKALGVHTVSIHPGASLGHQ 283

Query: 299 ITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSKGDTLSL---IRQSI 355
           I GL+SCEPEFLVSTPERLL+LV+++AID+SGVSLLVVD L+SLS+G  L +   IR+SI
Sbjct: 284 IQGLKSCEPEFLVSTPERLLELVAMQAIDISGVSLLVVDGLESLSRGGYLDMTQSIRKSI 343

Query: 356 SGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKIL 415
           S K HT+VF+D  +   VP +Q+LL G I RLSLN SVA QSACIIQS+N   S++EK+ 
Sbjct: 344 SSKLHTIVFSDSFSCAYVPFIQSLLGGPIRRLSLNTSVACQSACIIQSINFYTSEKEKLS 403

Query: 416 KGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTGSNCIVSHIKNSV 475
           K IQ LD A G     +PLK+L+I+GK+    +L + LK KG+ I  G+ C V  IKN++
Sbjct: 404 KVIQALDRANGSQIRPQPLKMLFILGKECNVHDLAAALKFKGHDIVAGALCGVPEIKNNL 463

Query: 476 EADGRKRPAVSMIDKDHISTAELEEYEVVIVPDFIISMKNYVEILTSMARHTVSGILHSF 535
           + DG+ RP V+  D + I+T +L  YE + +      +  YVEILT MARHT +G+LHSF
Sbjct: 464 KVDGKLRPVVAKTDIEQINTIDLGTYESIFILSAFPPIDKYVEILTGMARHTNNGVLHSF 523

Query: 536 FTKDDAAHAGQMIEILEQCGQVVPDALRDLCHT 568
            +K++A+ AG ++EILEQCGQ VP  +R+L  T
Sbjct: 524 ISKEEASVAGSLVEILEQCGQDVPKTVRNLSLT 556

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224109924\|ref\|XP_002315356.1\| predicted protein [Populus trichocarpa] gi\|222864396\|gb\|EEF01527.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|255580126\|ref\|XP_002530895.1\| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi\|223529548\|gb\|EEF31501.1\| dead box ATP-dependent RNA helicase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|356500419\|ref\|XP_003519029.1\| PREDICTED: pre-mRNA-processing ATP-dependent RNA helicase prp5-like [Glycine max]	Back alignment and taxonomy information

>gi\|357439969\|ref\|XP_003590262.1\| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] gi\|355479310\|gb\|AES60513.1\| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]	Back alignment and taxonomy information

>gi|15226904|ref|NP_180427.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|4580397|gb|AAD24375.1| putative ATP-dependent RNA helicase [Arabidopsis thaliana] gi|29824179|gb|AAP04050.1| putative ATP-dependent RNA helicase [Arabidopsis thaliana] gi|330253053|gb|AEC08147.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|20259502\|gb\|AAM13871.1\| putative ATP-dependent RNA helicase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|225449714\|ref\|XP_002268926.1\| PREDICTED: uncharacterized protein LOC100260841 isoform 2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297822571\|ref\|XP_002879168.1\| ATP binding protein [Arabidopsis lyrata subsp. lyrata] gi\|297325007\|gb\|EFH55427.1\| ATP binding protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|296090406\|emb\|CBI40225.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		573
TAIR\|locus:2065494		502	AT2G28600 [Arabidopsis thalian	0.671	0.766	0.476	5.7e-107
UNIPROTKB\|I3LR20		1032	DDX46 "Uncharacterized protein	0.652	0.362	0.216	9.5e-09
UNIPROTKB\|F1MX40		1032	DDX46 "Uncharacterized protein	0.652	0.362	0.216	9.5e-09
UNIPROTKB\|F1PK90		1032	DDX46 "Uncharacterized protein	0.652	0.362	0.216	9.5e-09
UNIPROTKB\|Q7L014		1031	DDX46 "Probable ATP-dependent	0.652	0.362	0.216	1.2e-08
FB\|FBgn0029979		945	CG10777 [Drosophila melanogast	0.790	0.479	0.221	1.5e-08
MGI\|MGI:1920895		1032	Ddx46 "DEAD (Asp-Glu-Ala-Asp)	0.652	0.362	0.216	1.9e-08
ASPGD\|ASPL0000055571		1173	AN1266 [Emericella nidulans (t	0.521	0.254	0.231	1.9e-08
RGD\|708480		1032	Ddx46 "DEAD (Asp-Glu-Ala-Asp)	0.652	0.362	0.216	2.4e-08
UNIPROTKB\|Q62780		1032	Ddx46 "Probable ATP-dependent	0.652	0.362	0.216	2.4e-08

TAIR\|locus:2065494 AT2G28600 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 936 (334.5 bits), Expect = 5.7e-107, Sum P(3) = 5.7e-107
 Identities = 197/413 (47%), Positives = 274/413 (66%)

Query:   167 QACEKLDCPSKFLILCLNAIENAMRHD---GVEQDNPLFVNSWGIEFWKCYSSAKDILET 223
             +  EK+D P KFL+L LN IE++ R D     + D  LF +SWGIEFWKCYSS  DIL+T
Sbjct:    98 EGVEKMDGPPKFLMLNLNEIESSFRKDITYSEQHDKSLFTSSWGIEFWKCYSSGNDILDT 157

Query:   224 SGSSSTIVQIAWIVATAADSIARKEK----EGFSFTG--PFLLFLVSSQEKAAKVRSVCK 277
             SG SST+ QIAWIV+TAAD+IAR+EK    E     G  PFLL+LV SQ KA++VRSVCK
Sbjct:   158 SGMSSTVEQIAWIVSTAADAIARREKDEVEEEEELLGNSPFLLYLVPSQSKASQVRSVCK 217

Query:   278 PLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIXXXXXXXXXXX 337
              LK  GIHTVSLH GA +DHQI+GL+S EPEF+V+TPERLL++V+LK +           
Sbjct:   218 ALKGIGIHTVSLHQGAPLDHQISGLKSVEPEFIVATPERLLEIVTLKGVDISNVSLLVID 277

Query:   338 XXXXXXKGDTLSL---IRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLNQSVA 394
                    G  L+    I+Q+IS K  T+VFN+  + + +PAVQ+ L GS+NR+++N+SVA
Sbjct:   278 ELGSLCSGGYLNAVKSIKQAISSKHQTIVFNNSFSASIIPAVQSFLGGSVNRVTVNESVA 337

Query:   395 SQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLK 454
             SQ +CI Q+V+VCAS+E+K+ K        +  H  S   K++YIV K+  F+ +++ LK
Sbjct:   338 SQGSCITQTVSVCASEEKKLQK--------FAKHLDSSSSKLIYIVTKEESFKKIMAILK 389

Query:   455 CKGYSISTGSNCIVSHIKNSVEADGRKRPAVSMIDKDHISTAELEEYEVVIVPDFIISMK 514
              KG S+ST S+  +S +K S      ++P   +ID + + T  + + E V++PDF  S++
Sbjct:   390 LKGISVSTSSDSKLSEVKKS------RKPVAHLIDFEQLDTTVMRDSETVLLPDFFPSIE 443

Query:   515 NYVEILTSMARHTVSGILHSFFTKDDAA--HAGQMIEILEQCGQVVPDALRDL 565
              Y +ILTSMAR +  G+LHS+ T+ DAA   AG ++ +LE CGQ VPD  R++
Sbjct:   444 IYTQILTSMARESAHGVLHSYITEKDAASYQAGPLVNVLENCGQNVPDRWRNM 496

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0008026 "ATP-dependent helicase activity" evidence=IEA

GO:0000741 "karyogamy" evidence=RCA

GO:0001510 "RNA methylation" evidence=RCA

GO:0009560 "embryo sac egg cell differentiation" evidence=RCA

UNIPROTKB\|I3LR20 DDX46 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MX40 DDX46 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PK90 DDX46 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q7L014 DDX46 "Probable ATP-dependent RNA helicase DDX46" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

FB\|FBgn0029979 CG10777 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

MGI\|MGI:1920895 Ddx46 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 46" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000055571 AN1266 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

RGD\|708480 Ddx46 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 46" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q62780 Ddx46 "Probable ATP-dependent RNA helicase DDX46" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.X.3007.1	hypothetical protein (487 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		573
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	7e-07
pfam00270		169	pfam00270, DEAD, DEAD/DEAH box helicase	6e-06
COG0513		513	COG0513, SrmB, Superfamily II DNA and RNA helicase	9e-06
cd00268		203	cd00268, DEADc, DEAD-box helicases	2e-05
PRK10590		456	PRK10590, PRK10590, ATP-dependent RNA helicase Rhl	5e-04
PRK11634		629	PRK11634, PRK11634, ATP-dependent RNA helicase Dea	6e-04
PRK01297		475	PRK01297, PRK01297, ATP-dependent RNA helicase Rhl	0.001

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

 Score = 49.8 bits (119), Expect = 7e-07
 Identities = 25/96 (26%), Positives = 45/96 (46%), Gaps = 3/96 (3%)

Query: 272 VRSVCKPLKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGV 331
              + K   + G+  V L+ G +   Q+  L S + + LV+TP RLL L+    + +S V
Sbjct: 71  AEELKKLGPSLGLKVVGLYGGDSKREQLRKLESGKTDILVTTPGRLLDLLENDKLSLSNV 130

Query: 332 SLLVVD---RLDSLSKGDTLSLIRQSISGKPHTVVF 364
            L+++D   RL     GD L  + + +      ++ 
Sbjct: 131 DLVILDEAHRLLDGGFGDQLEKLLKLLPKNVQLLLL 166

Length = 201

>gnl\|CDD\|215832 pfam00270, DEAD, DEAD/DEAH box helicase	Back alignment and domain information

>gnl\|CDD\|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|238167 cd00268, DEADc, DEAD-box helicases	Back alignment and domain information

>gnl\|CDD\|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>gnl\|CDD\|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>gnl\|CDD\|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		573
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	100.0
PTZ00110		545	helicase; Provisional	100.0
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	100.0
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	100.0
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	100.0
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	100.0
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0347		731	consensus RNA helicase [RNA processing and modific	100.0
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	100.0
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	100.0
KOG0343		758	consensus RNA Helicase [RNA processing and modific	100.0
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0334		997	consensus RNA helicase [RNA processing and modific	100.0
KOG0326		459	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	100.0
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	100.0
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	100.0
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	100.0
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	100.0
KOG0346		569	consensus RNA helicase [RNA processing and modific	100.0
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	100.0
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	100.0
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0327		397	consensus Translation initiation factor 4F, helica	100.0
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	100.0
PTZ00424		401	helicase 45; Provisional	100.0
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	100.0
KOG4284		980	consensus DEAD box protein [Transcription]	100.0
KOG0337		529	consensus ATP-dependent RNA helicase [RNA processi	100.0
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	100.0
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	100.0
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	100.0
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	100.0
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	100.0
PRK13767		876	ATP-dependent helicase; Provisional	100.0
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	100.0
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	100.0
PRK02362		737	ski2-like helicase; Provisional	100.0
PRK09401		1176	reverse gyrase; Reviewed	100.0
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	100.0
PRK00254		720	ski2-like helicase; Provisional	100.0
PRK10689		1147	transcription-repair coupling factor; Provisional	100.0
PRK14701		1638	reverse gyrase; Provisional	100.0
PHA02653		675	RNA helicase NPH-II; Provisional	100.0
COG1201		814	Lhr Lhr-like helicases [General function predictio	100.0
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	100.0
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	100.0
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	100.0
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	100.0
PRK01172		674	ski2-like helicase; Provisional	100.0
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	100.0
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	100.0
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	100.0
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	100.0
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	100.0
PRK09200		790	preprotein translocase subunit SecA; Reviewed	100.0
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	100.0
PHA02558		501	uvsW UvsW helicase; Provisional	100.0
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	100.0
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	100.0
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	100.0
PRK13766		773	Hef nuclease; Provisional	100.0
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	100.0
COG1205		851	Distinct helicase family with a unique C-terminal	100.0
COG1202		830	Superfamily II helicase, archaea-specific [General	100.0
COG1204		766	Superfamily II helicase [General function predicti	100.0
KOG0351		941	consensus ATP-dependent DNA helicase [Replication,	100.0
KOG0352		641	consensus ATP-dependent DNA helicase [Replication,	100.0
KOG0354		746	consensus DEAD-box like helicase [General function	99.98
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	99.98
PRK05580		679	primosome assembly protein PriA; Validated	99.97
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	99.97
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	99.97
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	99.96
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	99.96
KOG0353		695	consensus ATP-dependent DNA helicase [General func	99.96
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	99.96
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	99.95
PRK09694		878	helicase Cas3; Provisional	99.95
PRK12904		830	preprotein translocase subunit SecA; Reviewed	99.95
TIGR00595		505	priA primosomal protein N'. All proteins in this f	99.95
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	99.94
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	99.94
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	99.93
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.93
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	99.93
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	99.93
PRK13107		908	preprotein translocase subunit SecA; Reviewed	99.92
PRK04914		956	ATP-dependent helicase HepA; Validated	99.92
KOG0948		1041	consensus Nuclear exosomal RNA helicase MTR4, DEAD	99.92
KOG0947		1248	consensus Cytoplasmic exosomal RNA helicase SKI2,	99.91
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	99.9
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	99.9
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	99.89
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	99.87
KOG0950		1008	consensus DNA polymerase theta/eta, DEAD-box super	99.85
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	99.84
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.84
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	99.84
PRK05298		652	excinuclease ABC subunit B; Provisional	99.81
smart00487		201	DEXDc DEAD-like helicases superfamily.	99.81
PRK12326		764	preprotein translocase subunit SecA; Reviewed	99.8
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	99.8
COG4096		875	HsdR Type I site-specific restriction-modification	99.78
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	99.77
KOG4150		1034	consensus Predicted ATP-dependent RNA helicase [RN	99.77
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	99.76
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	99.76
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	99.74
COG1198		730	PriA Primosomal protein N' (replication factor Y)	99.73
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	99.73
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	99.73
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	99.71
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	99.67
CHL00122		870	secA preprotein translocase subunit SecA; Validate	99.65
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	99.63
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	99.63
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	99.6
PF06862		442	DUF1253: Protein of unknown function (DUF1253); In	99.6
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	99.58
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	99.56
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	99.53
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	99.51
KOG0949		1330	consensus Predicted helicase, DEAD-box superfamily	99.49
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	99.48
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.47
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	99.46
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	99.45
KOG2340		698	consensus Uncharacterized conserved protein [Funct	99.42
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	99.4
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	99.39
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	99.37
KOG1123		776	consensus RNA polymerase II transcription initiati	99.32
PF00271		78	Helicase_C: Helicase conserved C-terminal domain;	99.32
COG4889		1518	Predicted helicase [General function prediction on	99.3
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	99.3
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	99.26
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	99.25
PRK14873		665	primosome assembly protein PriA; Provisional	99.21
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	99.16
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	99.16
KOG0387		923	consensus Transcription-coupled repair protein CSB	99.12
KOG1000		689	consensus Chromatin remodeling protein HARP/SMARCA	99.11
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	99.03
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	99.02
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	99.02
KOG0384		1373	consensus Chromodomain-helicase DNA-binding protei	98.99
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	98.99
smart00490		82	HELICc helicase superfamily c-terminal domain.	98.96
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	98.92
PF07517		266	SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011	98.84
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	98.8
KOG0953		700	consensus Mitochondrial RNA helicase SUV3, DEAD-bo	98.8
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	98.73
COG0610		962	Type I site-specific restriction-modification syst	98.61
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	98.58
KOG1002		791	consensus Nucleotide excision repair protein RAD16	98.54
KOG0386		1157	consensus Chromatin remodeling complex SWI/SNF, co	98.45
KOG4439		901	consensus RNA polymerase II transcription terminat	98.43
TIGR00596		814	rad1 DNA repair protein (rad1). This family is bas	98.36
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	98.32
PRK15483		986	type III restriction-modification system StyLTI en	98.2
PF14617		252	CMS1: U3-containing 90S pre-ribosomal complex subu	98.04
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	97.95
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	97.94
PF12340		229	DUF3638: Protein of unknown function (DUF3638); In	97.89
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	97.73
PRK10875		615	recD exonuclease V subunit alpha; Provisional	97.61
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	97.57
KOG0921		1282	consensus Dosage compensation complex, subunit MLE	97.55
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	97.54
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	97.53
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	97.45
PRK10536		262	hypothetical protein; Provisional	97.29
PRK13889		988	conjugal transfer relaxase TraA; Provisional	97.28
PF13872		303	AAA_34: P-loop containing NTP hydrolase pore-1	97.28
TIGR00376		637	DNA helicase, putative. The gene product may repre	97.23
PF13307		167	Helicase_C_2: Helicase C-terminal domain; PDB: 4A1	97.23
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	97.15
PF13245		76	AAA_19: Part of AAA domain	97.1
KOG1132		945	consensus Helicase of the DEAD superfamily [Replic	97.0
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	96.93
COG3587		985	Restriction endonuclease [Defense mechanisms]	96.81
PRK14974		336	cell division protein FtsY; Provisional	96.74
KOG1803		649	consensus DNA helicase [Replication, recombination	96.73
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	96.68
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	96.65
PRK13826		1102	Dtr system oriT relaxase; Provisional	96.61
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	96.61
PHA02533		534	17 large terminase protein; Provisional	96.51
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	96.49
PRK04296		190	thymidine kinase; Provisional	96.47
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	96.42
PF03354		477	Terminase_1: Phage Terminase ; InterPro: IPR005021	96.2
TIGR01073		726	pcrA ATP-dependent DNA helicase PcrA. Designed to	96.2
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	96.16
COG1875		436	NYN ribonuclease and ATPase of PhoH family domains	96.14
KOG1805		1100	consensus DNA replication helicase [Replication, r	96.08
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	95.95
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	95.85
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	95.8
PRK06526		254	transposase; Provisional	95.69
PRK08181		269	transposase; Validated	95.65
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	95.56
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	95.26
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	95.23
PRK05642		234	DNA replication initiation factor; Validated	95.07
KOG1001		674	consensus Helicase-like transcription factor HLTF/	95.06
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	95.05
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	94.98
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	94.96
COG3421		812	Uncharacterized protein conserved in bacteria [Fun	94.94
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	94.9
KOG1015		1567	consensus Transcription regulator XNP/ATRX, DEAD-b	94.89
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	94.84
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	94.81
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	94.78
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	94.75
PRK08084		235	DNA replication initiation factor; Provisional	94.75
PF05127		177	Helicase_RecD: Helicase; InterPro: IPR007807 This	94.74
PRK06893		229	DNA replication initiation factor; Validated	94.71
PRK07952		244	DNA replication protein DnaC; Validated	94.7
PRK05707		328	DNA polymerase III subunit delta'; Validated	94.66
PRK08727		233	hypothetical protein; Validated	94.61
PRK14087		450	dnaA chromosomal replication initiation protein; P	94.57
PRK13833		323	conjugal transfer protein TrbB; Provisional	94.55
smart00382		148	AAA ATPases associated with a variety of cellular	94.45
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	94.42
PRK08769		319	DNA polymerase III subunit delta'; Validated	94.39
PRK00771		437	signal recognition particle protein Srp54; Provisi	94.34
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	94.34
PRK06835		329	DNA replication protein DnaC; Validated	94.26
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	94.26
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	94.23
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	94.23
PTZ00112		1164	origin recognition complex 1 protein; Provisional	94.15
PRK08903		227	DnaA regulatory inactivator Hda; Validated	94.1
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	94.03
PRK11054		684	helD DNA helicase IV; Provisional	94.02
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	93.88
PRK00149		450	dnaA chromosomal replication initiation protein; R	93.84
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	93.81
PRK06921		266	hypothetical protein; Provisional	93.77
TIGR01547		396	phage_term_2 phage terminase, large subunit, PBSX	93.73
PRK12422		445	chromosomal replication initiation protein; Provis	93.7
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	93.48
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	93.42
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	93.41
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	93.38
PRK08116		268	hypothetical protein; Validated	93.32
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	93.21
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	93.2
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	93.19
PRK11773		721	uvrD DNA-dependent helicase II; Provisional	93.16
PRK12402		337	replication factor C small subunit 2; Reviewed	93.07
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	93.06
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	93.04
TIGR01075		715	uvrD DNA helicase II. Designed to identify uvrD me	92.95
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	92.95
PRK00411		394	cdc6 cell division control protein 6; Reviewed	92.92
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	92.81
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	92.77
KOG1133		821	consensus Helicase of the DEAD superfamily [Replic	92.72
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	92.69
TIGR01074		664	rep ATP-dependent DNA helicase Rep. Designed to id	92.65
PRK10689		1147	transcription-repair coupling factor; Provisional	92.64
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	92.62
PRK14088		440	dnaA chromosomal replication initiation protein; P	92.6
PF13871		278	Helicase_C_4: Helicase_C-like	92.6
PRK12377		248	putative replication protein; Provisional	92.58
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	92.48
cd00984		242	DnaB_C DnaB helicase C terminal domain. The hexame	92.46
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	92.44
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	92.4
TIGR02785		1232	addA_Gpos recombination helicase AddA, Firmicutes	92.36
PRK14086		617	dnaA chromosomal replication initiation protein; P	92.34
PRK06871		325	DNA polymerase III subunit delta'; Validated	92.2
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	92.19
COG1484		254	DnaC DNA replication protein [DNA replication, rec	92.11
PHA03333		752	putative ATPase subunit of terminase; Provisional	92.08
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	91.97
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	91.93
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	91.82
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	91.72
PRK06964		342	DNA polymerase III subunit delta'; Validated	91.61
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	91.46
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	91.45
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	91.44
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	91.38
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	91.37
TIGR03600		421	phage_DnaB phage replicative helicase, DnaB family	91.37
cd03115		173	SRP The signal recognition particle (SRP) mediates	91.34
PRK10416		318	signal recognition particle-docking protein FtsY;	91.15
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	91.13
COG1435		201	Tdk Thymidine kinase [Nucleotide transport and met	91.12
PF03796		259	DnaB_C: DnaB-like helicase C terminal domain; Inte	90.79
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	90.76
TIGR00064		272	ftsY signal recognition particle-docking protein F	90.73
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	90.71
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	90.71
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	90.61
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	90.6
COG4626		546	Phage terminase-like protein, large subunit [Gener	90.49
PRK09183		259	transposase/IS protein; Provisional	90.47
PHA03368		738	DNA packaging terminase subunit 1; Provisional	90.39
PF05876		557	Terminase_GpA: Phage terminase large subunit (GpA)	90.39
PRK05973		237	replicative DNA helicase; Provisional	90.28
PRK08699		325	DNA polymerase III subunit delta'; Validated	90.2
PTZ00110		545	helicase; Provisional	90.16
PF06745		226	KaiC: KaiC; InterPro: IPR014774 This entry represe	90.14
KOG0298		1394	consensus DEAD box-containing helicase-like transc	90.08
PLN03025		319	replication factor C subunit; Provisional	90.06
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	89.99
PF02534		469	T4SS-DNA_transf: Type IV secretory system Conjugat	89.97
PRK06904		472	replicative DNA helicase; Validated	89.92
PRK00440		319	rfc replication factor C small subunit; Reviewed	89.91
PRK07471		365	DNA polymerase III subunit delta'; Validated	89.91
PRK09112		351	DNA polymerase III subunit delta'; Validated	89.78
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	89.71
KOG1133		821	consensus Helicase of the DEAD superfamily [Replic	89.71
cd01126		384	TraG_VirD4 The TraG/TraD/VirD4 family are bacteria	89.69
PRK13897		606	type IV secretion system component VirD4; Provisio	89.62
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	89.6
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	89.57
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	89.57
PRK07993		334	DNA polymerase III subunit delta'; Validated	89.5
CHL00181		287	cbbX CbbX; Provisional	89.48
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	89.46
PRK06090		319	DNA polymerase III subunit delta'; Validated	89.46
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	89.27
PRK13851		344	type IV secretion system protein VirB11; Provision	89.15
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	89.12
PRK08533		230	flagellar accessory protein FlaH; Reviewed	89.08
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	89.06
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	89.01
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	88.96
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	88.95
TIGR03877		237	thermo_KaiC_1 KaiC domain protein, Ph0284 family.	88.92
KOG3089		271	consensus Predicted DEAD-box-containing helicase [	88.89
TIGR00959		428	ffh signal recognition particle protein. This mode	88.88
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	88.87
PHA02544		316	44 clamp loader, small subunit; Provisional	88.85
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	88.78
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	88.64
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	88.64
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	88.42
PRK07004		460	replicative DNA helicase; Provisional	88.23
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	88.22
PF05729		166	NACHT: NACHT domain	88.07
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	88.07
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	87.85
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	87.76
PRK10867		433	signal recognition particle protein; Provisional	87.73
PRK09435		332	membrane ATPase/protein kinase; Provisional	87.62
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	87.61
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	87.47
KOG0354		746	consensus DEAD-box like helicase [General function	87.47
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	87.37
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	87.36
PTZ00424		401	helicase 45; Provisional	87.34
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	87.32
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	87.28
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	87.21
PF13173		128	AAA_14: AAA domain	87.17
TIGR00665		434	DnaB replicative DNA helicase. This model describe	87.12
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	87.09
PRK13850		670	type IV secretion system protein VirD4; Provisiona	87.09
PRK08006		471	replicative DNA helicase; Provisional	87.06
PF00004		132	AAA: ATPase family associated with various cellula	86.98
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	86.79
PRK05748		448	replicative DNA helicase; Provisional	86.63
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	86.51
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	86.41
PRK05298		652	excinuclease ABC subunit B; Provisional	86.3
PRK08840		464	replicative DNA helicase; Provisional	86.24
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	86.14
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	85.88
PF03237		384	Terminase_6: Terminase-like family; InterPro: IPR0	85.84
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	85.83
PRK13342		413	recombination factor protein RarA; Reviewed	85.6
PRK08760		476	replicative DNA helicase; Provisional	85.58
PHA00729		226	NTP-binding motif containing protein	85.57
PRK05636		505	replicative DNA helicase; Provisional	85.48
PRK07940		394	DNA polymerase III subunit delta'; Validated	85.47
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	85.44
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	85.37
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	85.32
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	85.23
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	84.86
KOG1015		1567	consensus Transcription regulator XNP/ATRX, DEAD-b	84.85
PRK08506		472	replicative DNA helicase; Provisional	84.84
PRK04195		482	replication factor C large subunit; Provisional	84.78
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	84.68
PRK13822		641	conjugal transfer coupling protein TraG; Provision	84.62
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	84.51
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	84.48
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	84.41
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	84.21
smart00492		141	HELICc3 helicase superfamily c-terminal domain.	84.16
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	84.1
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	83.93
PRK13876		663	conjugal transfer coupling protein TraG; Provision	83.5
PRK07399		314	DNA polymerase III subunit delta'; Validated	83.5
PF03969		362	AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654	83.4
TIGR02767		623	TraG-Ti Ti-type conjugative transfer system protie	83.27
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	83.07
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	82.9
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	82.88
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	82.81
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	82.72
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	82.64
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	82.64
PRK08939		306	primosomal protein DnaI; Reviewed	82.64
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	82.63
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	82.44
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	82.43
PRK04328		249	hypothetical protein; Provisional	82.41
PRK13767		876	ATP-dependent helicase; Provisional	82.36
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	82.3
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	82.27
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	82.24
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	82.2
TIGR03878		259	thermo_KaiC_2 KaiC domain protein, AF_0795 family.	82.18
TIGR00595		505	priA primosomal protein N'. All proteins in this f	82.09
COG3973		747	Superfamily I DNA and RNA helicases [General funct	82.05
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	82.04
KOG0701		1606	consensus dsRNA-specific nuclease Dicer and relate	82.03
PF12846		304	AAA_10: AAA-like domain	81.55
PRK06321		472	replicative DNA helicase; Provisional	81.35
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	81.31
PRK06067		234	flagellar accessory protein FlaH; Validated	81.3
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	81.12
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	81.02
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	80.79
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	80.74
PRK05595		444	replicative DNA helicase; Provisional	80.63
PRK09376		416	rho transcription termination factor Rho; Provisio	80.5
PF06733		174	DEAD_2: DEAD_2; InterPro: IPR010614 This represent	80.5
COG0630		312	VirB11 Type IV secretory pathway, VirB11 component	80.42
PRK09401		1176	reverse gyrase; Reviewed	80.42
PRK10436		462	hypothetical protein; Provisional	80.4
TIGR02688		449	conserved hypothetical protein TIGR02688. Members	80.39
PRK13341		725	recombination factor protein RarA/unknown domain f	80.17
KOG2036		1011	consensus Predicted P-loop ATPase fused to an acet	80.15
PHA02653		675	RNA helicase NPH-II; Provisional	80.08

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

Probab=100.00  E-value=1.7e-81  Score=629.58  Aligned_cols=497  Identities=23%  Similarity=0.302  Sum_probs=439.6

Q ss_pred             CCCCchHHHHhhhHHHHHhhhccCC-----CCchhHHHHHHHHHhhhcc---cCCcc----cccccccCCCCCCCccCcc
Q 008235            1 MTKGDDAVMRRRNKAKIKKLNNKNT-----SSNVSARVAAVIAAKKRRK---SGKRR----QCQGMCFSLPTLDDPFNDR   68 (573)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~---~~~~~----~~~~~~~~~~~~~~~~~~~   68 (573)
                      |||++|..++++++..+|++.++++     .-.++++++.+++.++++|   .+++.    .|++||+..|+.++||+.+
T Consensus        84 MA~~~d~~~sd~~~~e~kk~eRkn~dd~~p~~~vr~dI~~e~aae~~~kym~e~k~~~~~~e~~~~~leydsd~nPi~~~  163 (731)
T KOG0339|consen   84 MAKIEDQAQSDKKPLEQKKKERKNDDDDDPTATVRADIDEEDAAEALFKYMSENKRAGAAKECDDMCLEYDSDGNPIAPD  163 (731)
T ss_pred             hhhhhhhhhccCCccchHHHhhhccCCCccchhhhcchhhHHhHHHHHHHhhhcccchhhhhcccceeecCCCCCccCcc
Confidence            9999999999999999999877773     3457999999999999999   78877    8999999999999999873


Q ss_pred             c--chhhhhhhhhhhhccccccccccccccCCcccccccccccCCCCCCCcccchHHhhhcCcccccccccccccccccc
Q 008235           69 Y--DKRETETKATKKRNSLQLDKNKNAFVKGKSAVSKKETKRDNNEKPGHLEQTKEKAINLKNSQDKSLLFIDGVEKRTG  146 (573)
Q Consensus        69 ~--~~~~~~~~~~kk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~  146 (573)
                      +  ..+...                                            ++......+++++++|.++.++.....
T Consensus       164 kr~idpl~~--------------------------------------------idhs~i~y~p~~kdfy~e~esI~gl~~  199 (731)
T KOG0339|consen  164 KRQIDPLPP--------------------------------------------IDHSEIDYEPFNKDFYEEHESIEGLTK  199 (731)
T ss_pred             cccCCCCCC--------------------------------------------cchhhccccccccccccChhhhhcccc
Confidence            2  111111                                            111223456777888888777777655


Q ss_pred             c-----ccccceEEccCCCCCCCCCCCccccCCChHHHHHhHHHHHHHHHhCCCccCCCCCCCHHHHHHHHHHhcCCcEE
Q 008235          147 N-----VERAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDIL  221 (573)
Q Consensus       147 ~-----~~~~~i~~~g~~~~~~~~~~~~~~~~~p~~~~~~~~~~i~~~l~~~g~~~p~~~~~t~iQ~~aip~il~g~dvl  221 (573)
                      +     +...++.+.|.+.|.|  ..+|+.++|...+    +.++++    ..|.+|     ||||.+++|..+.|+||+
T Consensus       200 ~d~~~~r~~Lnlrv~g~s~~rp--vtsfeh~gfDkqL----m~airk----~Ey~kp-----tpiq~qalptalsgrdvi  264 (731)
T KOG0339|consen  200 MDVIDLRLTLNLRVSGSSPPRP--VTSFEHFGFDKQL----MTAIRK----SEYEKP-----TPIQCQALPTALSGRDVI  264 (731)
T ss_pred             ccchhhHhhhcceeccCCCCCC--cchhhhcCchHHH----HHHHhh----hhcccC-----Ccccccccccccccccch
Confidence            5     5568888899888877  6678888888777    666654    577888     999999999999999999


Q ss_pred             EEeCCCchhHHHHHHHHHHHHHHhchhccCCCCCCcEEEEEcccHHHHHHHHHHHhhh-hcCCcEEEEeCCCCCHHHHHH
Q 008235          222 ETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPL-KAFGIHTVSLHPGAAIDHQIT  300 (573)
Q Consensus       222 ~~A~TG~SGKTlaf~lp~l~~l~~~~~~~~~~~~~~~~Lil~PtreLa~Qi~~~~~~l-~~~~i~~~~~~gg~~~~~~~~  300 (573)
                      ++|.|| ||||.||+.|++.++..++....  +.||.+||||||||||.||+.+|++| +.+||+++++|||.+.++|..
T Consensus       265 gIAktg-SgktaAfi~pm~~himdq~eL~~--g~gPi~vilvPTrela~Qi~~eaKkf~K~ygl~~v~~ygGgsk~eQ~k  341 (731)
T KOG0339|consen  265 GIAKTG-SGKTAAFIWPMIVHIMDQPELKP--GEGPIGVILVPTRELASQIFSEAKKFGKAYGLRVVAVYGGGSKWEQSK  341 (731)
T ss_pred             heeecc-CcchhHHHHHHHHHhcchhhhcC--CCCCeEEEEeccHHHHHHHHHHHHHhhhhccceEEEeecCCcHHHHHH
Confidence            999999 99999999999999998876653  37999999999999999999999999 667999999999999999999


Q ss_pred             HhhcCCCcEEEeCHHHHHHHHHcCCCCCCCccEEEEeCcccccC---cchHHHHHHhcCCCCcEEEEeccCCccHHHHHH
Q 008235          301 GLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSK---GDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQ  377 (573)
Q Consensus       301 ~l~~~~~~IlV~TP~rL~~~l~~~~~~l~~l~~lViDEad~ll~---~~~l~~Il~~l~~~~q~l~~SAT~~~~~~~~~~  377 (573)
                      .|.. +++|||||||||++++..+..++.++.||||||||+|++   ..+++.|.+.+++++|+++||||++..++.+++
T Consensus       342 ~Lk~-g~EivVaTPgRlid~VkmKatn~~rvS~LV~DEadrmfdmGfe~qVrSI~~hirpdrQtllFsaTf~~kIe~lar  420 (731)
T KOG0339|consen  342 ELKE-GAEIVVATPGRLIDMVKMKATNLSRVSYLVLDEADRMFDMGFEPQVRSIKQHIRPDRQTLLFSATFKKKIEKLAR  420 (731)
T ss_pred             hhhc-CCeEEEechHHHHHHHHhhcccceeeeEEEEechhhhhccccHHHHHHHHhhcCCcceEEEeeccchHHHHHHHH
Confidence            9997 899999999999999999999999999999999999999   899999999999999999999999999999999


Q ss_pred             HHhcCCceEEEcCCCccccccceEEEEEEcCChhHHHHHHHHHHHHHhccCCCCCCCcEEEEecChhhHHHHHHHHHHCC
Q 008235          378 NLLLGSINRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKG  457 (573)
Q Consensus       378 ~~l~~~~~~i~~~~~~~~~~~~i~~~~~~~~~~~~k~~~l~~~L~~~~~~~~~~~~~k~lIF~~s~~~~~~l~~~L~~~g  457 (573)
                      .+|.+|+. +..+. ....+..|.|.+.+|.+++.|+.+|+.-|-.+..      .+++|||+.-...+++++..|+..+
T Consensus       421 d~L~dpVr-vVqg~-vgean~dITQ~V~V~~s~~~Kl~wl~~~L~~f~S------~gkvlifVTKk~~~e~i~a~Lklk~  492 (731)
T KOG0339|consen  421 DILSDPVR-VVQGE-VGEANEDITQTVSVCPSEEKKLNWLLRHLVEFSS------EGKVLIFVTKKADAEEIAANLKLKG  492 (731)
T ss_pred             HHhcCCee-EEEee-hhccccchhheeeeccCcHHHHHHHHHHhhhhcc------CCcEEEEEeccCCHHHHHHHhcccc
Confidence            99999984 44443 3577889999999999999999988888877654      5799999999999999999999999


Q ss_pred             CCeeeecCCCHHH-----HHHHHHhcCCCCCeEEEEeccccCCCccCCCCEEEeCCCCCCHHHHHHHHhccccCCCcceE
Q 008235          458 YSISTGSNCIVSH-----IKNSVEADGRKRPAVSMIDKDHISTAELEEYEVVIVPDFIISMKNYVEILTSMARHTVSGIL  532 (573)
Q Consensus       458 ~~~~~~~~~~~~~-----~l~~F~~~g~~~~l~~lvd~~s~rGlDip~v~~VI~~d~P~s~~~YiqR~GR~gR~g~~G~~  532 (573)
                      +++.. +||++.|     +|..| +.++..++++ +|++ +||+||+++..|||||+-++++.|.||+|||||+|..|.+
T Consensus       493 ~~v~l-lhgdkdqa~rn~~ls~f-Kkk~~~Vlva-tDva-argldI~~ikTVvnyD~ardIdththrigrtgRag~kGva  568 (731)
T KOG0339|consen  493 FNVSL-LHGDKDQAERNEVLSKF-KKKRKPVLVA-TDVA-ARGLDIPSIKTVVNYDFARDIDTHTHRIGRTGRAGEKGVA  568 (731)
T ss_pred             ceeee-ecCchhhHHHHHHHHHH-hhcCCceEEE-eeHh-hcCCCccccceeecccccchhHHHHHHhhhccccccccee
Confidence            99986 5998765     69999 8888888877 7999 6999999999999999999999999999999999999999


Q ss_pred             EEEeccccHHHHHHHHHHHHHcCCCCCHHHHHhhhcCCCC
Q 008235          533 HSFFTKDDAAHAGQMIEILEQCGQVVPDALRDLCHTSPML  572 (573)
Q Consensus       533 i~~~~~~d~~~~~~l~~~l~~~~~~vp~~l~~~~~~~~~~  572 (573)
                      +++++++|..++..|++.|+.++|.||+.|..|+-.+++.
T Consensus       569 yTlvTeKDa~fAG~LVnnLe~agQnVP~~l~dlamk~s~f  608 (731)
T KOG0339|consen  569 YTLVTEKDAEFAGHLVNNLEGAGQNVPDELMDLAMKSSWF  608 (731)
T ss_pred             eEEechhhHHHhhHHHHHHhhccccCChHHHHHHhhhhhh
Confidence            9999999999999999999999999999999999877663

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only]	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ]	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>KOG2340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription]	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>smart00490 HELICc helicase superfamily c-terminal domain	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>TIGR00596 rad1 DNA repair protein (rad1)	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional	Back alignment and domain information

>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

>COG3587 Restriction endonuclease [Defense mechanisms]	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>PHA02533 17 large terminase protein; Provisional	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase)	Back alignment and domain information

>TIGR01073 pcrA ATP-dependent DNA helicase PcrA	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only]	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>COG3421 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription]	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PRK11773 uvrD DNA-dependent helicase II; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>TIGR01075 uvrD DNA helicase II	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>TIGR01074 rep ATP-dependent DNA helicase Rep	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF13871 Helicase_C_4: Helicase_C-like	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>cd00984 DnaB_C DnaB helicase C terminal domain	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>COG4626 Phage terminase-like protein, large subunit [General function prediction only]	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PHA03368 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues	Back alignment and domain information

>PRK06904 replicative DNA helicase; Validated	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion	Back alignment and domain information

>PRK13897 type IV secretion system component VirD4; Provisional	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family	Back alignment and domain information

>KOG3089 consensus Predicted DEAD-box-containing helicase [General function prediction only]	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>PRK07004 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK09435 membrane ATPase/protein kinase; Provisional	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>TIGR00665 DnaB replicative DNA helicase	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13850 type IV secretion system protein VirD4; Provisional	Back alignment and domain information

>PRK08006 replicative DNA helicase; Provisional	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05748 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>PRK08840 replicative DNA helicase; Provisional	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging []	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>PRK08760 replicative DNA helicase; Provisional	Back alignment and domain information

>PHA00729 NTP-binding motif containing protein	Back alignment and domain information

>PRK05636 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription]	Back alignment and domain information

>PRK08506 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13822 conjugal transfer coupling protein TraG; Provisional	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>smart00492 HELICc3 helicase superfamily c-terminal domain	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13876 conjugal transfer coupling protein TraG; Provisional	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP	Back alignment and domain information

>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>PRK04328 hypothetical protein; Provisional	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification]	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>PRK06321 replicative DNA helicase; Provisional	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK05595 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK09376 rho transcription termination factor Rho; Provisional	Back alignment and domain information

>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin	Back alignment and domain information

>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02688 conserved hypothetical protein TIGR02688	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>KOG2036 consensus Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		573
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	7e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-04
3iuy_A		228	Probable ATP-dependent RNA helicase DDX53; REC-A-l	1e-06
2jgn_A		185	DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp	4e-06
3bor_A		237	Human initiation factor 4A-II; translation initiat	1e-05
2i4i_A		417	ATP-dependent RNA helicase DDX3X; DEAD, structural	2e-05
3eiq_A		414	Eukaryotic initiation factor 4A-I; PDCD4, anti-onc	2e-05
3fe2_A		242	Probable ATP-dependent RNA helicase DDX5; DEAD, AD	2e-05
2gxq_A		207	Heat resistant RNA dependent ATPase; RNA helicase,	2e-05
1xti_A		391	Probable ATP-dependent RNA helicase P47; alpha-bet	5e-05
1t6n_A		220	Probable ATP-dependent RNA helicase; RECA-like fol	5e-05
1vec_A		206	ATP-dependent RNA helicase P54; DEAD-box protein,	8e-05
1q0u_A		219	Bstdead; DEAD protein, RNA binding protein; 1.85A	1e-04
2oxc_A		230	Probable ATP-dependent RNA helicase DDX20; DEAD, s	1e-04
1s2m_A		400	Putative ATP-dependent RNA helicase DHH1; ATP-bind	1e-04
2p6n_A		191	ATP-dependent RNA helicase DDX41; DEAD, structural	1e-04
1fuu_A		394	Yeast initiation factor 4A; IF4A, helicase, DEAD-b	2e-04
1qde_A		224	EIF4A, translation initiation factor 4A; DEAD box	2e-04
2z0m_A		337	337AA long hypothetical ATP-dependent RNA helicase	2e-04
2db3_A		434	ATP-dependent RNA helicase VASA; DEAD-BOX, protein	4e-04
1hv8_A		367	Putative ATP-dependent RNA helicase MJ0669; RNA-bi	7e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 70.7 bits (172), Expect = 7e-13
 Identities = 90/620 (14%), Positives = 198/620 (31%), Gaps = 170/620 (27%)

Query: 58  LPTLDDPFNDRYDKRETE--TKA--TKK--RNSLQLDKNKNA----F----VKGKSAVSK 103
           L   +D F D +D ++ +   K+  +K+   + +      +     F     K +  V K
Sbjct: 22  LSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQK 81

Query: 104 --KETKRDNNE---KPGHLEQTKEKAINLKN-SQDKSLLFIDGVEKRTGNVERAEVHLNG 157
             +E  R N +    P    + ++ ++  +   + +  L+ D       NV R + +L  
Sbjct: 82  FVEEVLRINYKFLMSPIK-TEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKL 140

Query: 158 KSCANGHHGQACEKLDCPSKFLIL---------CLNAIENAMRHDGVEQDNPLFVNSWGI 208
           +        QA  +L  P+K +++          + A++       V+         + I
Sbjct: 141 R--------QALLELR-PAKNVLIDGVLGSGKTWV-ALD-VCLSYKVQCKMD-----FKI 184

Query: 209 EFW---KCYSSAKDILETSGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSS 265
            FW   K  +S + +LE       + QI     + +D  +  +    S        L S 
Sbjct: 185 -FWLNLKNCNSPETVLEM--LQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSK 241

Query: 266 QEKAA--KVRSVCKP--LKAFGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLV 321
             +     + +V       AF +                    C  + L++T  R  ++ 
Sbjct: 242 PYENCLLVLLNVQNAKAWNAFNLS-------------------C--KILLTT--RFKQVT 278

Query: 322 -SLKAIDVSGVSLLVVDRLDSLSKGDTLSLIRQSISGK----PHTVVFNDCLTYTSVPAV 376
             L A   + +SL       +L+  +  SL+ + +  +    P  V+  +    + +   
Sbjct: 279 DFLSAATTTHISL--DHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNPRRLSIIAE- 335

Query: 377 QNLLLGSINRLS-LNQSVASQSACIIQ-SVNVCASDEEK-------IL-KGIQVLDHAYG 426
              +   +            +   II+ S+NV    E +       +      +      
Sbjct: 336 --SIRDGLATWDNWKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSAHI------ 387

Query: 427 DHFHSEPLKVLYIVGKDSKFQNLVSTL-KCKGYSISTGSNC--IVS----HIKNSVEADG 479
                 P  +L ++  D    +++  + K   YS+         +S    +++  V+ + 
Sbjct: 388 ------PTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTISIPSIYLELKVKLEN 441

Query: 480 RKRPAVSMIDK-----------------D---------HISTAELEEYEVVIVP----DF 509
                 S++D                  D         H+   E  E  + +      DF
Sbjct: 442 EYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPE-RMTLFRMVFLDF 500

Query: 510 IISMKNYVE---ILTSMARHTVSGILH---------SFFTKDDAAHA---GQMIEILEQC 554
                 ++E      S A +    IL+          +   +D  +      +++ L + 
Sbjct: 501 -----RFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAILDFLPKI 555

Query: 555 GQ-VVPDALRDLCHTSPMLE 573
            + ++     DL   + M E
Sbjct: 556 EENLICSKYTDLLRIALMAE 575

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228	Back alignment and structure

>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Length = 185	Back alignment and structure

>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237	Back alignment and structure

>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417	Back alignment and structure

>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414	Back alignment and structure

>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242	Back alignment and structure

>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207	Back alignment and structure

>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391	Back alignment and structure

>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220	Back alignment and structure

>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206	Back alignment and structure

>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219	Back alignment and structure

>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230	Back alignment and structure

>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400	Back alignment and structure

>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Length = 191	Back alignment and structure

>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394	Back alignment and structure

>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224	Back alignment and structure

>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337	Back alignment and structure

>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434	Back alignment and structure

>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		573
2db3_A		434	ATP-dependent RNA helicase VASA; DEAD-BOX, protein	100.0
2i4i_A		417	ATP-dependent RNA helicase DDX3X; DEAD, structural	100.0
2j0s_A		410	ATP-dependent RNA helicase DDX48; mRNA processing,	100.0
3eiq_A		414	Eukaryotic initiation factor 4A-I; PDCD4, anti-onc	100.0
1s2m_A		400	Putative ATP-dependent RNA helicase DHH1; ATP-bind	100.0
1xti_A		391	Probable ATP-dependent RNA helicase P47; alpha-bet	100.0
3sqw_A		579	ATP-dependent RNA helicase MSS116, mitochondrial;	100.0
3i5x_A		563	ATP-dependent RNA helicase MSS116; protein-RNA com	100.0
3fmp_B		479	ATP-dependent RNA helicase DDX19B; nuclear porin,	100.0
3fht_A		412	ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box	100.0
1fuu_A		394	Yeast initiation factor 4A; IF4A, helicase, DEAD-b	100.0
1hv8_A		367	Putative ATP-dependent RNA helicase MJ0669; RNA-bi	100.0
3pey_A		395	ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A	100.0
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	100.0
2z0m_A		337	337AA long hypothetical ATP-dependent RNA helicase	100.0
2v1x_A		591	ATP-dependent DNA helicase Q1; DNA strand annealin	100.0
4ddu_A		1104	Reverse gyrase; topoisomerase, DNA supercoiling, a	100.0
3fho_A		508	ATP-dependent RNA helicase DBP5; mRNA export, ATPa	100.0
1tf5_A		844	Preprotein translocase SECA subunit; ATPase, helic	100.0
1oyw_A		523	RECQ helicase, ATP-dependent DNA helicase; winged	100.0
3l9o_A		1108	ATP-dependent RNA helicase DOB1; REC-A fold, winge	100.0
1gku_B		1054	Reverse gyrase, TOP-RG; topoisomerase, DNA superco	100.0
2fsf_A		853	Preprotein translocase SECA subunit; ATPase, DNA-R	100.0
2ykg_A		696	Probable ATP-dependent RNA helicase DDX58; hydrola	100.0
4a2p_A		556	RIG-I, retinoic acid inducible protein I; hydrolas	100.0
3tbk_A		555	RIG-I helicase domain; DECH helicase, ATP binding,	100.0
1nkt_A		922	Preprotein translocase SECA 1 subunit; preprotein	100.0
4a2q_A		797	RIG-I, retinoic acid inducible protein I; hydrolas	100.0
2p6r_A		702	Afuhel308 helicase; protein-DNA complex, SF2 helic	100.0
2zj8_A		720	DNA helicase, putative SKI2-type helicase; RECA fo	100.0
2va8_A		715	SSO2462, SKI2-type helicase; hydrolase, DNA repair	100.0
2xgj_A		1010	ATP-dependent RNA helicase DOB1; hydrolase-RNA com	100.0
1wp9_A		494	ATP-dependent RNA helicase, putative; ATPase, DNA	100.0
4gl2_A		699	Interferon-induced helicase C domain-containing P;	100.0
4a2w_A		936	RIG-I, retinoic acid inducible protein I; hydrolas	100.0
2whx_A		618	Serine protease/ntpase/helicase NS3; transcription	100.0
2jlq_A		451	Serine protease subunit NS3; ribonucleoprotein, nu	100.0
4a4z_A		997	Antiviral helicase SKI2; hydrolase, ATPase, mRNA d	100.0
1gm5_A		780	RECG; helicase, replication restart; HET: DNA ADP;	100.0
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	100.0
1yks_A		440	Genome polyprotein [contains: flavivirin protease	100.0
3fe2_A		242	Probable ATP-dependent RNA helicase DDX5; DEAD, AD	100.0
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	100.0
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	100.0
2eyq_A		1151	TRCF, transcription-repair coupling factor; MFD, S	100.0
3o8b_A		666	HCV NS3 protease/helicase; ntpase, RNA, translocat	100.0
2oca_A		510	DAR protein, ATP-dependent DNA helicase UVSW; ATP-	100.0
3fmo_B		300	ATP-dependent RNA helicase DDX19B; nuclear porin,	100.0
2z83_A		459	Helicase/nucleoside triphosphatase; hydrolase, mem	100.0
3iuy_A		228	Probable ATP-dependent RNA helicase DDX53; REC-A-l	100.0
1wrb_A		253	DJVLGB; RNA helicase, DEAD BOX, VASA, structural g	100.0
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	100.0
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	100.0
2fwr_A		472	DNA repair protein RAD25; DNA unwinding, XPB, DNA	100.0
3ber_A		249	Probable ATP-dependent RNA helicase DDX47; DEAD, A	100.0
3h1t_A		590	Type I site-specific restriction-modification syst	100.0
1vec_A		206	ATP-dependent RNA helicase P54; DEAD-box protein,	100.0
3bor_A		237	Human initiation factor 4A-II; translation initiat	100.0
1q0u_A		219	Bstdead; DEAD protein, RNA binding protein; 1.85A	100.0
3ly5_A		262	ATP-dependent RNA helicase DDX18; alpha-beta, stru	100.0
3dkp_A		245	Probable ATP-dependent RNA helicase DDX52; DEAD, A	100.0
2oxc_A		230	Probable ATP-dependent RNA helicase DDX20; DEAD, s	100.0
1t6n_A		220	Probable ATP-dependent RNA helicase; RECA-like fol	100.0
2pl3_A		236	Probable ATP-dependent RNA helicase DDX10; DEAD, s	100.0
2gxq_A		207	Heat resistant RNA dependent ATPase; RNA helicase,	100.0
1qde_A		224	EIF4A, translation initiation factor 4A; DEAD box	100.0
3jux_A		822	Protein translocase subunit SECA; protein transloc	100.0
2w00_A		1038	HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri	99.98
3rc3_A		677	ATP-dependent RNA helicase SUPV3L1, mitochondrial;	99.97
2ipc_A		997	Preprotein translocase SECA subunit; nucleotide bi	99.97
3dmq_A		968	RNA polymerase-associated protein RAPA; SWF2/SNF2,	99.96
1z63_A		500	Helicase of the SNF2/RAD54 hamily; protein-DNA com	99.96
2p6n_A		191	ATP-dependent RNA helicase DDX41; DEAD, structural	99.95
2jgn_A		185	DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp	99.94
1z3i_X		644	Similar to RAD54-like; recombination ATPase helica	99.94
1c4o_A		664	DNA nucleotide excision repair enzyme UVRB; uvrabc	99.93
3mwy_W		800	Chromo domain-containing protein 1; SWI2/SNF2 ATPa	99.93
2d7d_A		661	Uvrabc system protein B; helicase, protein-DNA-ADP	99.92
3b6e_A		216	Interferon-induced helicase C domain-containing P;	99.92
2hjv_A		163	ATP-dependent RNA helicase DBPA; parallel alpha-be	99.91
1t5i_A		172	C_terminal domain of A probable ATP-dependent RNA	99.91
2rb4_A		175	ATP-dependent RNA helicase DDX25; rossmann fold, s	99.91
1fuk_A		165	Eukaryotic initiation factor 4A; helicase, DEAD-bo	99.91
3llm_A		235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	99.89
3eaq_A		212	Heat resistant RNA dependent ATPase; DEAD box RNA	99.88
2vl7_A		540	XPD; helicase, unknown function; 2.25A {Sulfolobus	99.87
3i32_A		300	Heat resistant RNA dependent ATPase; RNA helicase,	99.87
1rif_A		282	DAR protein, DNA helicase UVSW; bacteriophage, REC	99.86
2yjt_D		170	ATP-dependent RNA helicase SRMB, regulator of ribo	99.75
3crv_A		551	XPD/RAD3 related DNA helicase; XPD helicase DNA re	99.84
2fz4_A		237	DNA repair protein RAD25; RECA-like domain, DNA da	99.78
4a15_A		620	XPD helicase, ATP-dependent DNA helicase TA0057; h	99.68
1z5z_A		271	Helicase of the SNF2/RAD54 family; hydrolase, reco	99.5
1w36_D		608	RECD, exodeoxyribonuclease V alpha chain; recombin	99.08
3e1s_A		574	Exodeoxyribonuclease V, subunit RECD; alpha and be	98.0
2gk6_A		624	Regulator of nonsense transcripts 1; UPF1, helicas	97.94
2xzl_A		802	ATP-dependent helicase NAM7; hydrolase-RNA complex	97.84
2wjy_A		800	Regulator of nonsense transcripts 1; nonsense medi	97.8
3lfu_A		647	DNA helicase II; SF1 helicase, ATP-binding, DNA da	97.71
3upu_A		459	ATP-dependent DNA helicase DDA; RECA-like domain,	97.7
4b3f_X		646	DNA-binding protein smubp-2; hydrolase, helicase;	97.57
2o0j_A		385	Terminase, DNA packaging protein GP17; nucleotide-	97.35
3cpe_A		592	Terminase, DNA packaging protein GP17; large termi	97.03
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	96.25
3vkw_A		446	Replicase large subunit; alpha/beta domain, helica	96.09
2hjv_A		163	ATP-dependent RNA helicase DBPA; parallel alpha-be	95.12
2b8t_A		223	Thymidine kinase; deoxyribonucleoside kinase, zinc	95.01
2p6n_A		191	ATP-dependent RNA helicase DDX41; DEAD, structural	94.81
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	94.66
2rb4_A		175	ATP-dependent RNA helicase DDX25; rossmann fold, s	94.58
3hgt_A		328	HDA1 complex subunit 3; RECA-like domain, SWI2/SNF	94.55
3eaq_A		212	Heat resistant RNA dependent ATPase; DEAD box RNA	94.5
2orw_A		184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	94.48
1xx6_A		191	Thymidine kinase; NESG, northeast structural genom	94.41
1fuk_A		165	Eukaryotic initiation factor 4A; helicase, DEAD-bo	94.28
1pjr_A		724	PCRA; DNA repair, DNA replication, SOS response, h	94.27
1uaa_A		673	REP helicase, protein (ATP-dependent DNA helicase	94.0
3u4q_A		1232	ATP-dependent helicase/nuclease subunit A; helicas	93.92
1t5i_A		172	C_terminal domain of A probable ATP-dependent RNA	93.78
3kl4_A		433	SRP54, signal recognition 54 kDa protein; signal r	93.7
3bos_A		242	Putative DNA replication factor; P-loop containing	93.68
2j9r_A		214	Thymidine kinase; TK1, DNK, lasso, transferase, AT	93.47
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	93.38
2chg_A		226	Replication factor C small subunit; DNA-binding pr	92.99
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	92.94
2zpa_A		671	Uncharacterized protein YPFI; RNA modification enz	92.89
3e2i_A		219	Thymidine kinase; Zn-binding, ATP-binding, DNA syn	92.75
3i5x_A		563	ATP-dependent RNA helicase MSS116; protein-RNA com	92.69
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	92.32
3dm5_A		443	SRP54, signal recognition 54 kDa protein; protein-	92.3
3i32_A		300	Heat resistant RNA dependent ATPase; RNA helicase,	92.29
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	92.25
3sqw_A		579	ATP-dependent RNA helicase MSS116, mitochondrial;	91.88
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	91.79
2jgn_A		185	DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp	91.54
1g5t_A		196	COB(I)alamin adenosyltransferase; P-loop protein,	91.52
4a1f_A		338	DNAB helicase, replicative DNA helicase; hydrolase	91.41
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	91.27
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	91.21
2i4i_A		417	ATP-dependent RNA helicase DDX3X; DEAD, structural	90.22
3pey_A		395	ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A	89.86
3fht_A		412	ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box	89.78
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	89.78
2qgz_A		308	Helicase loader, putative primosome component; str	89.63
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	89.53
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	89.29
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	89.14
2d7d_A		661	Uvrabc system protein B; helicase, protein-DNA-ADP	88.68
1oyw_A		523	RECQ helicase, ATP-dependent DNA helicase; winged	88.6
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	88.45
2j0s_A		410	ATP-dependent RNA helicase DDX48; mRNA processing,	88.34
1w4r_A		195	Thymidine kinase; type II, human, cytosolic, phosp	88.2
2v1x_A		591	ATP-dependent DNA helicase Q1; DNA strand annealin	88.15
2db3_A		434	ATP-dependent RNA helicase VASA; DEAD-BOX, protein	88.08
1hv8_A		367	Putative ATP-dependent RNA helicase MJ0669; RNA-bi	87.94
1c4o_A		664	DNA nucleotide excision repair enzyme UVRB; uvrabc	87.64
1s2m_A		400	Putative ATP-dependent RNA helicase DHH1; ATP-bind	87.55
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	87.5
2r6a_A		454	DNAB helicase, replicative helicase; replication,	87.49
2yjt_D		170	ATP-dependent RNA helicase SRMB, regulator of ribo	87.08
1xti_A		391	Probable ATP-dependent RNA helicase P47; alpha-bet	86.8
1yks_A		440	Genome polyprotein [contains: flavivirin protease	86.78
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	86.57
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	86.25
3pfi_A		338	Holliday junction ATP-dependent DNA helicase RUVB;	85.81
2orv_A		234	Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2	85.74
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	85.64
3bh0_A		315	DNAB-like replicative helicase; ATPase, replicatio	85.62
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	84.26
2q6t_A		444	DNAB replication FORK helicase; hydrolase; 2.90A {	84.12
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	83.95
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	83.55
1wp9_A		494	ATP-dependent RNA helicase, putative; ATPase, DNA	83.5
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	83.43
3hjh_A		483	Transcription-repair-coupling factor; MFD, mutatio	82.57
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	82.51
3vfd_A		389	Spastin; ATPase, microtubule severing, hydrolase;	82.37
2px0_A		296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	81.88
2gno_A		305	DNA polymerase III, gamma subunit-related protein;	81.6
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	81.04
2l8b_A		189	Protein TRAI, DNA helicase I; RECD, hydrolase; NMR	80.92
3rc3_A		677	ATP-dependent RNA helicase SUPV3L1, mitochondrial;	80.63
2oca_A		510	DAR protein, ATP-dependent DNA helicase UVSW; ATP-	80.31
4b4t_J		405	26S protease regulatory subunit 8 homolog; hydrola	80.13

>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster}	Back alignment and structure

Probab=100.00  E-value=1.7e-63  Score=533.14  Aligned_cols=382  Identities=16%  Similarity=0.213  Sum_probs=333.1

Q ss_pred             ccceEEccCCCCCCCCCCCccccCCChHHHHHhHHHHHHHHHhCCCccCCCCCCCHHHHHHHHHHhcCCcEEEEeCCCch
Q 008235          150 RAEVHLNGKSCANGHHGQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSST  229 (573)
Q Consensus       150 ~~~i~~~g~~~~~~~~~~~~~~~~~p~~~~~~~~~~i~~~l~~~g~~~p~~~~~t~iQ~~aip~il~g~dvl~~A~TG~S  229 (573)
                      ...+.+.|.+.|.+  ..+|++.++++.+    ++    ++...||.+|     ||+|.++||.+++|+|++++|||| |
T Consensus        41 ~~~~~~~~~~~p~~--~~~f~~~~l~~~l----~~----~l~~~g~~~p-----t~iQ~~ai~~i~~g~d~i~~a~TG-s  104 (434)
T 2db3_A           41 NIPVKVTGSDVPQP--IQHFTSADLRDII----ID----NVNKSGYKIP-----TPIQKCSIPVISSGRDLMACAQTG-S  104 (434)
T ss_dssp             GSCEEEESSSCCCC--CCCGGGSCCCHHH----HH----HHHHTTCCSC-----CHHHHHHHHHHHTTCCEEEECCTT-S
T ss_pred             CceeEecCCCCCCC--cCChhhcCCCHHH----HH----HHHHcCCCCC-----CHHHHHHHHHHhcCCCEEEECCCC-C
Confidence            34577888888766  6678888877766    44    4556899999     999999999999999999999999 9


Q ss_pred             hHHHHHHHHHHHHHHhchhccCCCCCCcEEEEEcccHHHHHHHHHHHhhhhc-CCcEEEEeCCCCCHHHHHHHhhcCCCc
Q 008235          230 IVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKA-FGIHTVSLHPGAAIDHQITGLRSCEPE  308 (573)
Q Consensus       230 GKTlaf~lp~l~~l~~~~~~~~~~~~~~~~Lil~PtreLa~Qi~~~~~~l~~-~~i~~~~~~gg~~~~~~~~~l~~~~~~  308 (573)
                      |||++|++|++.++.......  ...++++|||+||||||.|+++.++.+.. .++++++++||.....+...+.. +++
T Consensus       105 GKT~a~~lpil~~l~~~~~~~--~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~-~~~  181 (434)
T 2db3_A          105 GKTAAFLLPILSKLLEDPHEL--ELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITR-GCH  181 (434)
T ss_dssp             SHHHHHHHHHHHHHHHSCCCC--CTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHHTT-CCS
T ss_pred             CchHHHHHHHHHHHHhccccc--ccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHhhc-CCC
Confidence            999999999999998754221  12578999999999999999999999844 58999999999999988888887 899


Q ss_pred             EEEeCHHHHHHHHHcCCCCCCCccEEEEeCcccccC---cchHHHHHHhc--CCCCcEEEEeccCCccHHHHHHHHhcCC
Q 008235          309 FLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSLSK---GDTLSLIRQSI--SGKPHTVVFNDCLTYTSVPAVQNLLLGS  383 (573)
Q Consensus       309 IlV~TP~rL~~~l~~~~~~l~~l~~lViDEad~ll~---~~~l~~Il~~l--~~~~q~l~~SAT~~~~~~~~~~~~l~~~  383 (573)
                      |+|+|||+|++++.++.+.++++++|||||||+|++   ..++..|+..+  ++++|+++||||+|..+..++..++.++
T Consensus       182 Ivv~Tp~~l~~~l~~~~~~l~~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~  261 (434)
T 2db3_A          182 VVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNY  261 (434)
T ss_dssp             EEEECHHHHHHHHHTTSCCCTTCCEEEEETHHHHTSTTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSC
T ss_pred             EEEEChHHHHHHHHhCCcccccCCeEEEccHhhhhccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCC
Confidence            999999999999999888999999999999999998   67888998875  6789999999999999999999999988


Q ss_pred             ceEEEcCCCccccccceEEEEEEcCChhHHHHHHHHHHHHHhccCCCCCCCcEEEEecChhhHHHHHHHHHHCCCCeeee
Q 008235          384 INRLSLNQSVASQSACIIQSVNVCASDEEKILKGIQVLDHAYGDHFHSEPLKVLYIVGKDSKFQNLVSTLKCKGYSISTG  463 (573)
Q Consensus       384 ~~~i~~~~~~~~~~~~i~~~~~~~~~~~~k~~~l~~~L~~~~~~~~~~~~~k~lIF~~s~~~~~~l~~~L~~~g~~~~~~  463 (573)
                      . .+.++.. .....++.|.+..+. ...|...|.++|...        ..++||||+++..|+.++..|...|+.+..+
T Consensus       262 ~-~i~~~~~-~~~~~~i~~~~~~~~-~~~k~~~l~~~l~~~--------~~~~lVF~~t~~~a~~l~~~L~~~~~~~~~l  330 (434)
T 2db3_A          262 V-FVAIGIV-GGACSDVKQTIYEVN-KYAKRSKLIEILSEQ--------ADGTIVFVETKRGADFLASFLSEKEFPTTSI  330 (434)
T ss_dssp             E-EEEESST-TCCCTTEEEEEEECC-GGGHHHHHHHHHHHC--------CTTEEEECSSHHHHHHHHHHHHHTTCCEEEE
T ss_pred             E-EEEeccc-cccccccceEEEEeC-cHHHHHHHHHHHHhC--------CCCEEEEEeCcHHHHHHHHHHHhCCCCEEEE
Confidence            6 6776654 355678999999886 677888887777663        3469999999999999999999999999864


Q ss_pred             cCCC-----HHHHHHHHHhcCCCCCeEEEEeccccCCCccCCCCEEEeCCCCCCHHHHHHHHhccccCCCcceEEEEecc
Q 008235          464 SNCI-----VSHIKNSVEADGRKRPAVSMIDKDHISTAELEEYEVVIVPDFIISMKNYVEILTSMARHTVSGILHSFFTK  538 (573)
Q Consensus       464 ~~~~-----~~~~l~~F~~~g~~~~l~~lvd~~s~rGlDip~v~~VI~~d~P~s~~~YiqR~GR~gR~g~~G~~i~~~~~  538 (573)
                       ||+     |.++++.| ++|+..+|++ ||++ +||||+|+|++|||||+|.++++|+||+|||||+|+.|.|++|+++
T Consensus       331 -hg~~~~~~R~~~l~~F-~~g~~~vLva-T~v~-~rGlDi~~v~~VI~~d~p~~~~~y~qriGR~gR~g~~G~a~~~~~~  406 (434)
T 2db3_A          331 -HGDRLQSQREQALRDF-KNGSMKVLIA-TSVA-SRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDP  406 (434)
T ss_dssp             -STTSCHHHHHHHHHHH-HTSSCSEEEE-CGGG-TSSCCCTTCCEEEESSCCSSHHHHHHHHTTSSCTTCCEEEEEEECT
T ss_pred             -eCCCCHHHHHHHHHHH-HcCCCcEEEE-chhh-hCCCCcccCCEEEEECCCCCHHHHHHHhcccccCCCCCEEEEEEec
Confidence             775     45589999 9999999887 6888 5999999999999999999999999999999999999999999995


Q ss_pred             -ccHHHHHHHHHHHHHcCCCCCHHHHHh
Q 008235          539 -DDAAHAGQMIEILEQCGQVVPDALRDL  565 (573)
Q Consensus       539 -~d~~~~~~l~~~l~~~~~~vp~~l~~~  565 (573)
                       ++...+..|.++|+.++++||+||.+|
T Consensus       407 ~~~~~~~~~l~~~l~~~~~~vp~~l~~~  434 (434)
T 2db3_A          407 EKDRAIAADLVKILEGSGQTVPDFLRTC  434 (434)
T ss_dssp             TTCGGGHHHHHHHHHHTTCCCCGGGC--
T ss_pred             cccHHHHHHHHHHHHHcCCCCCHHHHhC
Confidence             578899999999999999999998764

PyMOL of 2db3

>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens}	Back alignment and structure

>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A	Back alignment and structure

>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens}	Back alignment and structure

>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A	Back alignment and structure

>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A	Back alignment and structure

>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A	Back alignment and structure

>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens}	Back alignment and structure

>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B	Back alignment and structure

>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A*	Back alignment and structure

>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A*	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A*	Back alignment and structure

>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A*	Back alignment and structure

>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A	Back alignment and structure

>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A	Back alignment and structure

>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A*	Back alignment and structure

>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae}	Back alignment and structure

>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B*	Back alignment and structure

>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A*	Back alignment and structure

>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A*	Back alignment and structure

>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A*	Back alignment and structure

>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus}	Back alignment and structure

>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A	Back alignment and structure

>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos}	Back alignment and structure

>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A	Back alignment and structure

>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A*	Back alignment and structure

>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus}	Back alignment and structure

>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens}	Back alignment and structure

>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos}	Back alignment and structure

>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A	Back alignment and structure

>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A	Back alignment and structure

>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A	Back alignment and structure

>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A*	Back alignment and structure

>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus}	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1	Back alignment and structure

>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ...	Back alignment and structure

>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4}	Back alignment and structure

>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens}	Back alignment and structure

>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A	Back alignment and structure

>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens}	Back alignment and structure

>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A	Back alignment and structure

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B*	Back alignment and structure

>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A*	Back alignment and structure

>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens}	Back alignment and structure

>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus}	Back alignment and structure

>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A*	Back alignment and structure

>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19	Back alignment and structure

>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens}	Back alignment and structure

>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens}	Back alignment and structure

>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A*	Back alignment and structure

>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens}	Back alignment and structure

>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A	Back alignment and structure

>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A	Back alignment and structure

>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A*	Back alignment and structure

>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B*	Back alignment and structure

>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A	Back alignment and structure

>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus}	Back alignment and structure

>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12}	Back alignment and structure

>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A	Back alignment and structure

>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens}	Back alignment and structure

>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens}	Back alignment and structure

>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A*	Back alignment and structure

>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B*	Back alignment and structure

>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens}	Back alignment and structure

>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis}	Back alignment and structure

>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens}	Back alignment and structure

>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19	Back alignment and structure

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens}	Back alignment and structure

>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A	Back alignment and structure

>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii}	Back alignment and structure

>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus}	Back alignment and structure

>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23	Back alignment and structure

>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli}	Back alignment and structure

>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1*	Back alignment and structure

>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19	Back alignment and structure

>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A*	Back alignment and structure

>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19	Back alignment and structure

>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D*	Back alignment and structure

>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A*	Back alignment and structure

>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A	Back alignment and structure

>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A	Back alignment and structure

>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A*	Back alignment and structure

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}	Back alignment and structure

>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A	Back alignment and structure

>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A*	Back alignment and structure

>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A*	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus}	Back alignment and structure

>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis}	Back alignment and structure

>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A*	Back alignment and structure

>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens}	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens}	Back alignment and structure

>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A	Back alignment and structure

>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A	Back alignment and structure

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*	Back alignment and structure

>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19	Back alignment and structure

>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B*	Back alignment and structure

>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A*	Back alignment and structure

>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A*	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12}	Back alignment and structure

>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus}	Back alignment and structure

>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}	Back alignment and structure

>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus}	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens}	Back alignment and structure

>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A*	Back alignment and structure

>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori}	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens}	Back alignment and structure

>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A*	Back alignment and structure

>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B*	Back alignment and structure

>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A*	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A	Back alignment and structure

>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A*	Back alignment and structure

>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A*	Back alignment and structure

>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster}	Back alignment and structure

>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A*	Back alignment and structure

>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A	Back alignment and structure

>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli}	Back alignment and structure

>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A*	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}	Back alignment and structure

>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus}	Back alignment and structure

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus}	Back alignment and structure

>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A	Back alignment and structure

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}	Back alignment and structure

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*	Back alignment and structure

>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli}	Back alignment and structure

>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A	Back alignment and structure

>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4}	Back alignment and structure

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		573
d1hv8a1		208	c.37.1.19 (A:3-210) Putative DEAD box RNA helicase	1e-07
d1t6na_		207	c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5	0.004

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score = 50.4 bits (120), Expect = 1e-07
 Identities = 25/145 (17%), Positives = 54/145 (37%), Gaps = 6/145 (4%)

Query: 224 SGSSSTIVQIAWIVATAADSIARKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKAF- 282
           +   + + Q        A       +      G   + L  ++E A +V    + LK   
Sbjct: 40  NDEYNIVAQARTGSGKTASFAIPLIELVNENNGIEAIILTPTRELAIQVADEIESLKGNK 99

Query: 283 GIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLKAIDVSGVSLLVVDRLDSL 342
            +    ++ G AI  QI  L++     +V TP R+L  ++   +++  V   ++D  D +
Sbjct: 100 NLKIAKIYGGKAIYPQIKALKN--ANIVVGTPGRILDHINRGTLNLKNVKYFILDEADEM 157

Query: 343 ---SKGDTLSLIRQSISGKPHTVVF 364
                   +  I  + +     ++F
Sbjct: 158 LNMGFIKDVEKILNACNKDKRILLF 182

PyMOL of d1hv8a1

>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		573
d2j0sa1		222	Probable ATP-dependent RNA helicase DDX48 {Human (	100.0
d1veca_		206	DEAD box RNA helicase rck/p54 {Human (Homo sapiens	100.0
d1t6na_		207	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	100.0
d2g9na1		218	Initiation factor 4a {Human (Homo sapiens) [TaxId:	100.0
d1wrba1		238	putative ATP-dependent RNA helicase VlgB {Flatworm	100.0
d1qdea_		212	Initiation factor 4a {Baker's yeast (Saccharomyces	100.0
d1hv8a1		208	Putative DEAD box RNA helicase {Archaeon Methanoco	100.0
d1s2ma1		206	Putative ATP-dependent RNA helicase DHH1 {Baker's	100.0
d1q0ua_		209	Probable DEAD box RNA helicase YqfR {Bacillus stea	100.0
d2bmfa2		305	Dengue virus helicase {Dengue virus type 2 [TaxId:	100.0
d2j0sa2		168	Probable ATP-dependent RNA helicase DDX48 {Human (	99.96
d1fuka_		162	Initiation factor 4a {Baker's yeast (Saccharomyces	99.96
d1s2ma2		171	Putative ATP-dependent RNA helicase DHH1 {Baker's	99.95
d2rb4a1		168	ATP-dependent RNA helicase DDX25 {Human (Homo sapi	99.94
d1gkub1		237	Helicase-like "domain" of reverse gyrase {Archaeon	99.94
d2p6ra3		202	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	99.94
d1hv8a2		155	Putative DEAD box RNA helicase {Archaeon Methanoco	99.94
d1oywa2		206	RecQ helicase domain {Escherichia coli [TaxId: 562	99.93
d1t5ia_		168	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	99.93
d1oywa3		200	RecQ helicase domain {Escherichia coli [TaxId: 562	99.91
d1wp9a1		200	putative ATP-dependent RNA helicase PF2015 {Pyroco	99.9
d1t5la2		181	Nucleotide excision repair enzyme UvrB {Bacillus c	99.85
d1c4oa2		174	Nucleotide excision repair enzyme UvrB {Thermus th	99.84
d1jr6a_		138	HCV helicase domain {Human hepatitis C virus (HCV)	99.81
d1wp9a2		286	putative ATP-dependent RNA helicase PF2015 {Pyroco	99.76
d2eyqa3		233	Transcription-repair coupling factor, TRCF {Escher	99.71
d1gm5a3		264	RecG helicase domain {Thermotoga maritima [TaxId:	99.68
d1rifa_		282	DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]	99.68
d1yksa1		140	YFV helicase domain {Yellow fever virus [TaxId: 11	99.67
d2fz4a1		206	DNA repair protein RAD25 {Archaeoglobus fulgidus [	99.65
d1a1va2		299	HCV helicase domain {Human hepatitis C virus (HCV)	99.63
d1gkub2		248	Helicase-like "domain" of reverse gyrase {Archaeon	99.63
d2p6ra4		201	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	99.56
d1a1va1		136	HCV helicase domain {Human hepatitis C virus (HCV)	99.54
d1gm5a4		206	RecG helicase domain {Thermotoga maritima [TaxId:	99.45
d2fwra1		200	DNA repair protein RAD25 {Archaeoglobus fulgidus [	99.44
d2eyqa5		211	Transcription-repair coupling factor, TRCF {Escher	99.15
d1tf5a4		175	Translocation ATPase SecA, nucleotide-binding doma	99.07
d1yksa2		299	YFV helicase domain {Yellow fever virus [TaxId: 11	99.01
d1z3ix1		346	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	98.94
d1z3ix2		298	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	98.9
d1z5za1		244	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	98.89
d1tf5a3		273	Translocation ATPase SecA, nucleotide-binding doma	98.68
d1nkta3		288	Translocation ATPase SecA, nucleotide-binding doma	98.57
d1z63a1		230	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	98.55
d1nkta4		219	Translocation ATPase SecA, nucleotide-binding doma	98.38
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	97.85
d1uaaa1		306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	96.76
d1c4oa2		174	Nucleotide excision repair enzyme UvrB {Thermus th	96.56
d1pjra1		318	DEXX box DNA helicase {Bacillus stearothermophilus	96.04
d2eyqa5		211	Transcription-repair coupling factor, TRCF {Escher	95.82
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	95.59
d1t5la2		181	Nucleotide excision repair enzyme UvrB {Bacillus c	95.58
g1qhh.1		623	DEXX box DNA helicase {Bacillus stearothermophilus	95.21
d1hv8a2		155	Putative DEAD box RNA helicase {Archaeon Methanoco	95.19
d1fuka_		162	Initiation factor 4a {Baker's yeast (Saccharomyces	95.02
d1ls1a2		207	GTPase domain of the signal sequence recognition p	94.71
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	94.45
d1s2ma2		171	Putative ATP-dependent RNA helicase DHH1 {Baker's	94.39
d1t5la1		413	Nucleotide excision repair enzyme UvrB {Bacillus c	94.38
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	94.28
d1oywa3		200	RecQ helicase domain {Escherichia coli [TaxId: 562	94.27
d1t5ia_		168	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	94.27
d2qy9a2		211	GTPase domain of the signal recognition particle r	94.17
d2j0sa2		168	Probable ATP-dependent RNA helicase DDX48 {Human (	93.75
d1vmaa2		213	GTPase domain of the signal recognition particle r	93.47
d2rb4a1		168	ATP-dependent RNA helicase DDX25 {Human (Homo sapi	93.32
d1jr6a_		138	HCV helicase domain {Human hepatitis C virus (HCV)	92.85
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	92.85
d1okkd2		207	GTPase domain of the signal recognition particle r	92.08
d1g6oa_		323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	91.81
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	91.53
d1j8yf2		211	GTPase domain of the signal sequence recognition p	90.69
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	90.11
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	89.66
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	88.37
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	87.98
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	86.98
d1yksa2		299	YFV helicase domain {Yellow fever virus [TaxId: 11	86.9
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	86.52
d1gm5a4		206	RecG helicase domain {Thermotoga maritima [TaxId:	85.53
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	84.18
d1wp9a2		286	putative ATP-dependent RNA helicase PF2015 {Pyroco	83.82
d1c4oa1		408	Nucleotide excision repair enzyme UvrB {Thermus th	83.72
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	83.46
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	83.22
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	82.35
d2eyqa2		117	Transcription-repair coupling factor, TRCF {Escher	81.99
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	81.94
d2b8ta1		139	Thymidine kinase, TK1, N-terminal domain {Ureaplas	81.76
d1xx6a1		141	Thymidine kinase, TK1, N-terminal domain {Clostrid	81.59
d1e9ra_		433	Bacterial conjugative coupling protein TrwB {Esche	80.84

>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=3.1e-43  Score=338.01  Aligned_cols=202  Identities=13%  Similarity=0.215  Sum_probs=184.0

Q ss_pred             CCCccccCCChHHHHHhHHHHHHHHHhCCCccCCCCCCCHHHHHHHHHHhcCCcEEEEeCCCchhHHHHHHHHHHHHHHh
Q 008235          166 GQACEKLDCPSKFLILCLNAIENAMRHDGVEQDNPLFVNSWGIEFWKCYSSAKDILETSGSSSTIVQIAWIVATAADSIA  245 (573)
Q Consensus       166 ~~~~~~~~~p~~~~~~~~~~i~~~l~~~g~~~p~~~~~t~iQ~~aip~il~g~dvl~~A~TG~SGKTlaf~lp~l~~l~~  245 (573)
                      ..+|+++++++.+    +    +++.+.||.+|     ||||.+|||.+++|+|++++|||| ||||+||++|+++++..
T Consensus        16 ~~sF~~l~L~~~l----~----~~L~~~g~~~p-----t~IQ~~aIp~il~g~dvi~~a~TG-SGKTlayllPil~~l~~   81 (222)
T d2j0sa1          16 TPTFDTMGLREDL----L----RGIYAYGFEKP-----SAIQQRAIKQIIKGRDVIAQSQSG-TGKTATFSISVLQCLDI   81 (222)
T ss_dssp             CCSGGGGCCCHHH----H----HHHHHHTCCSC-----CHHHHHHHHHHHTTCCEEEECCTT-SSHHHHHHHHHHHTCCT
T ss_pred             CCCHHHCCCCHHH----H----HHHHHCCCCCC-----CHHHHHHHHHHHCCCCeEEEcCcc-hhhhhhhcccccccccc
Confidence            3458888877766    4    44556799999     999999999999999999999999 99999999999998865


Q ss_pred             chhccCCCCCCcEEEEEcccHHHHHHHHHHHhhhhc-CCcEEEEeCCCCCHHHHHHHhhcCCCcEEEeCHHHHHHHHHcC
Q 008235          246 RKEKEGFSFTGPFLLFLVSSQEKAAKVRSVCKPLKA-FGIHTVSLHPGAAIDHQITGLRSCEPEFLVSTPERLLKLVSLK  324 (573)
Q Consensus       246 ~~~~~~~~~~~~~~Lil~PtreLa~Qi~~~~~~l~~-~~i~~~~~~gg~~~~~~~~~l~~~~~~IlV~TP~rL~~~l~~~  324 (573)
                      ..       ..+++||++||||||.|+++.+..++. .++++.+++||.....+...+.. +++|||+|||||++++..+
T Consensus        82 ~~-------~~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~-~~~Ilv~TPgrl~~~~~~~  153 (222)
T d2j0sa1          82 QV-------RETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDY-GQHVVAGTPGRVFDMIRRR  153 (222)
T ss_dssp             TS-------CSCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHH-CCSEEEECHHHHHHHHHTT
T ss_pred             cc-------cCceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhcc-CCeEEeCCCCcHHhccccc
Confidence            42       578999999999999999999999954 59999999999999999988988 8999999999999999999


Q ss_pred             CCCCCCccEEEEeCcccccC---cchHHHHHHhcCCCCcEEEEeccCCccHHHHHHHHhcCCceEEEcC
Q 008235          325 AIDVSGVSLLVVDRLDSLSK---GDTLSLIRQSISGKPHTVVFNDCLTYTSVPAVQNLLLGSINRLSLN  390 (573)
Q Consensus       325 ~~~l~~l~~lViDEad~ll~---~~~l~~Il~~l~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~~i~~~  390 (573)
                      .+.++++++||+||||+|++   ..++..|++.++.++|+++||||+|+.+.++++.++++|+ .|.++
T Consensus       154 ~~~~~~l~~lVlDEaD~ll~~~f~~~i~~I~~~l~~~~Q~ilfSAT~~~~v~~l~~~~l~~Pv-~I~V~  221 (222)
T d2j0sa1         154 SLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPI-RILVK  221 (222)
T ss_dssp             SSCCTTCCEEEEETHHHHTSTTTHHHHHHHHTTSCTTCEEEEEESCCCHHHHTTGGGTCSSCE-EECCC
T ss_pred             ccccccceeeeecchhHhhhcCcHHHHHHHHHhCCCCCEEEEEEEeCCHHHHHHHHHHCCCCE-EEEEe
Confidence            99999999999999999999   8889999999999999999999999999999999999996 67664

PyMOL of d2j0sa1

>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}	Back information, alignment and structure

>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}	Back information, alignment and structure

>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}	Back information, alignment and structure

>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}	Back information, alignment and structure

>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d2eyqa2 c.37.1.19 (A:349-465) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}	Back information, alignment and structure

>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure