Citrus Sinensis ID: 008489

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560----
MALLLLRNRKASALGIPRILRDNVEPFSLNSEKIIGAFASVDVIIRSYCSGSGMKKFDFTDLTRPHTWYPLARKKVRKVILHVGPTNSGKTHQALSRLESSSSGIYCGPLRLLAWEVAKRLNKANVSCDLITGQEREEVDGAKHRAVTVEMADVVSDYDCAVIDEIQMLGCKTRGFSFTRALLGICANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERLSPLVPLNVPLGSFSNIQTGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFDVLVASDAIGMGLNLNISRIIFSTMKKFDGVELRDLTVPEVKQIAGRAGRYGSKFPVGEVTCLDSEDLPLLHKSLLEPSPMLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLENAKLSENYFFANCEEVLKVATVIDQLPLRLHEKYLFCISPVDMNDDISSQGLTQFATNYSKKGIVQLREIFTPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDRELAASQKAICSMLIEEFLERLGWQKPRVKKVTPRPKLNSAVVSRC
cccHHccccccccccccccccccccccccccHHHHcccccHHHHHHHHcccccccccccccccccccccHHHHHccccEEEEEcccccHHHHHHHHHHHccccEEEcHHHHHHHHHHHHHHHccccccccccEEEEEEccccccEEEEcccccccccccEEEEEHHHHcccccccHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccEEEEccHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHcccccccEEEEcccccccccccccEEEEcccccccccEEEEccHHHHHHHcccccccccccccEEEEEEccccHHHHHHHHcccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHcc
cHHHHHHHHHHHHccccHHHHcccHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHccEEEEEEccccccHHHHHHHHHHHcccccEccHHHHHHHHHHHHHHHccccccEEcccEEEcccccccEEEEEEEEcccccEEEEEEEHHHHcccccccHHHHHHHHcccHcHEEccccHHHHHHHHHHHHHcccEEEEEEEEcccccEEcccccccHHccccccEEEEEcHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHccccccccEEEEEcHHHcccccccEEEEEEEEEcccccEEEEccHHHHHHHHccccccccccccEEEEEccHHHHHHHHHHHccccHHHHHccccccHHHHHHHHHHcccccHHHHHHHHHHHccccccEEEccHHHHHHHHHHHHcccccHHHHEEEEEcccccccHHHHHHHHHHHHHHHccccccccHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccHHHHHHHHccc
MALLLLRNRKasalgiprilrdnvepfslnsekiiGAFASVDVIIRSycsgsgmkkfdftdltrphtwyplaRKKVRKVILhvgptnsgkthQALSRlessssgiycgpLRLLAWEVAKRLNKAnvscdlitgqereevdgakhRAVTVEMADVVSDYDCAVIDEIQmlgcktrgfsFTRALLGICAnelhlcgdpaavPLIQQILQVtgddvkvqsyerlsplvplnvplgsfsniqtgdcivTFSRHAIYRLKKAIESRGKHLCSivygslppetrtrqatrfndasseFDVLVASDAIGMGLNLNISRIIFSTmkkfdgvelrdltvPEVKQIAGragrygskfpvgevtcldsedlpllhksllepspmlesaglfpnfdLIYMYsrlhpdsslYGILEHFLENAKLSENYFFANCEEVLKVATVidqlplrlhekylfcispvdmnddissqgltqfatnyskkGIVQLreiftpgtlqvpKTQAALRELESIHKVLDLYVWLSFRleesfpdrELAASQKAICSMLIEEFLERLgwqkprvkkvtprpklnsavvsrc
MALLLLRNrkasalgiprilrdnvepfslNSEKIIGAFASVDVIIRSYCSGSGMKKFDFTDLTRPHTWYPLARKKVRKVILHvgptnsgkthqALSRLESSSSGIYCGPLRLLAWEVAKRLNKANvscdlitgqereevdgakhrAVTVEMADVVSDYDCAVIDEIQMLGCKTRGFSFTRALLGICANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERLSPLVPLNVPLGSFSNIQTGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFDVLVASDAIGMGLNLNISRIIFSTMKKFDGVELRDLTVPEVKQiagragrygskfpVGEVTCLDSEDLPLLHKSLLEPSPMLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLENAKLSENYFFANCEEVLKVATVIDQLPLRLHEKYLFCISPVDMNDDISSQGLTQFATNYSKKGIVQLREIFTPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDRELAASQKAICSMLIEEFLErlgwqkprvkkvtprpklnsavvsrc
MALLLLRNRKASALGIPRILRDNVEPFSLNSEKIIGAFASVDVIIRSYCSGSGMKKFDFTDLTRPHTWYPLARKKVRKVILHVGPTNSGKTHQALSRLESSSSGIYCGPLRLLAWEVAKRLNKANVSCDLITGQEREEVDGAKHRAVTVEMADVVSDYDCAVIDEIQMLGCKTRGFSFTRALLGICANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERLSPLVPLNVPLGSFSNIQTGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFDVLVASDAIGMGLNLNISRIIFSTMKKFDGVELRDLTVPEVKQIAGRAGRYGSKFPVGEVTCLDSEDLPLLHKSLLEPSPMLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLENAKLSENYFFANCEEVLKVATVIDQLPLRLHEKYLFCISPVDMNDDISSQGLTQFATNYSKKGIVQLREIFTPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDRELAASQKAICSMLIEEFLERLGWQkprvkkvtprpkLNSAVVSRC
****LLRNRKASALGIPRILRDNVEPFSLNSEKIIGAFASVDVIIRSYCSGSGMKKFDFTDLTRPHTWYPLARKKVRKVILHVG********************IYCGPLRLLAWEVAKRLNKANVSCDLITGQEREEVDGAKHRAVTVEMADVVSDYDCAVIDEIQMLGCKTRGFSFTRALLGICANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERLSPLVPLNVPLGSFSNIQTGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSL****************SEFDVLVASDAIGMGLNLNISRIIFSTMKKFDGVELRDLTVPEVKQIAGRAGRYGSKFPVGEVTCLDSEDLPLLHKSLLEPSPMLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLENAKLSENYFFANCEEVLKVATVIDQLPLRLHEKYLFCISPVDMNDDISSQGLTQFATNYSKKGIVQLREIFTPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDRELAASQKAICSMLIEEFLERLGWQK********************
**LL***NRKASALGIPRILRDNVEPFSLNSEKIIGAFASVDVIIRSYCSGSGMKKFDFTDLTRPHTWYPLARKKVRKVILHVGPTNSGKTHQALSRLESSSSGIYCGPLRLLAWEVAKRLNKANVSCDLITGQEREEVDGAKHRAVTVEMADVVSDYDCAVIDEIQMLGCKTRGFSFTRALLGICANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERLSPLVPLNVPLGSFSNIQTGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFDVLVASDAIGMGLNLNISRIIFSTMKKFDGVELRDLTVPEVKQIAGRAGRYGSKFPVGEVTCLDSEDLPLLHKSLLEPSPMLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLENAKLSENYFFANCEEVLKVATVIDQLPLRLHEKYLFCISPVDMNDDISSQGLTQFATNYSKKGIVQLREIFTPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDRELAASQKAICSMLIEEFLE**************************
MALLLLRNRKASALGIPRILRDNVEPFSLNSEKIIGAFASVDVIIRSYCSGSGMKKFDFTDLTRPHTWYPLARKKVRKVILHVGPTNSGKTHQALSRLESSSSGIYCGPLRLLAWEVAKRLNKANVSCDLITGQEREEVDGAKHRAVTVEMADVVSDYDCAVIDEIQMLGCKTRGFSFTRALLGICANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERLSPLVPLNVPLGSFSNIQTGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFDVLVASDAIGMGLNLNISRIIFSTMKKFDGVELRDLTVPEVKQIAGRAGRYGSKFPVGEVTCLDSEDLPLLHKSLLEPSPMLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLENAKLSENYFFANCEEVLKVATVIDQLPLRLHEKYLFCISPVDMNDDISSQGLTQFATNYSKKGIVQLREIFTPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDRELAASQKAICSMLIEEFLERLGWQKPRVKKVTPRPKLNSAVVSRC
MALLLLRNRKASALGIPRILRDNVEPFSLNSEKIIGAFASVDVIIRSYCSGSGMKKFDFTDLTRPHTWYPLARKKVRKVILHVGPTNSGKTHQALSRLESSSSGIYCGPLRLLAWEVAKRLNKANVSCDLITGQEREEVDGAKHRAVTVEMADVVSDYDCAVIDEIQMLGCKTRGFSFTRALLGICANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERLSPLVPLNVPLGSFSNIQTGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFDVLVASDAIGMGLNLNISRIIFSTMKKFDGVELRDLTVPEVKQIAGRAGRYGSKFPVGEVTCLDSEDLPLLHKSLLEPSPMLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLENAKLSENYFFANCEEVLKVATVIDQLPLRLHEKYLFCISPVDMNDDISSQGLTQFATNYSKKGIVQLREIFTPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDRELAASQKAICSMLIEEFLERLGWQ*PR******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALLLLRNRKASALGIPRILRDNVEPFSLNSEKIIGAFASVDVIIRSYCSGSGMKKFDFTDLTRPHTWYPLARKKVRKVILHVGPTNSGKTHQALSRLESSSSGIYCGPLRLLAWEVAKRLNKANVSCDLITGQEREEVDGAKHRAVTVEMADVVSDYDCAVIDEIQMLGCKTRGFSFTRALLGICANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERLSPLVPLNVPLGSFSNIQTGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFDVLVASDAIGMGLNLNISRIIFSTMKKFDGVELRDLTVPEVKQIAGRAGRYGSKFPVGEVTCLDSEDLPLLHKSLLEPSPMLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLENAKLSENYFFANCEEVLKVATVIDQLPLRLHEKYLFCISPVDMNDDISSQGLTQFATNYSKKGIVQLREIFTPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDRELAASQKAICSMLIEEFLERLGWQKPRVKKVTPRPKLNSAVVSRC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query564 2.2.26 [Sep-21-2011]
Q5ZJT0 794 ATP-dependent RNA helicas yes no 0.865 0.614 0.420 1e-111
Q5EBA1776 ATP-dependent RNA helicas yes no 0.843 0.613 0.430 1e-111
Q80YD1779 ATP-dependent RNA helicas yes no 0.843 0.611 0.430 1e-111
Q8IYB8786 ATP-dependent RNA helicas yes no 0.817 0.586 0.435 1e-110
A4IG62763 ATP-dependent RNA helicas yes no 0.810 0.598 0.418 1e-106
Q9VN03763 ATP-dependent RNA helicas yes no 0.859 0.635 0.398 1e-100
Q17828721 ATP-dependent RNA helicas yes no 0.842 0.658 0.404 1e-98
Q61SU7721 ATP-dependent RNA helicas N/A no 0.838 0.656 0.399 2e-98
Q295E6762 ATP-dependent RNA helicas yes no 0.851 0.629 0.392 5e-97
O94445647 ATP-dependent RNA helicas yes no 0.776 0.676 0.398 3e-87
>sp|Q5ZJT0|SUV3_CHICK ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Gallus gallus GN=SUPV3L1 PE=2 SV=1 Back     alignment and function desciption
 Score =  403 bits (1036), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 215/511 (42%), Positives = 317/511 (62%), Gaps = 23/511 (4%)

Query: 22  DNVEPFSLNSEKIIGAFASVDVIIRSYCSGSGMKKFDFTDLTRPHTWYPLARKKVRKVIL 81
           D++ PF L   K I  F  +D +         ++K   +DL  P  WYP AR   RK+I 
Sbjct: 144 DDLFPFFLRHAKQI--FPMLDCM-------DDLRKI--SDLRLPPNWYPEARAIQRKIIF 192

Query: 82  HVGPTNSGKTHQALSRLESSSSGIYCGPLRLLAWEVAKRLNKANVSCDLITGQER----E 137
           H GPTNSGKT+ A+ R  S+ SGIYCGPL+LLA E+ ++ N ANV CDL+TG+ER    E
Sbjct: 193 HAGPTNSGKTYHAIQRFLSAKSGIYCGPLKLLAHEIFQKSNAANVPCDLVTGEERVYASE 252

Query: 138 EVDGAKHRAVTVEMADVVSDYDCAVIDEIQMLGCKTRGFSFTRALLGICANELHLCGDPA 197
           +   A H A T+EM    + Y+ AVIDEIQM+    RG+++TRALLG+CA E+H+CG+ A
Sbjct: 253 DAKQASHIACTIEMCSTNTPYEVAVIDEIQMIRDPARGWAWTRALLGLCAEEIHVCGEGA 312

Query: 198 AVPLIQQILQVTGDDVKVQSYERLSPLVPLNVPLGSFSNIQTGDCIVTFSRHAIYRLKKA 257
           A+ L+ +++  TG++V+V++Y+RL+PL  L+  L S  N+Q GDCIV FS++ IY + + 
Sbjct: 313 AIDLVTELMYTTGEEVEVRNYKRLTPLTVLDYALESLDNLQPGDCIVCFSKNDIYSVSRQ 372

Query: 258 IESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFDVLVASDAIGMGLNLNISRIIFS-- 315
           IE+RG   C+++YGSLPP T+  QA +FND +    +LVA+DAIGMGLNL I RIIF+  
Sbjct: 373 IEARGLE-CAVIYGSLPPGTKLEQAKKFNDPNDPCKILVATDAIGMGLNLCIKRIIFNSI 431

Query: 316 ---TMKKFDGVELRDLTVPEVKQIAGRAGRYGSKFPVGEVTCLDSEDLPLLHKSLLEPSP 372
              T+ +    E+  +T  +  QIAGRAGR+GS F  GEVT +  +DL  L + L E  P
Sbjct: 432 VKPTVNEKGEKEIDSITTSQALQIAGRAGRFGSSFKQGEVTAMHRDDLLQLKEILSEAVP 491

Query: 373 MLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLENAKLSENYFFANCEEVLKVATVIDQ 432
            +++AGL P  + I M++   PD++L  +++ F+  +++   YF  N ++   +A +I  
Sbjct: 492 PVKAAGLHPTPEQIEMFAYHLPDATLSNLIDIFVSLSQVDGLYFVCNIDDFKFLADMIQH 551

Query: 433 LPLRLHEKYLFCISPVDMNDDISSQGLTQFATNYSKKGIVQLREI--FTPGTLQVPKTQA 490
           +PL L  +Y+FC +P++  +      L +FA  +S+   +    +   T   L  PK   
Sbjct: 552 IPLNLRSRYVFCTAPLNRKEPFVCTTLLKFARQFSRNEPLTFDWLCRHTKWPLAPPKNIK 611

Query: 491 ALRELESIHKVLDLYVWLSFRLEESFPDREL 521
            L  LE++H V DLY+WLS+R  + FPD  L
Sbjct: 612 ELVHLEAVHDVFDLYLWLSYRFMDMFPDAAL 642
Major helicase player in mitochondrial RNA metabolism. Component of the mitochondrial degradosome (mtEXO) complex, that degrades 3' overhang double-stranded RNA with a 3'-to-5' directionality in an ATP-dependent manner. ATPase and ATP-dependent multisubstrate helicase, able to unwind double stranded (ds) DNA and RNA, and RNA/DNA heteroduplexes in the 5'-to-3' direction. Plays a role in the RNA surveillance system in mitochondria; regulates the stability of mature mRNAs, the removal of aberrantly formed mRNAs and the rapid degradation of non coding processing intermediates. Also implicated in recombination and chromatin maintenance pathways. May protect cells from apoptosis. Associates with mitochondrial DNA.
Gallus gallus (taxid: 9031)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q5EBA1|SUV3_RAT ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Rattus norvegicus GN=Supv3l1 PE=2 SV=1 Back     alignment and function description
>sp|Q80YD1|SUV3_MOUSE ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Mus musculus GN=Supv3l1 PE=2 SV=1 Back     alignment and function description
>sp|Q8IYB8|SUV3_HUMAN ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Homo sapiens GN=SUPV3L1 PE=1 SV=1 Back     alignment and function description
>sp|A4IG62|SUV3_DANRE ATP-dependent RNA helicase SUPV3L1, mitochondrial OS=Danio rerio GN=supv3l1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VN03|SUV3_DROME ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Drosophila melanogaster GN=CG9791 PE=2 SV=3 Back     alignment and function description
>sp|Q17828|SUV3_CAEEL ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Caenorhabditis elegans GN=C08F8.2 PE=3 SV=2 Back     alignment and function description
>sp|Q61SU7|SUV3_CAEBR ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Caenorhabditis briggsae GN=CBG06022 PE=3 SV=3 Back     alignment and function description
>sp|Q295E6|SUV3_DROPS ATP-dependent RNA helicase SUV3 homolog, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=GA22038 PE=3 SV=1 Back     alignment and function description
>sp|O94445|SUV3_SCHPO ATP-dependent RNA helicase suv3, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=suv3 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query564
224111126571 predicted protein [Populus trichocarpa] 0.980 0.968 0.764 0.0
356538244565 PREDICTED: ATP-dependent RNA helicase SU 0.987 0.985 0.743 0.0
255552101547 ATP-dependent RNA and DNA helicase, puta 0.943 0.972 0.763 0.0
356495782600 PREDICTED: ATP-dependent RNA helicase SU 0.957 0.9 0.759 0.0
357480943570 ATP-dependent RNA helicase SUPV3L1 [Medi 0.994 0.984 0.703 0.0
225432734572 PREDICTED: ATP-dependent RNA helicase SU 0.941 0.928 0.758 0.0
449432684560 PREDICTED: ATP-dependent RNA helicase SU 0.888 0.894 0.761 0.0
297737084612 unnamed protein product [Vitis vinifera] 0.973 0.897 0.690 0.0
30682998571 ATP-dependent RNA helicase, mitochondria 0.987 0.975 0.680 0.0
110739278571 RNA helicase like protein [Arabidopsis t 0.987 0.975 0.678 0.0
>gi|224111126|ref|XP_002315757.1| predicted protein [Populus trichocarpa] gi|222864797|gb|EEF01928.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/556 (76%), Positives = 479/556 (86%), Gaps = 3/556 (0%)

Query: 1   MALLLLRNRKASALGIPRILRDNVEPFSLNSEKIIGAFASVDVIIRSYCSGSGMK--KFD 58
           MA  LLR+R+ S LG+  IL+D ++P   + E  +GA A V  ++R Y + +  +  KFD
Sbjct: 1   MAAFLLRHRQVSTLGVSGILKDKLDPSRPHVESRLGALAGVCNLLREYSTSNDNRAHKFD 60

Query: 59  FTDLTRPHTWYPLARKKVRKVILHVGPTNSGKTHQALSRLESSSSGIYCGPLRLLAWEVA 118
           F DLT PH WYP+AR+K RK+ LHVGPTNSGKT+ AL +LESS SG+YCGPLRLLAWEVA
Sbjct: 61  FLDLTCPHAWYPVARRKNRKIFLHVGPTNSGKTYHALKQLESSPSGVYCGPLRLLAWEVA 120

Query: 119 KRLNKANVSCDLITGQEREEVDGAKHRAVTVEMADVVSDYDCAVIDEIQMLGCKTRGFSF 178
           KRLNKANV CDLITGQEREEV+GAKH+AVTVEMADV S+Y CAV+DEIQMLGC TRGFSF
Sbjct: 121 KRLNKANVPCDLITGQEREEVNGAKHKAVTVEMADVTSNYSCAVVDEIQMLGCMTRGFSF 180

Query: 179 TRALLGICANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERLSPLVPLNVPLGSFSNIQ 238
           TRALLGI A+ELHLCGDPAAVPLIQ+IL+ TGDD+ VQ YERLSPLVP   PLGSF NIQ
Sbjct: 181 TRALLGISADELHLCGDPAAVPLIQEILKPTGDDIHVQYYERLSPLVPSQKPLGSFKNIQ 240

Query: 239 TGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFDVLVAS 298
           TGDCIVTFSR  IY+LK  IE   KHLCS+VYGSLPPETRTRQAT FNDASSEFDVLVAS
Sbjct: 241 TGDCIVTFSRREIYKLKGQIERGRKHLCSVVYGSLPPETRTRQATMFNDASSEFDVLVAS 300

Query: 299 DAIGMGLNLNISRIIFSTMKKFDGVELRDLTVPEVKQIAGRAGRYGSKFPVGEVTCLDSE 358
           DAIGMGLNLNISRIIFSTMKKFDGVE+RDLT+ EVKQIAGRAGRYGS FPVGEVTCL ++
Sbjct: 301 DAIGMGLNLNISRIIFSTMKKFDGVEMRDLTISEVKQIAGRAGRYGSDFPVGEVTCLHAD 360

Query: 359 DLPLLHKSLLEPSPMLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLENAKLSENYFFA 418
           DLPLLH SL  PSP+LE AGLFP FDLI+MYSRLHP   LY I+EHFLENAKLSENYF A
Sbjct: 361 DLPLLHSSLKSPSPILECAGLFPTFDLIFMYSRLHPKKGLYRIMEHFLENAKLSENYFIA 420

Query: 419 NCEEVLKVATVIDQLPLRLHEKYLFCISPVDMNDDISSQGLTQFATNYSKKGIVQLREIF 478
           NCEE+LKVA V+D LP+ LH+KYLF ISPVDM ++ISSQGLTQFA NY++KGIV+L+EIF
Sbjct: 421 NCEEMLKVAAVVDVLPISLHDKYLFVISPVDMRNEISSQGLTQFAQNYAQKGIVRLKEIF 480

Query: 479 TPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDRELAASQKAICSMLIEEFLE 538
           TPGTLQVPKT++AL+ELESIHKVLDLYVWLSFRLE+SFPDRELAASQKAIC +LIEEFLE
Sbjct: 481 TPGTLQVPKTESALKELESIHKVLDLYVWLSFRLEDSFPDRELAASQKAICGLLIEEFLE 540

Query: 539 RLGWQK-PRVKKVTPR 553
           R GWQK P+ +K+  R
Sbjct: 541 RFGWQKQPKTRKLPSR 556

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356538244|ref|XP_003537614.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|255552101|ref|XP_002517095.1| ATP-dependent RNA and DNA helicase, putative [Ricinus communis] gi|223543730|gb|EEF45258.1| ATP-dependent RNA and DNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356495782|ref|XP_003516752.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Glycine max] Back     alignment and taxonomy information
>gi|357480943|ref|XP_003610757.1| ATP-dependent RNA helicase SUPV3L1 [Medicago truncatula] gi|355512092|gb|AES93715.1| ATP-dependent RNA helicase SUPV3L1 [Medicago truncatula] Back     alignment and taxonomy information
>gi|225432734|ref|XP_002279035.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449432684|ref|XP_004134129.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Cucumis sativus] gi|449504169|ref|XP_004162271.1| PREDICTED: ATP-dependent RNA helicase SUPV3L1, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297737084|emb|CBI26285.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|30682998|ref|NP_193215.2| ATP-dependent RNA helicase, mitochondrial (SUV3) [Arabidopsis thaliana] gi|5823579|emb|CAB53782.1| mitochondrial RNA helicase [Arabidopsis thaliana] gi|22655093|gb|AAM98137.1| RNA helicase like protein [Arabidopsis thaliana] gi|31711986|gb|AAP68349.1| At4g14790 [Arabidopsis thaliana] gi|332658099|gb|AEE83499.1| ATP-dependent RNA helicase, mitochondrial (SUV3) [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|110739278|dbj|BAF01552.1| RNA helicase like protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query564
TAIR|locus:2130235571 ATSUV3 [Arabidopsis thaliana ( 0.953 0.942 0.696 3e-204
TAIR|locus:2151911776 AT5G39840 [Arabidopsis thalian 0.856 0.622 0.424 1.2e-106
RGD|1305565776 Supv3l1 "suppressor of var1, 3 0.840 0.610 0.438 6e-103
MGI|MGI:2441711779 Supv3l1 "suppressor of var1, 3 0.840 0.608 0.438 9.8e-103
UNIPROTKB|F1SUG1789 SUPV3L1 "Uncharacterized prote 0.829 0.593 0.444 1.6e-102
UNIPROTKB|E1BTJ2 796 SUPV3L1 "ATP-dependent RNA hel 0.877 0.621 0.420 2e-102
UNIPROTKB|F1NMV4 794 SUPV3L1 "ATP-dependent RNA hel 0.877 0.623 0.420 2e-102
UNIPROTKB|Q5ZJT0 794 SUPV3L1 "ATP-dependent RNA hel 0.877 0.623 0.420 2e-102
UNIPROTKB|Q8IYB8786 SUPV3L1 "ATP-dependent RNA hel 0.863 0.619 0.429 2.6e-102
UNIPROTKB|F1PNI9845 SUPV3L1 "Uncharacterized prote 0.840 0.560 0.427 3.8e-101
TAIR|locus:2130235 ATSUV3 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1976 (700.6 bits), Expect = 3.0e-204, P = 3.0e-204
 Identities = 383/550 (69%), Positives = 447/550 (81%)

Query:     1 MALLLLRNRKASALGIPRILR-DNVEPFSLNSEKIIGAFASVDVIIRSYCSGSGM----- 54
             MA  ++R RK SALGI R+L+ D    +  + E   G    + V+ R+Y   SG      
Sbjct:     1 MAYSVVRLRKVSALGISRVLQADKGSLWRFHFEPEFGDLLRLGVLTRNYRKNSGSPKFDF 60

Query:    55 ------KKFDFTDLTRPHTWYPLARKKVRKVILHVGPTNSGKTHQALSRLESSSSGIYCG 108
                    KFDFTDLT PHTWYP+ARKK RKVILHVGPTNSGKT+ AL  LE SSSG+YCG
Sbjct:    61 TGTGTTSKFDFTDLTCPHTWYPIARKKKRKVILHVGPTNSGKTYSALKHLEQSSSGVYCG 120

Query:   109 PLRLLAWEVAKRLNKANVSCDLITGQEREEVDGAKHRAVTVEMADVVSDYDCAVIDEIQM 168
             PLRLLAWEVAKRLNKANV CDLITGQE++ V+GA H+AVTVEMADV S YDCA+IDEIQM
Sbjct:   121 PLRLLAWEVAKRLNKANVPCDLITGQEKDLVEGATHKAVTVEMADVTSVYDCAIIDEIQM 180

Query:   169 LGCKTRGFSFTRALLGICANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERLSPLVPLN 228
             +GCK RGF+FTRALLGI A+ELHLCGDPA VPL++ IL+VTGDDV+V +YERLSPLVPL 
Sbjct:   181 VGCKQRGFAFTRALLGIAADELHLCGDPAVVPLVEDILKVTGDDVEVHTYERLSPLVPLK 240

Query:   229 VPLGSFSNIQTGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDA 288
             VP+ S S+I+TGDC+VTFSR  IY  KK IE  GKHLCS+VYGSLPPETRT QATRFND 
Sbjct:   241 VPVSSVSSIKTGDCLVTFSRKDIYAYKKTIERAGKHLCSVVYGSLPPETRTAQATRFNDE 300

Query:   289 SSEFDVLVASDAIGMGLNLNISRIIFSTMKKFDGVELRDLTVPEVKQIAGRAGRYGSKFP 348
             +++FDVLVASDAIGMGLNLNISRIIFST++K+DG E RDLTV E+KQIAGRAGR+ SKFP
Sbjct:   301 TNDFDVLVASDAIGMGLNLNISRIIFSTLQKYDGSETRDLTVSEIKQIAGRAGRFQSKFP 360

Query:   349 VGEVTCLDSEDLPLLHKSLLEPSPMLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLEN 408
             +GEVTCL  EDLPLLH SL  PSP+LE AGLFP FDL+  YS+ HP   LY ILEHF+EN
Sbjct:   361 IGEVTCLHKEDLPLLHSSLKSPSPILERAGLFPTFDLLSGYSQAHPTHGLYQILEHFVEN 420

Query:   409 AKLSENYFFANCEEVLKVATVIDQLPLRLHEKYLFCISPVDMNDDISSQGLTQFATNYSK 468
             AKLS NYF +N E+++KVA ++D+LPL L EKYLF +SPVD+ND+IS QGL QFA N+SK
Sbjct:   421 AKLSSNYFISNVEDMMKVAAIVDELPLGLQEKYLFVVSPVDVNDEISGQGLAQFAQNFSK 480

Query:   469 KGIVQLREIFTPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDRELAASQKAI 528
              GIV+LREI  P  ++VPKT   L+ELESIHKVLDLYVWLS RLE+SFPDRE+AASQK+I
Sbjct:   481 AGIVRLREILAPDRVKVPKTPTELKELESIHKVLDLYVWLSLRLEDSFPDREVAASQKSI 540

Query:   529 CSMLIEEFLE 538
             C++LIE+FLE
Sbjct:   541 CNLLIEQFLE 550
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=ISM;IDA
GO:0016817 "hydrolase activity, acting on acid anhydrides" evidence=IEA
GO:0004004 "ATP-dependent RNA helicase activity" evidence=IDA
GO:0016070 "RNA metabolic process" evidence=IDA
GO:0009561 "megagametogenesis" evidence=IMP
GO:0009555 "pollen development" evidence=IMP
TAIR|locus:2151911 AT5G39840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1305565 Supv3l1 "suppressor of var1, 3-like 1 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2441711 Supv3l1 "suppressor of var1, 3-like 1 (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUG1 SUPV3L1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BTJ2 SUPV3L1 "ATP-dependent RNA helicase SUPV3L1, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMV4 SUPV3L1 "ATP-dependent RNA helicase SUPV3L1, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJT0 SUPV3L1 "ATP-dependent RNA helicase SUPV3L1, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IYB8 SUPV3L1 "ATP-dependent RNA helicase SUPV3L1, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNI9 SUPV3L1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.13LOW CONFIDENCE prediction!
3rd Layer3.6.40.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query564
pfam1251349 pfam12513, SUV3_C, Mitochondrial degradasome RNA h 4e-16
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 9e-13
smart0049082 smart00490, HELICc, helicase superfamily c-termina 2e-11
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 1e-10
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 2e-10
COG4581 1041 COG4581, COG4581, Superfamily II RNA helicase [DNA 8e-06
COG1202830 COG1202, COG1202, Superfamily II helicase, archaea 1e-04
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 6e-04
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 9e-04
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 0.002
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 0.003
>gnl|CDD|204947 pfam12513, SUV3_C, Mitochondrial degradasome RNA helicase subunit C terminal Back     alignment and domain information 
 Score = 72.2 bits (178), Expect = 4e-16
 Identities = 30/49 (61%), Positives = 36/49 (73%)

Query: 492 LRELESIHKVLDLYVWLSFRLEESFPDRELAASQKAICSMLIEEFLERL 540
           L+ELES+HKVLDLY+WLS+R  + FPDRELA   K +    IEE LER 
Sbjct: 1   LQELESLHKVLDLYLWLSYRFPDLFPDRELAEELKKLVEEKIEEILERQ 49

This domain family is found in bacteria and eukaryotes, and is approximately 50 amino acids in length. The family is found in association with pfam00271. The yeast mitochondrial degradosome (mtEXO) is an NTP-dependent exoribonuclease involved in mitochondrial RNA metabolism. mtEXO is made up of two subunits: an RNase (DSS1) and an RNA helicase (SUV3). These co-purify with mitochondrial ribosomes. Length = 49
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|226947 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 564
KOG0953700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 100.0
KOG0922674 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0923902 consensus mRNA splicing factor ATP-dependent RNA h 100.0
KOG0925699 consensus mRNA splicing factor ATP-dependent RNA h 100.0
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 100.0
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
KOG0330476 consensus ATP-dependent RNA helicase [RNA processi 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PTZ00110545 helicase; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
COG1204 766 Superfamily II helicase [General function predicti 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
PTZ00424401 helicase 45; Provisional 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
KOG0345567 consensus ATP-dependent RNA helicase [RNA processi 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
KOG0340442 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
KOG0338691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
KOG0342543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0348708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.98
KOG0339731 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 99.97
KOG0347731 consensus RNA helicase [RNA processing and modific 99.97
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.97
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 99.97
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.97
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 99.97
PRK106891147 transcription-repair coupling factor; Provisional 99.97
TIGR00643630 recG ATP-dependent DNA helicase RecG. 99.97
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.97
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.97
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 99.97
KOG0350620 consensus DEAD-box ATP-dependent RNA helicase [RNA 99.97
KOG0346569 consensus RNA helicase [RNA processing and modific 99.97
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 99.96
KOG0334997 consensus RNA helicase [RNA processing and modific 99.96
PHA02558501 uvsW UvsW helicase; Provisional 99.95
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 99.95
KOG0327397 consensus Translation initiation factor 4F, helica 99.95
KOG0352641 consensus ATP-dependent DNA helicase [Replication, 99.95
KOG4284 980 consensus DEAD box protein [Transcription] 99.94
KOG0337529 consensus ATP-dependent RNA helicase [RNA processi 99.94
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.94
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.94
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.93
COG1205 851 Distinct helicase family with a unique C-terminal 99.92
KOG0353695 consensus ATP-dependent DNA helicase [General func 99.92
PRK14701 1638 reverse gyrase; Provisional 99.92
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.91
PRK13766773 Hef nuclease; Provisional 99.91
PRK09401 1176 reverse gyrase; Reviewed 99.91
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.9
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.9
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.9
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 99.9
PRK09200790 preprotein translocase subunit SecA; Reviewed 99.89
KOG0354746 consensus DEAD-box like helicase [General function 99.89
PRK05580679 primosome assembly protein PriA; Validated 99.89
PRK09694878 helicase Cas3; Provisional 99.88
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.88
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.88
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 99.88
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.88
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 99.87
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.87
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 99.86
PRK04914 956 ATP-dependent helicase HepA; Validated 99.85
KOG0349725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.82
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.79
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 99.79
KOG09491330 consensus Predicted helicase, DEAD-box superfamily 99.78
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.77
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.74
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.72
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.71
KOG09511674 consensus RNA helicase BRR2, DEAD-box superfamily 99.69
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.66
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.63
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.63
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.6
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.59
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.58
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.57
PF1251349 SUV3_C: Mitochondrial degradasome RNA helicase sub 99.54
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.54
COG4096 875 HsdR Type I site-specific restriction-modification 99.52
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.51
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.51
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.49
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.47
KOG1123776 consensus RNA polymerase II transcription initiati 99.45
smart0049082 HELICc helicase superfamily c-terminal domain. 99.44
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.38
PRK05298652 excinuclease ABC subunit B; Provisional 99.33
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.3
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.28
smart00487201 DEXDc DEAD-like helicases superfamily. 99.21
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.2
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.18
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 99.17
KOG0387923 consensus Transcription-coupled repair protein CSB 99.17
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 99.16
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.13
COG4889 1518 Predicted helicase [General function prediction on 99.12
KOG1000689 consensus Chromatin remodeling protein HARP/SMARCA 99.11
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 99.09
KOG0390776 consensus DNA repair protein, SNF2 family [Replica 99.05
PRK14873665 primosome assembly protein PriA; Provisional 99.05
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 98.97
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.95
KOG03921549 consensus SNF2 family DNA-dependent ATPase domain- 98.94
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 98.94
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.92
PF04851184 ResIII: Type III restriction enzyme, res subunit; 98.87
CHL00122 870 secA preprotein translocase subunit SecA; Validate 98.86
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 98.84
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 98.58
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 98.4
KOG1002791 consensus Nucleotide excision repair protein RAD16 98.38
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 98.24
KOG1802935 consensus RNA helicase nonsense mRNA reducing fact 98.13
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.12
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 98.06
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.0
KOG4439901 consensus RNA polymerase II transcription terminat 97.97
COG0610 962 Type I site-specific restriction-modification syst 97.95
KOG1803649 consensus DNA helicase [Replication, recombination 97.82
TIGR00376637 DNA helicase, putative. The gene product may repre 97.81
PF1324576 AAA_19: Part of AAA domain 97.75
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 97.62
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.59
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 97.42
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 97.42
PF04408102 HA2: Helicase associated domain (HA2); InterPro: I 97.38
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.21
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 97.21
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.14
smart0084792 HA2 Helicase associated domain (HA2) Add an annota 97.12
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.05
PRK06526254 transposase; Provisional 97.02
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.0
PRK08181269 transposase; Validated 96.94
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.91
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 96.89
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 96.89
PRK04296190 thymidine kinase; Provisional 96.89
smart00382148 AAA ATPases associated with a variety of cellular 96.84
KOG18051100 consensus DNA replication helicase [Replication, r 96.81
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 96.78
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 96.76
PRK10875615 recD exonuclease V subunit alpha; Provisional 96.76
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.75
PRK08727233 hypothetical protein; Validated 96.74
COG3973747 Superfamily I DNA and RNA helicases [General funct 96.73
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.73
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.71
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.7
PRK12377248 putative replication protein; Provisional 96.69
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 96.66
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 96.62
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 96.57
smart00488289 DEXDc2 DEAD-like helicases superfamily. 96.54
smart00489289 DEXDc3 DEAD-like helicases superfamily. 96.54
PRK06921266 hypothetical protein; Provisional 96.52
PRK07952244 DNA replication protein DnaC; Validated 96.51
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 96.49
PRK10536262 hypothetical protein; Provisional 96.45
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 96.41
PF13173128 AAA_14: AAA domain 96.36
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.34
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 96.28
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 96.28
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 96.28
PRK06893229 DNA replication initiation factor; Validated 96.26
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.26
PRK08116268 hypothetical protein; Validated 96.22
PRK08084235 DNA replication initiation factor; Provisional 96.21
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 96.16
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 96.14
PRK15483 986 type III restriction-modification system StyLTI en 96.13
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 96.12
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.07
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.06
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 95.96
PRK06835329 DNA replication protein DnaC; Validated 95.93
PRK09183259 transposase/IS protein; Provisional 95.88
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.86
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 95.85
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 95.74
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 95.69
PRK08939306 primosomal protein DnaI; Reviewed 95.61
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 95.57
PRK13889 988 conjugal transfer relaxase TraA; Provisional 95.55
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 95.54
PRK11823446 DNA repair protein RadA; Provisional 95.54
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 95.53
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 95.53
PF1355562 AAA_29: P-loop containing region of AAA domain 95.52
COG2256436 MGS1 ATPase related to the helicase subunit of the 95.5
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.46
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 95.4
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 95.4
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 95.4
PRK00149450 dnaA chromosomal replication initiation protein; R 95.33
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 95.29
PTZ00293211 thymidine kinase; Provisional 95.21
PF00265176 TK: Thymidine kinase; InterPro: IPR001267 Thymidin 95.19
PRK14974336 cell division protein FtsY; Provisional 95.17
COG1618179 Predicted nucleotide kinase [Nucleotide transport 95.13
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 95.12
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.11
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 95.11
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 95.07
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 95.06
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 95.05
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.03
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 94.95
PRK05642234 DNA replication initiation factor; Validated 94.94
smart00492141 HELICc3 helicase superfamily c-terminal domain. 94.93
TIGR00362405 DnaA chromosomal replication initiator protein Dna 94.92
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 94.8
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 94.8
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.76
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 94.76
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.7
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.69
PHA03368738 DNA packaging terminase subunit 1; Provisional 94.69
PHA00729226 NTP-binding motif containing protein 94.69
PRK13851344 type IV secretion system protein VirB11; Provision 94.67
cd01124187 KaiC KaiC is a circadian clock protein primarily f 94.67
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 94.66
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 94.62
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 94.61
PRK04195482 replication factor C large subunit; Provisional 94.6
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 94.56
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 94.56
PRK10416318 signal recognition particle-docking protein FtsY; 94.5
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 94.49
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 94.48
PRK00771437 signal recognition particle protein Srp54; Provisi 94.46
TIGR02688449 conserved hypothetical protein TIGR02688. Members 94.45
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 94.45
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 94.41
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 94.34
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 94.3
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 94.17
PLN03025319 replication factor C subunit; Provisional 94.17
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 94.13
PRK12422445 chromosomal replication initiation protein; Provis 94.13
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 94.09
COG2255332 RuvB Holliday junction resolvasome, helicase subun 94.06
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 94.05
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 94.0
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 93.97
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 93.93
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 93.93
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 93.92
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.9
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 93.85
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 93.81
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 93.79
PRK05973237 replicative DNA helicase; Provisional 93.79
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 93.73
PRK14087450 dnaA chromosomal replication initiation protein; P 93.71
PRK13342413 recombination factor protein RarA; Reviewed 93.7
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 93.67
PRK13341 725 recombination factor protein RarA/unknown domain f 93.64
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 93.63
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 93.61
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 93.6
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 93.56
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.55
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 93.54
PHA02544316 44 clamp loader, small subunit; Provisional 93.53
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 93.53
PHA00350399 putative assembly protein 93.52
PRK13833323 conjugal transfer protein TrbB; Provisional 93.51
KOG10151567 consensus Transcription regulator XNP/ATRX, DEAD-b 93.47
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 93.47
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 93.42
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 93.4
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 93.35
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 93.35
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 93.3
smart00491142 HELICc2 helicase superfamily c-terminal domain. 93.25
PHA03333752 putative ATPase subunit of terminase; Provisional 93.24
PRK10436462 hypothetical protein; Provisional 93.24
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 93.22
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 93.12
PRK14088440 dnaA chromosomal replication initiation protein; P 93.1
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.1
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 93.07
PRK10865 857 protein disaggregation chaperone; Provisional 93.07
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 93.06
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 93.05
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 93.04
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 93.01
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 92.98
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 92.94
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 92.93
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 92.88
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 92.8
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 92.79
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 92.73
PF13871278 Helicase_C_4: Helicase_C-like 92.69
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 92.65
PRK14729300 miaA tRNA delta(2)-isopentenylpyrophosphate transf 92.6
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 92.56
PRK13897606 type IV secretion system component VirD4; Provisio 92.56
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 92.56
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 92.55
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 92.52
PLN02165334 adenylate isopentenyltransferase 92.47
PRK11054684 helD DNA helicase IV; Provisional 92.45
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 92.45
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 92.39
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 92.34
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, 92.32
TIGR00767415 rho transcription termination factor Rho. Members 92.29
PRK14086617 dnaA chromosomal replication initiation protein; P 92.27
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 92.25
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 92.24
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 92.17
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 92.16
PRK04328249 hypothetical protein; Provisional 92.1
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 92.06
PF12846304 AAA_10: AAA-like domain 92.02
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 92.0
KOG03881185 consensus SNF2 family DNA-dependent ATPase [Replic 92.0
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 91.98
PRK14530215 adenylate kinase; Provisional 91.97
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 91.93
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 91.92
PRK06067234 flagellar accessory protein FlaH; Validated 91.91
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 91.86
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 91.82
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 91.81
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 91.79
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 91.77
COG0470325 HolB ATPase involved in DNA replication [DNA repli 91.75
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 91.68
PRK13894319 conjugal transfer ATPase TrbB; Provisional 91.68
PRK07940394 DNA polymerase III subunit delta'; Validated 91.58
PRK13850670 type IV secretion system protein VirD4; Provisiona 91.58
TIGR02533486 type_II_gspE general secretory pathway protein E. 91.4
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 91.38
TIGR02397355 dnaX_nterm DNA polymerase III, subunit gamma and t 91.36
TIGR02237209 recomb_radB DNA repair and recombination protein R 91.26
PRK08233182 hypothetical protein; Provisional 91.23
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP bindi 91.22
PRK13764602 ATPase; Provisional 91.12
TIGR00064272 ftsY signal recognition particle-docking protein F 91.11
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 91.11
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 91.07
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 91.07
COG5008375 PilU Tfp pilus assembly protein, ATPase PilU [Cell 90.96
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 90.95
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 90.94
PRK08118167 topology modulation protein; Reviewed 90.92
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 90.92
PRK13822641 conjugal transfer coupling protein TraG; Provision 90.89
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 90.85
KOG0745564 consensus Putative ATP-dependent Clp-type protease 90.81
PRK10867433 signal recognition particle protein; Provisional 90.79
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 90.75
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 90.72
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Po 90.71
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 90.68
COG1221403 PspF Transcriptional regulators containing an AAA- 90.64
cd01394218 radB RadB. The archaeal protein radB shares simila 90.5
COG3854308 SpoIIIAA ncharacterized protein conserved in bacte 90.48
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 90.48
KOG2373514 consensus Predicted mitochondrial DNA helicase twi 90.46
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 90.45
KOG2340698 consensus Uncharacterized conserved protein [Funct 90.42
PRK00300205 gmk guanylate kinase; Provisional 90.4
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 90.38
TIGR02012321 tigrfam_recA protein RecA. This model describes or 90.36
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 90.36
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 90.32
TIGR00235207 udk uridine kinase. Model contains a number of lon 90.31
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 90.26
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 90.24
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 90.22
PRK05480209 uridine/cytidine kinase; Provisional 90.19
PRK07261171 topology modulation protein; Provisional 90.19
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 90.17
KOG2028554 consensus ATPase related to the helicase subunit o 90.08
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 90.08
cd00983325 recA RecA is a bacterial enzyme which has roles in 90.02
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 89.97
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 89.93
cd03115173 SRP The signal recognition particle (SRP) mediates 89.83
PF00004132 AAA: ATPase family associated with various cellula 89.79
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 89.77
PRK09361225 radB DNA repair and recombination protein RadB; Pr 89.77
TIGR02767623 TraG-Ti Ti-type conjugative transfer system protie 89.76
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 89.76
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 89.71
TIGR00959428 ffh signal recognition particle protein. This mode 89.6
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 89.59
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 89.57
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 89.52
PRK09376416 rho transcription termination factor Rho; Provisio 89.5
PRK09112351 DNA polymerase III subunit delta'; Validated 89.49
PRK00131175 aroK shikimate kinase; Reviewed 89.42
COG1126240 GlnQ ABC-type polar amino acid transport system, A 89.35
COG4128398 Zot Zonula occludens toxin [General function predi 89.31
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 89.28
PRK14531183 adenylate kinase; Provisional 89.28
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 89.22
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 89.18
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 89.17
TIGR00595 505 priA primosomal protein N'. All proteins in this f 89.14
TIGR02236310 recomb_radA DNA repair and recombination protein R 89.06
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 89.05
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 88.96
PRK09354349 recA recombinase A; Provisional 88.92
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 88.92
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 88.77
PRK14527191 adenylate kinase; Provisional 88.77
PF10412386 TrwB_AAD_bind: Type IV secretion-system coupling p 88.74
CHL00176638 ftsH cell division protein; Validated 88.74
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 88.71
PF00154322 RecA: recA bacterial DNA recombination protein; In 88.7
PRK09825176 idnK D-gluconate kinase; Provisional 88.67
PRK14737186 gmk guanylate kinase; Provisional 88.67
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 88.63
PRK05541176 adenylylsulfate kinase; Provisional 88.63
COG1136226 SalX ABC-type antimicrobial peptide transport syst 88.61
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 88.58
PRK05580 679 primosome assembly protein PriA; Validated 88.5
KOG2228408 consensus Origin recognition complex, subunit 4 [R 88.43
PRK06762166 hypothetical protein; Provisional 88.42
PLN02840421 tRNA dimethylallyltransferase 88.39
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 88.35
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 88.27
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 88.14
PLN02748468 tRNA dimethylallyltransferase 88.13
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 88.09
PF09439181 SRPRB: Signal recognition particle receptor beta s 88.06
PRK00698205 tmk thymidylate kinase; Validated 88.01
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 87.97
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 87.92
PRK14532188 adenylate kinase; Provisional 87.9
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 87.83
PRK04301317 radA DNA repair and recombination protein RadA; Va 87.63
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 87.62
PF07724171 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR 87.57
cd01918149 HprK_C HprK/P, the bifunctional histidine-containi 87.5
PHA00012361 I assembly protein 87.45
TIGR03743634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 87.4
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 87.38
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 87.38
PTZ00301210 uridine kinase; Provisional 87.38
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 87.36
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 87.35
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transf 87.24
PRK08356195 hypothetical protein; Provisional 87.18
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 87.14
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 86.98
PRK04841 903 transcriptional regulator MalT; Provisional 86.97
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 86.95
PRK06217183 hypothetical protein; Validated 86.93
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 86.85
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 86.85
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 86.84
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=3.1e-91  Score=704.14  Aligned_cols=490  Identities=48%  Similarity=0.807  Sum_probs=474.5

Q ss_pred             cCCCCCCccccchHHHhcCCceEEEEccCCccHHHHHHHHHHcCCCEEEEccHHHHHHHHHHHHHhcCCeeEEEeCcccc
Q 008489           58 DFTDLTRPHTWYPLARKKVRKVILHVGPTNSGKTHQALSRLESSSSGIYCGPLRLLAWEVAKRLNKANVSCDLITGQERE  137 (564)
Q Consensus        58 ~~~~~~~~q~~~p~~~~~~~~~viv~apTGsGKT~~~~~~l~~~~~~li~~P~r~La~q~~~~l~~~g~~~~~~~G~~~~  137 (564)
                      .+.|++.|..|||.+|++++++++++|||+||||+-|++.+.+.++++|+.|+|.||.++++++++.|++|.++||++++
T Consensus       172 ~isDLt~P~~WyP~AR~~~RkIi~H~GPTNSGKTy~ALqrl~~aksGvycGPLrLLA~EV~~r~na~gipCdL~TGeE~~  251 (700)
T KOG0953|consen  172 KISDLTNPANWYPEARKIRRKIIMHVGPTNSGKTYRALQRLKSAKSGVYCGPLRLLAHEVYDRLNALGIPCDLLTGEERR  251 (700)
T ss_pred             hhhccCCCcccCchhHhhhheEEEEeCCCCCchhHHHHHHHhhhccceecchHHHHHHHHHHHhhhcCCCccccccceee
Confidence            56999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             ccCC----CceEEEcceeccccCcccEEEEccccccCCCCCcchHHHHHhccCccceEEEccCCCchHHHHHHHHcCCce
Q 008489          138 EVDG----AKHRAVTVEMADVVSDYDCAVIDEIQMLGCKTRGFSFTRALLGICANELHLCGDPAAVPLIQQILQVTGDDV  213 (564)
Q Consensus       138 ~~~~----~~~i~~T~e~~~~l~~~~~vViDEaH~~~~~~rg~~~~~~ll~l~~~~~~l~~~~~~~~~~~~l~~~~g~~~  213 (564)
                      ....    +.++.||+||.+....|++.||||+|++.|++|||+||++|||+.++++|+||.++.+++++++++.+|+++
T Consensus       252 ~~~~~~~~a~hvScTVEM~sv~~~yeVAViDEIQmm~Dp~RGwAWTrALLGl~AdEiHLCGepsvldlV~~i~k~TGd~v  331 (700)
T KOG0953|consen  252 FVLDNGNPAQHVSCTVEMVSVNTPYEVAVIDEIQMMRDPSRGWAWTRALLGLAADEIHLCGEPSVLDLVRKILKMTGDDV  331 (700)
T ss_pred             ecCCCCCcccceEEEEEEeecCCceEEEEehhHHhhcCcccchHHHHHHHhhhhhhhhccCCchHHHHHHHHHhhcCCee
Confidence            8765    889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeecccCCCCCCCccccccccccCCCeEEEccHHHHHHHHHHHHHcCCCeEEEEcCCCCHHHHHHHHHHHhCCCCCee
Q 008489          214 KVQSYERLSPLVPLNVPLGSFSNIQTGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFD  293 (564)
Q Consensus       214 ~v~~~~~~~~~~~~~~~l~~l~~~~~g~~iv~~s~~~~~~l~~~L~~~~~~~v~~lhg~l~~~~R~~~~~~F~~~~g~~~  293 (564)
                      ++..|+|..|+...+..+..+.++.+|||||+||++++..++..+++.+..+++++||+|||+.|.+|...|++++++.+
T Consensus       332 ev~~YeRl~pL~v~~~~~~sl~nlk~GDCvV~FSkk~I~~~k~kIE~~g~~k~aVIYGsLPPeTr~aQA~~FNd~~~e~d  411 (700)
T KOG0953|consen  332 EVREYERLSPLVVEETALGSLSNLKPGDCVVAFSKKDIFTVKKKIEKAGNHKCAVIYGSLPPETRLAQAALFNDPSNECD  411 (700)
T ss_pred             EEEeecccCcceehhhhhhhhccCCCCCeEEEeehhhHHHHHHHHHHhcCcceEEEecCCCCchhHHHHHHhCCCCCccc
Confidence            99999999999999988899999999999999999999999999999999889999999999999999999999999999


Q ss_pred             EEEeccccccccccCccEEEecCccccCCccccccCHhhHHhhhccCCCCCCCCCcEEEEEecCCCHHHHHhhhCCCChh
Q 008489          294 VLVASDAIGMGLNLNISRIIFSTMKKFDGVELRDLTVPEVKQIAGRAGRYGSKFPVGEVTCLDSEDLPLLHKSLLEPSPM  373 (564)
Q Consensus       294 VlVaT~~~~~Gldipv~~VI~~~~~k~~~~~~~p~s~~~~~Qr~GRaGR~g~~~~~G~~~~l~~~~~~~~~~~~~~~~~e  373 (564)
                      |+||||++|||+|+.|++|||++..||+|.++.+++.++.+|++|||||+|.++..|.++++..+|+..+++.++.+..+
T Consensus       412 vlVAsDAIGMGLNL~IrRiiF~sl~Kysg~e~~~it~sqikQIAGRAGRf~s~~~~G~vTtl~~eDL~~L~~~l~~p~ep  491 (700)
T KOG0953|consen  412 VLVASDAIGMGLNLNIRRIIFYSLIKYSGRETEDITVSQIKQIAGRAGRFGSKYPQGEVTTLHSEDLKLLKRILKRPVEP  491 (700)
T ss_pred             eEEeecccccccccceeEEEEeecccCCcccceeccHHHHHHHhhcccccccCCcCceEEEeeHhhHHHHHHHHhCCchH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcCCCCcHHHHHHHHhhCCCCCHHHHHHHHHHhcccCCCccccCHHHHHHHHHHhccCCCCHHHHHHHhccCCCCCCH
Q 008489          374 LESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLENAKLSENYFFANCEEVLKVATVIDQLPLRLHEKYLFCISPVDMNDD  453 (564)
Q Consensus       374 i~~~~l~~~~~~l~~~~~~~~~~~~~~~l~~f~~~~~~~~~~~~~~~~~l~~l~~~~~~~~lt~~~~~~~~~~P~~~~~~  453 (564)
                      |..++++|+.+++..|+...|+..+..+++.|......+..|++|..++...++.++++.+|+..+|+.||.||++..+|
T Consensus       492 i~~agl~pt~eqie~fa~~~Pd~t~snLld~f~~~~~~~~~fflc~~~~~k~va~liehi~L~l~dr~~fc~aPvnk~~p  571 (700)
T KOG0953|consen  492 IKNAGLWPTDEQIELFAYHLPDATPSNLLDIFVKLCEVDGLFFLCNLDDFKFVAELIEHIELPLKDRYKFCTAPVNKKMP  571 (700)
T ss_pred             HHhccCCccHHHHHHHHHhCCCccHHHHHHHHHHHHccCCceEEecchhHHHHHHHHHhCCcchhhhheeecCcccccCc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHhhcCccchhhhc--cCCCCCCCCcHHHHHHHHHHHHHHHHHHHhhhhcCCCCCCHHHHHHHHHHHHH
Q 008489          454 ISSQGLTQFATNYSKKGIVQLREIF--TPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDRELAASQKAICSM  531 (564)
Q Consensus       454 ~~~~~l~~~~~~~~~~~~~~i~~~~--~~~~~~~~~~~~~l~~le~~~~~~~~y~wl~~r~~~~f~~~~~~~~~~~~~~~  531 (564)
                      ....+++.+|+.|+.++++++..+-  ..+|...|++..+|..||+.|+++++|+|||+|||++|||.+.|+++++.+++
T Consensus       572 ~v~~~f~kfa~~~s~~~~l~~~~l~~~~~~p~~~p~t~~~L~~LEs~h~il~lYmWlS~Rfpd~fpd~~~vrd~~~~ld~  651 (700)
T KOG0953|consen  572 RVCSAFLKFARQYSQNEPLTFLWLKFNLGWPNKIPKTIYELEDLESLHDILDLYMWLSNRFPDMFPDAESVRDLKKELDE  651 (700)
T ss_pred             hHHHHHHHHHHHHhcCCcccHHHHHHhhcCCCCCCccHHHHHHHHHHHHHHHHHHHHHhhhhhhccChHHHHHHHHHHHH
Confidence            9999999999999999999975432  35777889999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCcccc
Q 008489          532 LIEEFLERLGWQKPRV  547 (564)
Q Consensus       532 ~i~~~l~~~~~~~~~~  547 (564)
                      +|.+.+.++++...+-
T Consensus       652 ii~egv~~~~k~~~~~  667 (700)
T KOG0953|consen  652 IIQEGVSKLTKLLKAH  667 (700)
T ss_pred             HHHHHHHHHHhhhhcC
Confidence            9999999998876543

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF12513 SUV3_C: Mitochondrial degradasome RNA helicase subunit C terminal; InterPro: IPR022192 This domain family is found in bacteria and eukaryotes, and is approximately 50 amino acids in length Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>smart00847 HA2 Helicase associated domain (HA2) Add an annotation Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA00350 putative assembly protein Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4128 Zot Zonula occludens toxin [General function prediction only] Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>PLN02748 tRNA dimethylallyltransferase Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>cd01918 HprK_C HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria Back     alignment and domain information
>PHA00012 I assembly protein Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query564
3rc8_A677 Human Mitochondrial Helicase Suv3 In Complex With S 1e-111
3rc3_A677 Human Mitochondrial Helicase Suv3 Length = 677 1e-107
4a4z_A 997 Crystal Structure Of The S. Cerevisiae Dexh Helicas 5e-08
2p6r_A 702 Crystal Structure Of Superfamily 2 Helicase Hel308 6e-06
2xgj_A 1010 Structure Of Mtr4, A Dexh Helicase Involved In Nucl 8e-05
3l9o_A 1108 Crystal Structure Of Mtr4, A Co-Factor Of The Nucle 8e-05
>pdb|3RC8|A Chain A, Human Mitochondrial Helicase Suv3 In Complex With Short Rna Fragment Length = 677 Back     alignment and structure 
Iteration: 1

 Score =  399 bits (1024), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 208/474 (43%), Positives = 300/474 (63%), Gaps = 14/474 (2%)
Query: 60  TDLTRPHTWYPLARKKVRKVILHVGPTNSGKTHQALSRLESSSSGIYCGPLRLLAWEVAK 119
           +DL  P  WYP AR   RK+I H GPTNSGKT+ A+ +  S+ SG+YCGPL+LLA E+ +
Sbjct: 138 SDLRIPPNWYPDARAMQRKIIFHSGPTNSGKTYHAIQKYFSAKSGVYCGPLKLLAHEIFE 197
Query: 120 RLNKANVSCDLITGQEREEVD----GAKHRAVTVEMADVVSDYDCAVIDEIQMLGCKTRG 175
           + N A V CDL+TG+ER  V      A H + TVEM  V + Y+ AVIDEIQM+    RG
Sbjct: 198 KSNAAGVPCDLVTGEERVTVQPNGKQASHVSCTVEMCSVTTPYEVAVIDEIQMIRDPARG 257
Query: 176 FSFTRALLGICANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERLSPLVPLNVPLGSFS 235
           +++TRALLG+CA E+HLCG+PAA+ L+ +++  TG++V+V+ Y+RL+P+  L+  L S  
Sbjct: 258 WAWTRALLGLCAEEVHLCGEPAAIDLVMELMYTTGEEVEVRDYKRLTPISVLDHALESLD 317
Query: 236 NIQTGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFDVL 295
           N++ GDCIV FS++ IY + + IE RG    +++YGSLPP T+  QA +FND +    +L
Sbjct: 318 NLRPGDCIVCFSKNDIYSVSRQIEIRGLE-SAVIYGSLPPGTKLAQAKKFNDPNDPCKIL 376
Query: 296 VASDAIGMGLNLNISRIIFSTMKKFD-----GVELRDLTVPEVKQIAGRAGRYGSKFPVG 350
           VA+DAIGMGLNL+I RIIF ++ K         EL  +T  +  QIAGRAGR+ S+F  G
Sbjct: 377 VATDAIGMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRFKEG 436
Query: 351 EVTCLDSEDLPLLHKSLLEPSPMLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLENAK 410
           EVT ++ EDL LL + L  P   + +AGL P  + I M++   PD++L  +++ F++ ++
Sbjct: 437 EVTTMNHEDLSLLKEILKRPVDPIRAAGLHPTAEQIEMFAYHLPDATLSNLIDIFVDFSQ 496
Query: 411 LSENYFFANCEEVLKVATVIDQLPLRLHEKYLFCISPVDMNDDISSQGLTQFATNYSKK- 469
           +   YF  N ++    A +I  +PL L  +Y+FC +P++         L QFA  YS+  
Sbjct: 497 VDGQYFVCNMDDFKFSAELIQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQFARQYSRNE 556
Query: 470 --GIVQLREIFTPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDREL 521
                 LR  +    L  PK    L +LE++H VLDLY+WLS+R  + FPD  L
Sbjct: 557 PLTFAWLRR-YIKWPLLPPKNIKDLMDLEAVHDVLDLYLWLSYRFMDMFPDASL 609
>pdb|3RC3|A Chain A, Human Mitochondrial Helicase Suv3 Length = 677 Back     alignment and structure
>pdb|4A4Z|A Chain A, Crystal Structure Of The S. Cerevisiae Dexh Helicase Ski2 Bound To Amppnp Length = 997 Back     alignment and structure
>pdb|2P6R|A Chain A, Crystal Structure Of Superfamily 2 Helicase Hel308 In Complex With Unwound Dna Length = 702 Back     alignment and structure
>pdb|2XGJ|A Chain A, Structure Of Mtr4, A Dexh Helicase Involved In Nuclear Rna Processing And Surveillance Length = 1010 Back     alignment and structure
>pdb|3L9O|A Chain A, Crystal Structure Of Mtr4, A Co-Factor Of The Nuclear Exosome Length = 1108 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query564
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 1e-158
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1yks_A440 Genome polyprotein [contains: flavivirin protease 8e-10
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 2e-09
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 4e-09
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 4e-05
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 5e-09
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 6e-09
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 4e-08
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 4e-06
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 1e-07
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 1e-07
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 1e-07
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 4e-07
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 7e-07
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 2e-06
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 2e-06
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 1e-04
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 5e-05
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Length = 677 Back     alignment and structure
 Score =  468 bits (1204), Expect = e-158
 Identities = 207/510 (40%), Positives = 308/510 (60%), Gaps = 12/510 (2%)

Query: 57  FDFTDLTRPHTWYPLARKKVRKVILHVGPTNSGKTHQALSRLESSSSGIYCGPLRLLAWE 116
              +DL  P  WYP AR   RK+I H GPTNSGKT+ A+ +  S+ SG+YCGPL+LLA E
Sbjct: 135 RKISDLRIPPNWYPDARAMQRKIIFHSGPTNSGKTYHAIQKYFSAKSGVYCGPLKLLAHE 194

Query: 117 VAKRLNKANVSCDLITGQEREEVD----GAKHRAVTVEMADVVSDYDCAVIDEIQMLGCK 172
           + ++ N A V CDL+TG+ER  V      A H + TVEM  V + Y+ AVIDEIQM+   
Sbjct: 195 IFEKSNAAGVPCDLVTGEERVTVQPNGKQASHVSCTVEMCSVTTPYEVAVIDEIQMIRDP 254

Query: 173 TRGFSFTRALLGICANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERLSPLVPLNVPLG 232
            RG+++TRALLG+CA E+HLCG+PAA+ L+ +++  TG++V+V+ Y+RL+P+  L+  L 
Sbjct: 255 ARGWAWTRALLGLCAEEVHLCGEPAAIDLVMELMYTTGEEVEVRDYKRLTPISVLDHALE 314

Query: 233 SFSNIQTGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEF 292
           S  N++ GDCIV FS++ IY + + IE RG    +++YGSLPP T+  QA +FND +   
Sbjct: 315 SLDNLRPGDCIVCFSKNDIYSVSRQIEIRGLE-SAVIYGSLPPGTKLAQAKKFNDPNDPC 373

Query: 293 DVLVASDAIGMGLNLNISRIIFSTMKKFD-----GVELRDLTVPEVKQIAGRAGRYGSKF 347
            +LVA+DAIGMGLNL+I RIIF ++ K         EL  +T  +  QIAGRAGR+ S+F
Sbjct: 374 KILVATDAIGMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRF 433

Query: 348 PVGEVTCLDSEDLPLLHKSLLEPSPMLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLE 407
             GEVT ++ EDL LL + L  P   + +AGL P  + I M++   PD++L  +++ F++
Sbjct: 434 KEGEVTTMNHEDLSLLKEILKRPVDPIRAAGLHPTAEQIEMFAYHLPDATLSNLIDIFVD 493

Query: 408 NAKLSENYFFANCEEVLKVATVIDQLPLRLHEKYLFCISPVDMNDDISSQGLTQFATNYS 467
            +++   YF  N ++    A +I  +PL L  +Y+FC +P++         L QFA  YS
Sbjct: 494 FSQVDGQYFVCNMDDFKFSAELIQHIPLSLRVRYVFCTAPINKKQPFVCSSLLQFARQYS 553

Query: 468 KKGIVQLREI--FTPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDRELAASQ 525
           +   +    +  +    L  PK    L +LE++H VLDLY+WLS+R  + FPD  L    
Sbjct: 554 RNEPLTFAWLRRYIKWPLLPPKNIKDLMDLEAVHDVLDLYLWLSYRFMDMFPDASLIRDL 613

Query: 526 KAICSMLIEEFLERLGWQKPRVKKVTPRPK 555
           +     +I++ +  +       +       
Sbjct: 614 QKELDGIIQDGVHNITKLIKMSETHKLLNL 643
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Length = 997 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query564
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 100.0
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.98
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 99.97
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.97
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.97
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 99.97
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 99.97
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.97
4gl2_A699 Interferon-induced helicase C domain-containing P; 99.97
1yks_A440 Genome polyprotein [contains: flavivirin protease 99.97
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 99.97
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 99.97
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 99.96
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.96
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.96
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.96
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 99.96
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 99.96
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 99.96
3h1t_A590 Type I site-specific restriction-modification syst 99.94
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 99.94
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.92
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.91
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 99.91
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.9
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.85
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.84
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.84
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.81
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.81
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.8
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.8
3jux_A822 Protein translocase subunit SECA; protein transloc 99.8
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 99.79
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.79
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.78
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.78
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 99.77
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.76
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.76
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.76
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 99.76
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.75
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.75
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.75
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.74
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 99.74
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.74
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.74
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.73
3bor_A237 Human initiation factor 4A-II; translation initiat 99.73
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.72
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.71
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.55
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.57
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.55
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.52
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.51
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.49
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.45
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.45
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.37
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 98.92
3i4u_A270 ATP-dependent RNA helicase DHX8; splicing, ATP-bin 98.83
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 98.28
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.22
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 98.19
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.15
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 98.09
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.04
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 97.84
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.77
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.72
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 97.37
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 97.33
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 97.15
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 96.87
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 96.85
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.82
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.81
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.78
3bos_A242 Putative DNA replication factor; P-loop containing 96.66
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 96.58
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.18
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.06
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.93
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.92
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 95.48
2qgz_A308 Helicase loader, putative primosome component; str 95.35
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 95.09
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 94.91
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 94.9
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 94.89
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 94.75
2v1u_A387 Cell division control protein 6 homolog; DNA repli 94.45
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 94.38
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.28
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 94.25
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 94.18
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 94.0
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 93.96
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.71
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 93.64
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 93.62
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 93.59
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 93.48
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 93.46
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 93.43
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 93.4
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 93.16
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 93.01
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 92.89
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 92.8
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 92.74
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 92.62
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 92.62
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 92.49
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 92.37
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 92.11
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 91.96
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 91.94
2gno_A305 DNA polymerase III, gamma subunit-related protein; 91.81
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 91.73
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 91.72
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 91.62
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 91.55
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 91.34
2eyu_A261 Twitching motility protein PILT; pilus retraction 91.3
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 91.25
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 91.19
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 91.14
3co5_A143 Putative two-component system transcriptional RES 91.08
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 91.07
3vaa_A199 Shikimate kinase, SK; structural genomics, center 91.06
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 90.99
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 90.99
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 90.91
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 90.81
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 90.78
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 90.7
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 90.53
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 90.53
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 90.52
1c9k_A180 COBU, adenosylcobinamide kinase; alpha/beta struct 90.34
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 90.25
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 90.2
2oap_1511 GSPE-2, type II secretion system protein; hexameri 90.18
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 90.1
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 90.09
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 90.0
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 89.92
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 89.89
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 89.88
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 89.77
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 89.77
2z43_A324 DNA repair and recombination protein RADA; archaea 89.74
1kag_A173 SKI, shikimate kinase I; transferase, structural g 89.73
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 89.72
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 89.58
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 89.58
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 89.56
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 89.5
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 89.4
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 89.37
2cvh_A220 DNA repair and recombination protein RADB; filamen 89.2
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 89.15
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 88.99
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 88.95
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 88.9
2ewv_A372 Twitching motility protein PILT; pilus retraction 88.8
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 88.79
3cmw_A1706 Protein RECA, recombinase A; homologous recombinat 88.76
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 88.73
1vma_A306 Cell division protein FTSY; TM0570, structural gen 88.73
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 88.67
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 88.65
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 88.63
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 88.6
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 88.59
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 88.59
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 88.49
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 88.36
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 88.23
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 88.21
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 88.2
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 88.18
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 88.1
1p9r_A418 General secretion pathway protein E; bacterial typ 88.02
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 87.98
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 87.9
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 87.88
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 87.87
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 87.76
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 87.74
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 87.68
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 87.48
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 87.46
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 87.41
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 87.39
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 87.39
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 87.32
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 87.3
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 87.25
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 87.18
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 87.16
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 87.05
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 87.04
2vli_A183 Antibiotic resistance protein; transferase, tunica 86.98
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 86.94
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 86.92
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 86.89
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 86.84
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 86.81
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 86.62
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 86.54
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 86.52
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 86.52
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 86.45
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 86.43
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 86.38
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 86.31
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 86.26
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 86.19
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 86.08
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 86.05
1via_A175 Shikimate kinase; structural genomics, transferase 86.02
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 85.86
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 85.85
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 85.77
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 85.68
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 85.64
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 85.63
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 85.56
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 85.5
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 85.43
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 85.37
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 85.36
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 85.35
4a74_A231 DNA repair and recombination protein RADA; hydrola 85.35
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 85.35
3tlx_A243 Adenylate kinase 2; structural genomics, structura 85.29
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 85.29
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 85.1
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 85.06
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 85.06
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 85.0
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 84.93
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 84.83
1u94_A356 RECA protein, recombinase A; homologous recombinat 84.65
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 84.62
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 84.62
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 84.54
2chg_A226 Replication factor C small subunit; DNA-binding pr 84.52
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 84.51
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 84.37
3kta_A182 Chromosome segregation protein SMC; structural mai 84.26
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 84.18
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 84.15
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 84.11
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 84.11
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 83.91
3io5_A333 Recombination and repair protein; storage dimer, i 83.91
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 83.73
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 83.72
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 83.69
1tue_A212 Replication protein E1; helicase, replication, E1E 83.67
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 83.62
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 83.59
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 83.56
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 83.55
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 83.45
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 83.4
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 83.33
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 83.21
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 83.21
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 83.15
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 83.02
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 82.93
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 82.91
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 82.88
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 82.88
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 82.78
2og2_A359 Putative signal recognition particle receptor; nuc 82.6
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 82.55
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 82.51
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 82.5
1xp8_A366 RECA protein, recombinase A; recombination, radior 82.45
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 82.44
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 82.4
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 82.39
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 82.38
1sgw_A214 Putative ABC transporter; structural genomics, P p 82.37
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 82.29
2ghi_A260 Transport protein; multidrug resistance protein, M 82.24
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 82.24
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 82.23
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 82.23
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 82.11
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 82.08
1g6h_A257 High-affinity branched-chain amino acid transport 82.04
1b0u_A262 Histidine permease; ABC transporter, transport pro 81.93
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 81.92
1ji0_A240 ABC transporter; ATP binding protein, structural g 81.85
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 81.75
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 81.6
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 81.5
1ojl_A304 Transcriptional regulatory protein ZRAR; response 81.47
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 81.34
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 81.23
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 81.15
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 80.97
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 80.89
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 80.87
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 80.84
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 80.79
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 80.76
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 80.69
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 80.65
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 80.6
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 80.36
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 80.31
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 80.29
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 80.26
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 80.25
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 80.24
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 80.11
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
Probab=100.00  E-value=8.2e-71  Score=608.94  Aligned_cols=484  Identities=43%  Similarity=0.765  Sum_probs=442.6

Q ss_pred             cCCCCCCccccchHHHhcCCceEEEEccCCccHHHHHHHHHHcCCCEEEEccHHHHHHHHHHHHHhcCCeeEEEeCcccc
Q 008489           58 DFTDLTRPHTWYPLARKKVRKVILHVGPTNSGKTHQALSRLESSSSGIYCGPLRLLAWEVAKRLNKANVSCDLITGQERE  137 (564)
Q Consensus        58 ~~~~~~~~q~~~p~~~~~~~~~viv~apTGsGKT~~~~~~l~~~~~~li~~P~r~La~q~~~~l~~~g~~~~~~~G~~~~  137 (564)
                      .+.+++.+++|+|.++.+++++++++||||||||+.+++.+...++++|++|+|+||.|+++++++.|++|++++|+...
T Consensus       136 ~i~dl~~p~~~~p~ar~l~rk~vlv~apTGSGKT~~al~~l~~~~~gl~l~PtR~LA~Qi~~~l~~~g~~v~lltG~~~~  215 (677)
T 3rc3_A          136 KISDLRIPPNWYPDARAMQRKIIFHSGPTNSGKTYHAIQKYFSAKSGVYCGPLKLLAHEIFEKSNAAGVPCDLVTGEERV  215 (677)
T ss_dssp             HHTBCCCGGGGCHHHHTSCCEEEEEECCTTSSHHHHHHHHHHHSSSEEEEESSHHHHHHHHHHHHHTTCCEEEECSSCEE
T ss_pred             HHhhccChhhhCHHHHhcCCCEEEEEcCCCCCHHHHHHHHHHhcCCeEEEeCHHHHHHHHHHHHHhcCCcEEEEECCeeE
Confidence            45778889999999999999999999999999999999999999999999999999999999999999999999999876


Q ss_pred             ccC----CCceEEEcceeccccCcccEEEEccccccCCCCCcchHHHHHhccCccceEEEccCCCchHHHHHHHHcCCce
Q 008489          138 EVD----GAKHRAVTVEMADVVSDYDCAVIDEIQMLGCKTRGFSFTRALLGICANELHLCGDPAAVPLIQQILQVTGDDV  213 (564)
Q Consensus       138 ~~~----~~~~i~~T~e~~~~l~~~~~vViDEaH~~~~~~rg~~~~~~ll~l~~~~~~l~~~~~~~~~~~~l~~~~g~~~  213 (564)
                      ...    ...++++|+++++....++++||||+|++.+.++|+.|...+.++.+..+++++.+++.+.+..+....+..+
T Consensus       216 iv~TpGr~~~il~~T~e~~~l~~~v~lvVIDEaH~l~d~~~g~~~~~~l~~l~~~~i~il~~SAT~~~i~~l~~~~~~~~  295 (677)
T 3rc3_A          216 TVQPNGKQASHVSCTVEMCSVTTPYEVAVIDEIQMIRDPARGWAWTRALLGLCAEEVHLCGEPAAIDLVMELMYTTGEEV  295 (677)
T ss_dssp             CCSTTCCCCSEEEEEGGGCCSSSCEEEEEECSGGGGGCTTTHHHHHHHHHHCCEEEEEEEECGGGHHHHHHHHHHHTCCE
T ss_pred             EecCCCcccceeEecHhHhhhcccCCEEEEecceecCCccchHHHHHHHHccCccceEEEeccchHHHHHHHHHhcCCce
Confidence            543    3679999999999999999999999999999889999999999999888999999999999999999899999


Q ss_pred             EEEeecccCCCCCCCccccccccccCCCeEEEccHHHHHHHHHHHHHcCCCeEEEEcCCCCHHHHHHHHHHHhCCCCCee
Q 008489          214 KVQSYERLSPLVPLNVPLGSFSNIQTGDCIVTFSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFD  293 (564)
Q Consensus       214 ~v~~~~~~~~~~~~~~~l~~l~~~~~g~~iv~~s~~~~~~l~~~L~~~~~~~v~~lhg~l~~~~R~~~~~~F~~~~g~~~  293 (564)
                      .+..+.+..++......+..+.+..+|++|||+++++++.+++.|++.+. .+.++||+|++++|..+++.|++++|.++
T Consensus       296 ~v~~~~r~~~l~~~~~~l~~l~~~~~g~iIf~~s~~~ie~la~~L~~~g~-~v~~lHG~L~~~~R~~~~~~F~~~~g~~~  374 (677)
T 3rc3_A          296 EVRDYKRLTPISVLDHALESLDNLRPGDCIVCFSKNDIYSVSRQIEIRGL-ESAVIYGSLPPGTKLAQAKKFNDPNDPCK  374 (677)
T ss_dssp             EEEECCCSSCEEECSSCCCSGGGCCTTEEEECSSHHHHHHHHHHHHHTTC-CCEEECTTSCHHHHHHHHHHHHCTTSSCC
T ss_pred             EEEEeeecchHHHHHHHHHHHHhcCCCCEEEEcCHHHHHHHHHHHHhcCC-CeeeeeccCCHHHHHHHHHHHHccCCCeE
Confidence            99888888887777666666777788898888899999999999998765 89999999999999999999998778899


Q ss_pred             EEEeccccccccccCccEEEecCccccC----C-ccccccCHhhHHhhhccCCCCCCCCCcEEEEEecCCCHHHHHhhhC
Q 008489          294 VLVASDAIGMGLNLNISRIIFSTMKKFD----G-VELRDLTVPEVKQIAGRAGRYGSKFPVGEVTCLDSEDLPLLHKSLL  368 (564)
Q Consensus       294 VlVaT~~~~~Gldipv~~VI~~~~~k~~----~-~~~~p~s~~~~~Qr~GRaGR~g~~~~~G~~~~l~~~~~~~~~~~~~  368 (564)
                      |||||+++++|||++|++||+++..+|+    | .+.+|+|.++|.||+|||||.|..+..|.|+.+++++...+++++.
T Consensus       375 VLVATdi~e~GlDi~v~~VI~~~~~k~~~~~~G~~~~~p~s~~~~~QR~GRAGR~g~~g~~G~v~~l~~~d~~~~~~~~~  454 (677)
T 3rc3_A          375 ILVATDAIGMGLNLSIRRIIFYSLIKPSINEKGERELEPITTSQALQIAGRAGRFSSRFKEGEVTTMNHEDLSLLKEILK  454 (677)
T ss_dssp             EEEECGGGGSSCCCCBSEEEESCSBC-----------CBCCHHHHHHHHTTBTCTTSSCSSEEEEESSTTHHHHHHHHHH
T ss_pred             EEEeCcHHHCCcCcCccEEEECCccccccccCCccccccCCHHHHHHHhcCCCCCCCCCCCEEEEEEecchHHHHHHHHh
Confidence            9999999999999999999999998863    2 2467999999999999999999654559999999998889999999


Q ss_pred             CCChhhhhcCCCCcHHHHHHHHhhCCCCCHHHHHHHHHHhcccCCCccccCHHHHHHHHHHhccCCCCHHHHHHHhccCC
Q 008489          369 EPSPMLESAGLFPNFDLIYMYSRLHPDSSLYGILEHFLENAKLSENYFFANCEEVLKVATVIDQLPLRLHEKYLFCISPV  448 (564)
Q Consensus       369 ~~~~ei~~~~l~~~~~~l~~~~~~~~~~~~~~~l~~f~~~~~~~~~~~~~~~~~l~~l~~~~~~~~lt~~~~~~~~~~P~  448 (564)
                      ...++|.++++.|..++++.|+...|+..+.++++.+......+..|++++++++..+++++++.+|+..+++.|+.+|+
T Consensus       455 ~~~~~i~~~~l~p~~~~l~~~~~~l~~~~l~ell~~l~~~~~vd~~f~~~~l~~~~~la~~l~~~~L~~~~~~~f~~aP~  534 (677)
T 3rc3_A          455 RPVDPIRAAGLHPTAEQIEMFAYHLPDATLSNLIDIFVDFSQVDGQYFVCNMDDFKFSAELIQHIPLSLRVRYVFCTAPI  534 (677)
T ss_dssp             SCCCCCCCEEECCCHHHHHHHHHHSTTSCHHHHHHHHHHHCBCCTTEEECCCHHHHHHHHHTTTSCCCHHHHHHHHHSCC
T ss_pred             cCcchhhhccCCChHHHHHHHhccCCcchHHHHHHHHHHhhcccchhhccchHHHHHHHHHHhhCCCCHHHHhheEeCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCHHHHHHHHHHHHHHhhcCccchhhhc--cCCCCCCCCcHHHHHHHHHHHHHHHHHHHhhhhcCCCCCCHHHHHHHH
Q 008489          449 DMNDDISSQGLTQFATNYSKKGIVQLREIF--TPGTLQVPKTQAALRELESIHKVLDLYVWLSFRLEESFPDRELAASQK  526 (564)
Q Consensus       449 ~~~~~~~~~~l~~~~~~~~~~~~~~i~~~~--~~~~~~~~~~~~~l~~le~~~~~~~~y~wl~~r~~~~f~~~~~~~~~~  526 (564)
                      +..+|..+.+|..|++.++.++.+++..+.  ...|...+.+..+|.+||.+|+++++|+|||+|||++|+|.+.|+++|
T Consensus       535 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~~~~~~~y~wls~r~~~~f~~~~~~~~~~  614 (677)
T 3rc3_A          535 NKKQPFVCSSLLQFARQYSRNEPLTFAWLRRYIKWPLLPPKNIKDLMDLEAVHDVLDLYLWLSYRFMDMFPDASLIRDLQ  614 (677)
T ss_dssp             CTTCHHHHHHHHHHHHHHHTTCCCCHHHHHHHTTSSCCCCSSHHHHHHHHHHHHHHHHHHHHHTTCTTTSTTHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHcCCCCCHHHHhhccCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhhccccCCCHHHHHHHH
Confidence            999999999999999999999999987554  244566778888999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcCC
Q 008489          527 AICSMLIEEFLERLGW  542 (564)
Q Consensus       527 ~~~~~~i~~~l~~~~~  542 (564)
                      ..|+.+|++.|.+++.
T Consensus       615 ~~~~~~i~~~~~~~~~  630 (677)
T 3rc3_A          615 KELDGIIQDGVHNITK  630 (677)
T ss_dssp             HHHHHHHHHHHHTHHH
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            9999999999998653
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 564
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 3e-14
d1yksa2299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 5e-08
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 2e-05
d2p6ra4201 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglob 2e-05
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

 Score = 71.5 bits (174), Expect = 3e-14
 Identities = 42/292 (14%), Positives = 82/292 (28%), Gaps = 32/292 (10%)

Query: 77  RKVILHVGPTNSGKTHQALSRL-----ESSSSGIYCGPLRLLAWEVAKRLNKANVSCDLI 131
           +++ +      +GKT + L  +     +     +   P R++A E+ + L    +     
Sbjct: 9   KRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGLPIRYQTP 68

Query: 132 ----TGQEREEVDGAKHRAVTVEMADVVS--DYDCAVIDEIQMLGCKTRGFSFTRALLGI 185
                   RE VD   H   T+ +   +   +Y+  ++DE       +      R  +  
Sbjct: 69  AIRAEHTGREIVDLMCHATFTMRLLSPIRVPNYNLIIMDEAHFTDPASIAA---RGYIST 125

Query: 186 CANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERLSPLVPLNVPLGSFSNIQTGDCIVT 245
                   G                 +  +   ER  P    N      ++ +       
Sbjct: 126 RVEMGEAAGIFMTATPPGSRDPFPQSNAPIMDEEREIPERSWNSGHEWVTDFKGKTVWFV 185

Query: 246 FSRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFDVLVASDAIGMGL 305
            S  A   +   +   GK +  +           +  T       ++D +V +D   MG 
Sbjct: 186 PSIKAGNDIAACLRKNGKKVIQL-SRKTFDSEYIKTRTN------DWDFVVTTDISEMGA 238

Query: 306 NLNISRIIFSTMKKFDGVELRDLTVPEV-----------KQIAGRAGRYGSK 346
           N    R+I         +         +            Q  GR GR    
Sbjct: 239 NFKAERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNPKN 290
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 201 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query564
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.97
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.84
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.82
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.82
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.82
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.81
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.81
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.81
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.8
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 99.8
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.8
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 99.79
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.79
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.78
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.78
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.77
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 99.77
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 99.75
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.74
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 99.7
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.69
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.68
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 99.68
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.65
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.64
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.57
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.54
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.52
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.51
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.5
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.49
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.48
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.41
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.41
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.32
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.3
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.24
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.2
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.89
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.87
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.35
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 98.25
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 98.14
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.77
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 97.17
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.78
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.52
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 96.27
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.19
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 96.13
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 96.08
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.08
d1okkd2207 GTPase domain of the signal recognition particle r 96.05
d1vmaa2213 GTPase domain of the signal recognition particle r 95.63
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.56
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 95.48
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.36
d2qy9a2211 GTPase domain of the signal recognition particle r 95.32
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 95.3
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 95.03
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.99
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 94.96
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.76
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 94.68
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 94.48
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.44
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 94.44
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 93.99
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 93.86
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 93.7
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 93.63
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 93.6
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 93.55
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 93.48
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 93.46
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 93.44
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.29
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 93.19
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.11
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 93.04
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 92.7
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 92.64
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 92.54
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 92.51
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 92.48
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 92.44
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 92.38
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 92.38
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 92.25
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 92.05
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 91.99
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 91.86
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 91.83
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 91.82
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 91.81
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 91.77
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 91.77
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 91.7
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 91.63
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 91.62
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 91.47
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 91.42
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 91.34
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 90.98
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 90.95
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 90.87
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 90.75
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 90.52
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 90.39
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 90.31
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 90.3
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 90.14
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 90.05
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 89.98
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 89.97
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 89.93
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 89.93
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-termin 89.69
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 89.53
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 89.44
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 89.42
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 89.38
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 89.28
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 89.2
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 89.04
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 88.96
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 88.7
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 88.51
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 88.23
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 88.22
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 88.02
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 87.88
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 87.72
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 87.15
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 86.89
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 86.72
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 86.71
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 86.57
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 86.36
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 86.23
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 86.16
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 85.92
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 85.88
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 85.84
d2hyda1255 Putative multidrug export ATP-binding/permease pro 85.84
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 85.83
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 85.81
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 85.75
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 85.31
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 85.1
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 85.04
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 84.87
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 84.77
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 84.59
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 84.57
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 84.53
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 84.41
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 84.28
d2awna2232 Maltose transport protein MalK, N-terminal domain 83.78
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 83.7
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 83.45
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 83.34
d1g2912240 Maltose transport protein MalK, N-terminal domain 83.14
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 82.96
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 82.96
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 82.95
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 82.42
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 82.17
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 82.11
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 81.69
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 81.61
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 81.46
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 81.28
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 80.91
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 80.61
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 80.52
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 80.38
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 80.28
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 80.23
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=99.97  E-value=1e-31  Score=269.35  Aligned_cols=259  Identities=16%  Similarity=0.119  Sum_probs=172.6

Q ss_pred             cCCceEEEEccCCccHHHHHHHHHH-----cCCCEEEEccHHHHHHHHHHHHHhcCCeeEEEeCccccccCCCceEEEcc
Q 008489           75 KVRKVILHVGPTNSGKTHQALSRLE-----SSSSGIYCGPLRLLAWEVAKRLNKANVSCDLITGQEREEVDGAKHRAVTV  149 (564)
Q Consensus        75 ~~~~~viv~apTGsGKT~~~~~~l~-----~~~~~li~~P~r~La~q~~~~l~~~g~~~~~~~G~~~~~~~~~~~i~~T~  149 (564)
                      .+++++++.||||||||++++.+++     .+.+++|++|+|+||.|+++++++++..+....++.. ......++++|+
T Consensus         7 ~~~~~~lv~~~TGsGKT~~~l~~~~~~~~~~~~~~lvi~Ptr~La~q~~~~l~~~~~~~~~~~~~~~-~~~~~~i~~~t~   85 (305)
T d2bmfa2           7 RKKRLTIMDLHPGAGKTKRYLPAIVREAIKRGLRTLILAPTRVVAAEMEEALRGLPIRYQTPAIRAE-HTGREIVDLMCH   85 (305)
T ss_dssp             STTCEEEECCCTTSSTTTTHHHHHHHHHHHHTCCEEEEESSHHHHHHHHHHTTTSCCBCCC---------CCCSEEEEEH
T ss_pred             hcCCcEEEEECCCCCHHHHHHHHHHHHHHhcCCEEEEEccHHHHHHHHHHHHhcCCcceeeeEEeec-ccCccccccCCc
Confidence            4689999999999999988654443     4678999999999999999999987665443322221 224567788887


Q ss_pred             eec-------cccCcccEEEEccccccCCCCCcchHHHHHhcc-CccceEEEccCCCchHHHHHHHHcCCceEEEeeccc
Q 008489          150 EMA-------DVVSDYDCAVIDEIQMLGCKTRGFSFTRALLGI-CANELHLCGDPAAVPLIQQILQVTGDDVKVQSYERL  221 (564)
Q Consensus       150 e~~-------~~l~~~~~vViDEaH~~~~~~rg~~~~~~ll~l-~~~~~~l~~~~~~~~~~~~l~~~~g~~~~v~~~~~~  221 (564)
                      ..+       ..+.+++++|+||+|++...  ++.+...+..+ .....+++..+++.+....  .......++......
T Consensus        86 ~~l~~~~~~~~~~~~~~~vViDE~H~~~~~--~~~~~~~l~~~~~~~~~~~v~~SAT~~~~~~--~~~~~~~~~~~~~~~  161 (305)
T d2bmfa2          86 ATFTMRLLSPIRVPNYNLIIMDEAHFTDPA--SIAARGYISTRVEMGEAAGIFMTATPPGSRD--PFPQSNAPIMDEERE  161 (305)
T ss_dssp             HHHHHHHTSSSCCCCCSEEEEESTTCCSHH--HHHHHHHHHHHHHHTSCEEEEECSSCTTCCC--SSCCCSSCEEEEECC
T ss_pred             HHHHHHHhcCccccceeEEEeeeeeecchh--hHHHHHHHHHhhccccceEEEeecCCCccee--eecccCCcceEEEEe
Confidence            654       23578999999999998643  33322222111 1223444555555432110  111122222222222


Q ss_pred             CCCCCCCccccccccccCCCeEEEc-cHHHHHHHHHHHHHcCCCeEEEEcCCCCHHHHHHHHHHHhCCCCCeeEEEeccc
Q 008489          222 SPLVPLNVPLGSFSNIQTGDCIVTF-SRHAIYRLKKAIESRGKHLCSIVYGSLPPETRTRQATRFNDASSEFDVLVASDA  300 (564)
Q Consensus       222 ~~~~~~~~~l~~l~~~~~g~~iv~~-s~~~~~~l~~~L~~~~~~~v~~lhg~l~~~~R~~~~~~F~~~~g~~~VlVaT~~  300 (564)
                      .+..........+. ..++..++|+ ++++++++++.|++.+. .+..+||+++.+.    ...|++  |..+++|||++
T Consensus       162 ~~~~~~~~~~~~~~-~~~~~~lvf~~~~~~~~~l~~~L~~~~~-~~~~l~~~~~~~~----~~~~~~--~~~~~lvaT~~  233 (305)
T d2bmfa2         162 IPERSWNSGHEWVT-DFKGKTVWFVPSIKAGNDIAACLRKNGK-KVIQLSRKTFDSE----YIKTRT--NDWDFVVTTDI  233 (305)
T ss_dssp             CCCSCCSSCCHHHH-SSCSCEEEECSCHHHHHHHHHHHHHHTC-CCEECCTTCHHHH----GGGGGT--SCCSEEEECGG
T ss_pred             ccHHHHHHHHHHHH-hhCCCEEEEeccHHHHHHHHHHHHhCCC-CEEEeCCcChHHH----Hhhhhc--cchhhhhhhHH
Confidence            22222222222222 2456677777 89999999999999887 8999999997653    346777  89999999999


Q ss_pred             cccccccCccEEEecCccc-----cCCc------cccccCHhhHHhhhccCCCCCCC
Q 008489          301 IGMGLNLNISRIIFSTMKK-----FDGV------ELRDLTVPEVKQIAGRAGRYGSK  346 (564)
Q Consensus       301 ~~~Gldipv~~VI~~~~~k-----~~~~------~~~p~s~~~~~Qr~GRaGR~g~~  346 (564)
                      +++|+|++++.||+.+...     |++.      ...|+|.++|+||+|||||.|.+
T Consensus       234 ~~~G~~~~~~~Vi~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~Qr~GR~GR~~~~  290 (305)
T d2bmfa2         234 SEMGANFKAERVIDPRRCMKPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNPKN  290 (305)
T ss_dssp             GGTTCCCCCSEEEECCEEEEEEEECSSSCEEEEEEEEECCHHHHHHHHTTSSCSSSC
T ss_pred             HHhcCCCCccEEEEcCCceeeeEecCCCCceEEeccccCCHHHHhhhhcCcCcCCCC
Confidence            9999999999999766432     3332      24688999999999999999985
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure