Citrus Sinensis ID: 008735

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-----

MPSVAEGEVSNSTHNPKLHSKPFFNDSSSRRQKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVTQPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDDRTSTSTRIKEALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNNNENSDMILDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGMESLLVVPISKAQALQRSGRAGREGPGKCFRLYPENEFDKLEDSTKPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYSKALIVAGQFNCLEEMLITVAMLSVESIFFRSPGEVRRGKKCNEIFCKSRWRSPHFD

cccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccEEEEEcccccccccHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccHHHHccccccccccEEEEcccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccHHHHHHHcccccEEEEcccccccEEEEcccccccHHHHHHHHHHHHHcccccccEEEEcccHHHHHHHHHHHHHHHHHccccccccEEEEccccccHHHHHcccccccccccEEEEEccccccccccccEEEEEcccccccccccccccccEEEccccHHHHHHccccccccccccEEEEcccHHHHHcccccccccHHccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHccccccccHHHHHHccccccHHHHHHHHHHHccccEEEcccHHHHHHHHHHHHHHHccccccccc

ccccccccccccccccHHcccccccccHHHcccHHHHHccccHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHccccccccEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccHHHHHHHHHccccHHHcEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccccEEEccccccccccEcccccccccccEEEccccccccccEEEEEEccccHHHHHHHHccccEEEcccccccEEEEEccccHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHHHHHHHHccccccEEEEEEHccccHHHHHHHcccccccccEEEEEEEEEEEEEEEccEEEEEcccccEEccccccccccEEEEcEccHHHHHHHcccccccccccEEEEEcHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHcccccEEccHHHHHHHHHHHHHHccccccccccc

mpsvaegevsnsthnpklhskpffndsssRRQKILQQRKSLPIASVEKRLVEEVRKNDILIIVgetgsgkttqlpqflfhagfcrdgkligvtqpRRVAAVTVAKRVAEESGvelgqrvgysirfddrtstsTRIKEALLDPYLSRYSAIIvdeahertvHTDVLLGLLKKVQNarsksadghsngnnnnensdmildrgndtngintlkqcqgrkfapLKLIIMSASldargfseYFGCAKAvhvqgrqfpvEILYtlypepdyldaTLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLvtvpifsslpseqqmrVFAPAAAGFRKVILAtniaetsvtipgikyvidpgfvkarlydpvkgmesLLVVPISKAQALQrsgragregpgkcfrlypenefdkledstkpeikrcnLSNVILQLKalgvddiigfdfmekpsrASIIKSLEQLFLLGaltddcklsdpvghqmarlpldpiysKALIVAGQFNCLEEMLITVAMLSVESiffrspgevrrgkkcneifcksrwrsphfd

mpsvaegevsnsthnpklhskpffndsssRRQKILqqrkslpiasvekrlveevrknDILIIvgetgsgkttqLPQFLFHAGFCRDGKLIGVTQPRRVAAVTVAKrvaeesgvelgqrvgysirfddrtststrikealldpYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARsksadghsngnnnneNSDMILDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAGFRKVILATniaetsvtipgikyvidPGFVKARLYDPVKGMESLLVVPISKAQalqrsgragregpgkcfrlypenefdkledstkpeikrcnLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYSKALIVAGQFNCLEEMLITVAMLSVESIFfrspgevrrgkkcneifcksrwrsphfd

MPSVAEGEVSNSTHNPKLHSKPFFNDSSSRRQKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVTQPrrvaavtvakrvaEESGVELGQRVGYSIRFDDRTSTSTRIKEALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSngnnnnenSDMILDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGMESLLVVPISKAQALQRSGRAGREGPGKCFRLYPENEFDKLEDSTKPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYSKALIVAGQFNCLEEMLITVAMLSVESIFFRSPGEVRRGKKCNEIFCKSRWRSPHFD

*********************************************VEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVTQPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDDRTSTSTRIKEALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKK*********************************GINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGMESLLVVPISK*****************CFRLYP*************EIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYSKALIVAGQFNCLEEMLITVAMLSVESIFFRSPGEVRRGKKCNEIFCKSRW******

************************************QRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVTQPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDDRTSTSTRIKEALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSAD*HSNGNNNNENSDMILDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERL*****ASRKLVTVPIFSSLPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGMESLLVVPISKAQALQRSGRAGREGPGKCFRLYPENEFDKLEDSTKPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYSKALIVAGQFNCLEEMLITVAMLSVESI**********************WR*****

*************HNPKLHSKPFFNDSSSRRQKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVTQPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDDRTSTSTRIKEALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQ***********NGNNNNENSDMILDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGMESLLVVPISK*************GPGKCFRLYPENEFDKLEDSTKPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYSKALIVAGQFNCLEEMLITVAMLSVESIFFRSPGEVRRGKKCNEIFCKSRWRSPHFD

*******************************QKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVTQPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDDRTSTSTRIKEALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNNNENSDMILDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGMESLLVVPISKAQ***********GPGKCFRLYPENEFDKLEDSTKPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYSKALIVAGQFNCLEEMLITVAMLSVESIFFRSPGEVRRGKKC***************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		555	2.2.26 [Sep-21-2011]
A2A4P0		1244	ATP-dependent RNA helicas	yes	no	0.848	0.378	0.486	1e-137
Q14562		1220	ATP-dependent RNA helicas	yes	no	0.848	0.386	0.486	1e-137
O42643		1168	Pre-mRNA-splicing factor	yes	no	0.814	0.386	0.505	1e-136
Q09530		1200	Probable pre-mRNA-splicin	yes	no	0.859	0.397	0.483	1e-134
Q03319		719	Probable ATP-dependent RN	no	no	0.828	0.639	0.474	1e-133
Q54F05		1160	ATP-dependent RNA helicas	no	no	0.830	0.397	0.482	1e-132
Q80VY9		698	Putative ATP-dependent RN	no	no	0.843	0.670	0.460	1e-129
Q54MH3		1106	Putative pre-mRNA-splicin	no	no	0.837	0.420	0.468	1e-129
Q38953		1168	Probable pre-mRNA-splicin	no	no	0.816	0.387	0.480	1e-129
O45244		1008	Probable pre-mRNA-splicin	no	no	0.843	0.464	0.463	1e-128

>sp\|A2A4P0\|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1	Back alignment and function desciption

 Score =  489 bits (1259), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 257/528 (48%), Positives = 351/528 (66%), Gaps = 57/528 (10%)

Query: 16   PKLHSKPFFNDSSSRRQK----ILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKT 71
            P+     F  + +S  +K    IL+QR+SLPI  ++++LV+ V  N ILI++GETGSGKT
Sbjct: 560  PEWKKHAFGGNKASYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKT 619

Query: 72   TQLPQFLFHAGFCRDGKLIGVTQPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDDRTST 131
            TQ+ Q+L  AG+   GK IG TQPRRVAA++VAKRV+EE G  LGQ VGY+IRF+D TS 
Sbjct: 620  TQITQYLAEAGYTSRGK-IGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSP 678

Query: 132  STRIK---------EALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADG 182
             T IK         E L+DP L++Y+ I++DEAHERT+HTDVL GLLKK    R      
Sbjct: 679  ETVIKYMTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQD---- 734

Query: 183  HSNGNNNNENSDMILDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAK 242
                                                 +KLI+ SA+LDA  FS+YF  A 
Sbjct: 735  -------------------------------------MKLIVTSATLDAVKFSQYFYEAP 757

Query: 243  AVHVQGRQFPVEILYTLYPEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLV 302
               + GR +PVEILYT  PE DYLDA+LIT+ Q+HL E PGDILVFLTGQEEI++   ++
Sbjct: 758  IFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEIL 817

Query: 303  QERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKY 362
             ER+  L     +L+ +P++S+LPSE Q R+F PA  G RKV++ATNIAETS+TI GI Y
Sbjct: 818  YERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYY 877

Query: 363  VIDPGFVKARLYDPVKGMESLLVVPISKAQALQRSGRAGREGPGKCFRLYPENEF-DKLE 421
            V+DPGFVK ++Y+   G++ L+V PIS+AQA QR+GRAGR GPGKC+RLY E  + D++ 
Sbjct: 878  VVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEML 937

Query: 422  DSTKPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKL 481
             +  PEI+R NL++ +L LKA+G++D++ FDFM+ P   ++I ++EQL+ LGAL D+  L
Sbjct: 938  TTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLL 997

Query: 482  SDPVGHQMARLPLDPIYSKALIVAGQFNCLEEMLITVAMLSVESIFFR 529
            +  +G +MA  PL+P+  K LI++    C EEML  V+MLSV+++F+R
Sbjct: 998  TR-LGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYR 1044

Facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3

>sp\|Q14562\|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1	Back alignment and function description

>sp\|O42643\|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1	Back alignment and function description

>sp\|Q09530\|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1	Back alignment and function description

>sp\|Q03319\|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2	Back alignment and function description

>sp\|Q54F05\|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1	Back alignment and function description

>sp\|Q80VY9\|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1	Back alignment and function description

>sp\|Q54MH3\|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1	Back alignment and function description

>sp\|Q38953\|DHX8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2	Back alignment and function description

>sp\|O45244\|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		555
356498004		705	PREDICTED: ATP-dependent RNA helicase DH	0.949	0.747	0.752	0.0
356502628		705	PREDICTED: ATP-dependent RNA helicase DH	0.949	0.747	0.752	0.0
359473112		713	PREDICTED: putative ATP-dependent RNA he	0.942	0.733	0.756	0.0
255542006		690	ATP-dependent RNA helicase, putative [Ri	0.913	0.734	0.755	0.0
224098988		658	predicted protein [Populus trichocarpa]	0.859	0.724	0.762	0.0
42562325		717	helicase associated domain-containing pr	0.949	0.735	0.727	0.0
296081370		1408	unnamed protein product [Vitis vinifera]	0.879	0.346	0.733	0.0
326533114		697	predicted protein [Hordeum vulgare subsp	0.886	0.705	0.743	0.0
226502510		692	ATP-dependent RNA helicase DHX8 [Zea may	0.872	0.699	0.737	0.0
51090786		698	putative RNA helicase [Oryza sativa Japo	0.872	0.693	0.748	0.0

>gi\|356498004\|ref\|XP_003517845.1\| PREDICTED: ATP-dependent RNA helicase DHX8-like [Glycine max]	Back alignment and taxonomy information

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/553 (75%), Positives = 465/553 (84%), Gaps = 26/553 (4%)

Query: 1   MPSVAEGEVSNSTHNPKLHSKPFFNDSSSRRQKILQQRKSLPIASVEKRLVEEVRKNDIL 60
           MPSV  G  SN                S RRQKI+QQRKSLPIA VEKRLVEEVRK+D+L
Sbjct: 1   MPSVQRGSFSNRQ-----------TQFSERRQKIIQQRKSLPIAPVEKRLVEEVRKHDVL 49

Query: 61  IIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVTQPRRVAAVTVAKRVAEESGVELGQRVG 120
           IIVGETGSGKTTQ+PQFLF AGFC DG++IG+TQPRRVAAVTVAKRVAEE GVELGQ+VG
Sbjct: 50  IIVGETGSGKTTQIPQFLFDAGFCCDGRVIGITQPRRVAAVTVAKRVAEECGVELGQKVG 109

Query: 121 YSIRFDDRTSTSTRIK---------EALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKK 171
           YS+RFDD TS  TRIK         EALLDPYLS+YS IIVDEAHERTVHTDVL+GLLK 
Sbjct: 110 YSVRFDDATSGLTRIKYMTDGLLLREALLDPYLSKYSVIIVDEAHERTVHTDVLMGLLKS 169

Query: 172 VQNARSKSADGHSNGNNNNENSDMILDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDA 231
           VQ ARS S  G    N  N+N + + ++ ND +GI  LK+ +  K+APLKLIIMSASLDA
Sbjct: 170 VQLARSSSVSGGQGLNFGNKNMNKLFEKENDQSGI-FLKKPRHEKYAPLKLIIMSASLDA 228

Query: 232 RGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDYLDATLITIFQVHLDEAPGDILVFLTG 291
           R FSEYFG AKAVH+QGRQFPV+I YT   E DYLDA+LITIFQ+HL+E PGDILVFLTG
Sbjct: 229 RAFSEYFGGAKAVHIQGRQFPVDIFYTRDAETDYLDASLITIFQIHLEEGPGDILVFLTG 288

Query: 292 QEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAGFRKVILATNIA 351
           QEEIESVERL+ E+L QLP+ S+KL+ VPIF++LPSEQQMRVFAP+ +GFRKVILATNIA
Sbjct: 289 QEEIESVERLISEKLPQLPQESQKLLVVPIFAALPSEQQMRVFAPSPSGFRKVILATNIA 348

Query: 352 ETSVTIPGIKYVIDPGFVKARLYDPVKGMESLLVVPISKAQALQRSGRAGREGPGKCFRL 411
           ETSVTIPGIKYVIDPGFVKAR YDP KGMESL+++P SK+QALQRSGRAGREGPGKCFRL
Sbjct: 349 ETSVTIPGIKYVIDPGFVKARSYDPGKGMESLIIIPTSKSQALQRSGRAGREGPGKCFRL 408

Query: 412 YPENEFDKLEDSTKPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFL 471
           YPE EF+KLEDST PEIKRCNLSNVILQLKALGVDDI+GFDF++KPSRA+IIKSLEQLFL
Sbjct: 409 YPEREFEKLEDSTMPEIKRCNLSNVILQLKALGVDDILGFDFIDKPSRAAIIKSLEQLFL 468

Query: 472 LGALTDDCKLSDPVGHQMARLPLDPIYSKALIVAGQFNCLEEMLITVAMLSVESIFFRSP 531
           LGALTD+C+LSDPVGHQMARLPLDP+YSKALI+A QFNCLEEMLITVA+LSVESIF+ SP
Sbjct: 469 LGALTDECQLSDPVGHQMARLPLDPLYSKALILASQFNCLEEMLITVALLSVESIFY-SP 527

Query: 532 ----GEVRRGKKC 540
                E R   KC
Sbjct: 528 RDKLEEARTATKC 540

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356502628\|ref\|XP_003520120.1\| PREDICTED: ATP-dependent RNA helicase DHX8 [Glycine max]	Back alignment and taxonomy information

>gi\|359473112\|ref\|XP_002282341.2\| PREDICTED: putative ATP-dependent RNA helicase DHX33-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|255542006\|ref\|XP_002512067.1\| ATP-dependent RNA helicase, putative [Ricinus communis] gi\|223549247\|gb\|EEF50736.1\| ATP-dependent RNA helicase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|224098988\|ref\|XP_002311345.1\| predicted protein [Populus trichocarpa] gi\|222851165\|gb\|EEE88712.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|42562325\|ref\|NP_173961.3\| helicase associated domain-containing protein [Arabidopsis thaliana] gi\|332192562\|gb\|AEE30683.1\| helicase associated domain-containing protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|296081370\|emb\|CBI16803.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|326533114\|dbj\|BAJ93529.1\| predicted protein [Hordeum vulgare subsp. vulgare]	Back alignment and taxonomy information

>gi\|226502510\|ref\|NP_001147775.1\| ATP-dependent RNA helicase DHX8 [Zea mays] gi\|195613710\|gb\|ACG28685.1\| ATP-dependent RNA helicase DHX8 [Zea mays] gi\|413951431\|gb\|AFW84080.1\| ATP-dependent RNA helicase DHX8 [Zea mays]	Back alignment and taxonomy information

>gi\|51090786\|dbj\|BAD35264.1\| putative RNA helicase [Oryza sativa Japonica Group] gi\|51091123\|dbj\|BAD35820.1\| putative RNA helicase [Oryza sativa Japonica Group]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		555
TAIR\|locus:2197965		717	AT1G26370 [Arabidopsis thalian	0.944	0.730	0.702	3.1e-193
DICTYBASE\|DDB_G0270110		730	dhx33 "DEAD/DEAH box helicase"	0.587	0.446	0.543	1.5e-125
ZFIN\|ZDB-GENE-050809-39		1210	dhx8 "DEAH (Asp-Glu-Ala-His) b	0.565	0.259	0.518	4.9e-122
UNIPROTKB\|F5H658		1181	DHX8 "ATP-dependent RNA helica	0.565	0.265	0.522	1.4e-120
UNIPROTKB\|F1P306		1168	LOC100858239 "Uncharacterized	0.565	0.268	0.522	4.6e-120
RGD\|1310723		1210	Dhx8 "DEAH (Asp-Glu-Ala-His) b	0.565	0.259	0.522	4.8e-120
UNIPROTKB\|Q14562		1220	DHX8 "ATP-dependent RNA helica	0.565	0.257	0.522	6.5e-120
UNIPROTKB\|F1S1H3		1212	DHX8 "Uncharacterized protein"	0.565	0.259	0.522	8.4e-120
UNIPROTKB\|E2R9R9		1216	DHX8 "Uncharacterized protein"	0.565	0.258	0.522	9.4e-120
UNIPROTKB\|D4A805		1242	Dhx8 "Protein Dhx8" [Rattus no	0.565	0.252	0.522	1.1e-119

TAIR\|locus:2197965 AT1G26370 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1872 (664.0 bits), Expect = 3.1e-193, P = 3.1e-193
 Identities = 389/554 (70%), Positives = 443/554 (79%)

Query:     1 MPSVAEGE----VSNSTHNPKLHS-KPFFNDSSSRRQKILQQRKSLPIASVEKRLVEEVR 55
             MPS+A+GE    V NS  NPK  +  PF     S RQKI + R+SLPIASVEKRLVEEV+
Sbjct:     1 MPSMAQGELKSFVQNSRPNPKSPTVSPF-----SMRQKIAEHRRSLPIASVEKRLVEEVQ 55

Query:    56 KNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVTQPXXXXXXXXXXXXXEESGVEL 115
             KNDILIIVGETGSGKTTQLPQFL++AGFCR+GK+IG+TQP             EE  V+L
Sbjct:    56 KNDILIIVGETGSGKTTQLPQFLYNAGFCREGKMIGITQPRRIAAVTVAKRVAEECEVQL 115

Query:   116 GQRVGYSIRFDDRTSTSTRIK---------EALLDPYLSRYSAIIVDEAHERTVHTDVLL 166
             GQ+VGYSIRFDD TS STR+K         EALLDP+LSRYS IIVDEAH+R+VHTDVLL
Sbjct:   116 GQKVGYSIRFDDTTSGSTRLKYMTDGLLLREALLDPHLSRYSVIIVDEAHDRSVHTDVLL 175

Query:   167 GLLKKVQNARS-----KSADGHSXXXXXXXXSDMILDRGNDTNGINTLKQCQGRKFAPLK 221
              LLKK+Q  RS     K+  G+          D     G   NG+  LK  QGRK +PLK
Sbjct:   176 ALLKKIQRTRSQPVSEKTEFGNVASQVQTTTRDA---NGPQQNGV--LKGYQGRKLSPLK 230

Query:   222 LIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDYLDATLITIFQVHLDEA 281
             LIIMSASLDAR FSEYFG AKAVHVQGRQFPV+ILYT++PE DY+DATL+TIFQ+H +E 
Sbjct:   231 LIIMSASLDARVFSEYFGGAKAVHVQGRQFPVDILYTVHPESDYVDATLVTIFQIHFEEK 290

Query:   282 PGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAGF 341
             PGDILVFLTGQ+EIESVERLVQERL  +PE  RKL+ + IFS+LPSEQQM+VFAPA  GF
Sbjct:   291 PGDILVFLTGQDEIESVERLVQERLQNIPEDKRKLLPLAIFSALPSEQQMKVFAPAPTGF 350

Query:   342 RKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGMESLLVVPISKAQALQRSGRAG 401
             RKVILATNIAETS+TIPGI+YVIDPGFVKAR YDP KGMESL VVP SKAQ LQRSGRAG
Sbjct:   351 RKVILATNIAETSITIPGIRYVIDPGFVKARSYDPSKGMESLDVVPASKAQTLQRSGRAG 410

Query:   402 REGPGKCFRLYPENEFDKLEDSTKPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRAS 461
             REGPGK FRLYPE EF+KLEDSTKPEIKRCNLSN+ILQLKALG+DDI+GFDF++KPSR +
Sbjct:   411 REGPGKSFRLYPEREFEKLEDSTKPEIKRCNLSNIILQLKALGIDDIVGFDFIDKPSRGA 470

Query:   462 IIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYSKALIVAGQFNCLEEMLITVAML 521
             IIK+L +L  LGAL DD KL +PVG+QM+RLPL+P+YSKALI+A QFNCLEEMLITVA+L
Sbjct:   471 IIKALAELHSLGALADDGKLENPVGYQMSRLPLEPVYSKALILANQFNCLEEMLITVAVL 530

Query:   522 SVESIFFRSPGEVR 535
             SVESIF+  P E R
Sbjct:   531 SVESIFY-DPREKR 543

GO:0000166 "nucleotide binding" evidence=IEA

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0003724 "RNA helicase activity" evidence=ISS

GO:0004386 "helicase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0017111 "nucleoside-triphosphatase activity" evidence=IEA

DICTYBASE\|DDB_G0270110 dhx33 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-050809-39 dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F5H658 DHX8 "ATP-dependent RNA helicase DHX8" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P306 LOC100858239 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

RGD\|1310723 Dhx8 "DEAH (Asp-Glu-Ala-His) box polypeptide 8" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q14562 DHX8 "ATP-dependent RNA helicase DHX8" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S1H3 DHX8 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R9R9 DHX8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|D4A805 Dhx8 "Protein Dhx8" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		555
COG1643		845	COG1643, HrpA, HrpA-like helicases [DNA replicatio	0.0
TIGR01967		1283	TIGR01967, DEAH_box_HrpA, ATP-dependent helicase H	1e-113
PRK11131		1294	PRK11131, PRK11131, ATP-dependent RNA helicase Hrp	1e-107
TIGR01970		819	TIGR01970, DEAH_box_HrpB, ATP-dependent helicase H	8e-86
PRK11664		812	PRK11664, PRK11664, ATP-dependent RNA helicase Hrp	6e-85
pfam04408		91	pfam04408, HA2, Helicase associated domain (HA2)	1e-22
cd00046		144	cd00046, DEXDc, DEAD-like helicases superfamily	1e-20
smart00847		82	smart00847, HA2, Helicase associated domain (HA2)	3e-16
cd00079		131	cd00079, HELICc, Helicase superfamily c-terminal d	5e-15
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	7e-15
smart00490		82	smart00490, HELICc, helicase superfamily c-termina	2e-13
pfam00271		78	pfam00271, Helicase_C, Helicase conserved C-termin	5e-12
PHA02653		675	PHA02653, PHA02653, RNA helicase NPH-II; Provision	6e-06
COG1111		542	COG1111, MPH1, ERCC4-like helicases [DNA replicati	0.002
pfam13401		124	pfam13401, AAA_22, AAA domain	0.003

>gnl\|CDD\|224557 COG1643, HrpA, HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

 Score =  576 bits (1487), Expect = 0.0
 Identities = 237/520 (45%), Positives = 306/520 (58%), Gaps = 61/520 (11%)

Query: 28  SSRRQKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDG 87
           S+    IL+ R  LP+ +V   +++ + +N ++IIVGETGSGKTTQLPQFL   G    G
Sbjct: 36  SANVPDILEYRSGLPVTAVRDEILKAIEQNQVVIIVGETGSGKTTQLPQFLLEEGLGIAG 95

Query: 88  KLIGVTQPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDDRTSTSTRIK---------EA 138
           K IG TQPRR+AA +VA+RVAEE G +LG+ VGYSIRF+ + S  TRIK         E 
Sbjct: 96  K-IGCTQPRRLAARSVAERVAEELGEKLGETVGYSIRFESKVSPRTRIKVMTDGILLREI 154

Query: 139 LLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNNNENSDMILD 198
             DP LS YS +I+DEAHER+++TD+LLGLLK +   R                      
Sbjct: 155 QNDPLLSGYSVVIIDEAHERSLNTDILLGLLKDLLARRR--------------------- 193

Query: 199 RGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYT 258
                                LKLIIMSA+LDA  FS YFG A  + ++GR +PVEI Y 
Sbjct: 194 -------------------DDLKLIIMSATLDAERFSAYFGNAPVIEIEGRTYPVEIRYL 234

Query: 259 LYPEPDY-LDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLV 317
              E DY L   ++    +HL E  G ILVFL GQ EIE     +++  L        L 
Sbjct: 235 PEAEADYILLDAIVAAVDIHLREGSGSILVFLPGQREIERTAEWLEKAEL-----GDDLE 289

Query: 318 TVPIFSSLPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPV 377
            +P++ +L +E+Q+RVF PA  G RKV+LATNIAETS+TIPGI+YVID G  K + YDP 
Sbjct: 290 ILPLYGALSAEEQVRVFEPAPGGKRKVVLATNIAETSLTIPGIRYVIDSGLAKEKRYDPR 349

Query: 378 KGMESLLVVPISKAQALQRSGRAGREGPGKCFRLYPENEFDKLEDSTKPEIKRCNLSNVI 437
            G+  L   PISKA A QR+GRAGR GPG C+RLY E +F    + T PEI R +LS ++
Sbjct: 350 TGLTRLETEPISKASADQRAGRAGRTGPGICYRLYSEEDFLAFPEFTLPEILRTDLSGLV 409

Query: 438 LQLKALGVD-DIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDP 496
           LQLK+LG+  DI  F F++ P  A+I  +L  L  LGAL D  KL+ P+G QM+ LPLDP
Sbjct: 410 LQLKSLGIGQDIAPFPFLDPPPEAAIQAALTLLQELGALDDSGKLT-PLGKQMSLLPLDP 468

Query: 497 IYSKALIVAGQFNCLEEMLITVAMLSV---ESIFFRSPGE 533
             ++ L+ A +  CL E     +MLS    ES F R    
Sbjct: 469 RLARMLLTAPEGGCLGEAATIASMLSEQDRESDFSRDVKL 508

Length = 845

>gnl\|CDD\|233659 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA	Back alignment and domain information

>gnl\|CDD\|182986 PRK11131, PRK11131, ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>gnl\|CDD\|233660 TIGR01970, DEAH_box_HrpB, ATP-dependent helicase HrpB	Back alignment and domain information

>gnl\|CDD\|236950 PRK11664, PRK11664, ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>gnl\|CDD\|218070 pfam04408, HA2, Helicase associated domain (HA2)	Back alignment and domain information

>gnl\|CDD\|238005 cd00046, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|214852 smart00847, HA2, Helicase associated domain (HA2) Add an annotation	Back alignment and domain information

>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|197757 smart00490, HELICc, helicase superfamily c-terminal domain	Back alignment and domain information

>gnl\|CDD\|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain	Back alignment and domain information

>gnl\|CDD\|177443 PHA02653, PHA02653, RNA helicase NPH-II; Provisional	Back alignment and domain information

>gnl\|CDD\|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|222104 pfam13401, AAA_22, AAA domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		555
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	100.0
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	100.0
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	100.0
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	100.0
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	100.0
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	100.0
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	100.0
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	100.0
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	100.0
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	100.0
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	100.0
PHA02653		675	RNA helicase NPH-II; Provisional	100.0
PRK02362		737	ski2-like helicase; Provisional	100.0
PRK01172		674	ski2-like helicase; Provisional	100.0
KOG0921		1282	consensus Dosage compensation complex, subunit MLE	100.0
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK00254		720	ski2-like helicase; Provisional	100.0
COG1202		830	Superfamily II helicase, archaea-specific [General	100.0
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	100.0
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	100.0
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	100.0
PTZ00110		545	helicase; Provisional	100.0
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	100.0
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	100.0
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	100.0
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	100.0
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	100.0
COG1204		766	Superfamily II helicase [General function predicti	100.0
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	100.0
PTZ00424		401	helicase 45; Provisional	100.0
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	100.0
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	100.0
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	100.0
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	100.0
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	100.0
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	100.0
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	100.0
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK13767		876	ATP-dependent helicase; Provisional	100.0
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	100.0
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	100.0
KOG0343		758	consensus RNA Helicase [RNA processing and modific	100.0
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	100.0
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	100.0
COG1201		814	Lhr Lhr-like helicases [General function predictio	100.0
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	100.0
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	100.0
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	100.0
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	100.0
KOG0326		459	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	100.0
PRK10689		1147	transcription-repair coupling factor; Provisional	100.0
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	100.0
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	100.0
KOG0346		569	consensus RNA helicase [RNA processing and modific	100.0
KOG0347		731	consensus RNA helicase [RNA processing and modific	100.0
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	100.0
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	99.98
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.98
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	99.98
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	99.98
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	99.97
KOG4284		980	consensus DEAD box protein [Transcription]	99.97
COG1205		851	Distinct helicase family with a unique C-terminal	99.97
KOG0334		997	consensus RNA helicase [RNA processing and modific	99.97
KOG0354		746	consensus DEAD-box like helicase [General function	99.97
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	99.97
KOG0948		1041	consensus Nuclear exosomal RNA helicase MTR4, DEAD	99.97
KOG0327		397	consensus Translation initiation factor 4F, helica	99.97
KOG0947		1248	consensus Cytoplasmic exosomal RNA helicase SKI2,	99.96
PHA02558		501	uvsW UvsW helicase; Provisional	99.96
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	99.96
KOG0351		941	consensus ATP-dependent DNA helicase [Replication,	99.95
KOG0352		641	consensus ATP-dependent DNA helicase [Replication,	99.95
KOG0337		529	consensus ATP-dependent RNA helicase [RNA processi	99.95
PRK13766		773	Hef nuclease; Provisional	99.95
PRK09401		1176	reverse gyrase; Reviewed	99.94
KOG0950		1008	consensus DNA polymerase theta/eta, DEAD-box super	99.94
PRK14701		1638	reverse gyrase; Provisional	99.94
PRK09694		878	helicase Cas3; Provisional	99.94
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	99.94
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	99.93
PRK05580		679	primosome assembly protein PriA; Validated	99.93
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	99.93
KOG0353		695	consensus ATP-dependent DNA helicase [General func	99.93
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	99.93
TIGR00595		505	priA primosomal protein N'. All proteins in this f	99.92
PRK09200		790	preprotein translocase subunit SecA; Reviewed	99.92
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	99.92
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	99.92
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	99.91
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	99.91
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	99.9
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	99.88
KOG0949		1330	consensus Predicted helicase, DEAD-box superfamily	99.85
PRK04914		956	ATP-dependent helicase HepA; Validated	99.85
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	99.85
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	99.83
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	99.81
COG1198		730	PriA Primosomal protein N' (replication factor Y)	99.8
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	99.79
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	99.76
PRK12904		830	preprotein translocase subunit SecA; Reviewed	99.76
PRK05298		652	excinuclease ABC subunit B; Provisional	99.75
KOG0953		700	consensus Mitochondrial RNA helicase SUV3, DEAD-bo	99.74
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	99.72
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	99.7
COG4096		875	HsdR Type I site-specific restriction-modification	99.69
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	99.69
KOG4150		1034	consensus Predicted ATP-dependent RNA helicase [RN	99.69
PRK13107		908	preprotein translocase subunit SecA; Reviewed	99.66
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	99.64
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	99.62
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	99.62
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	99.61
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.6
PF00271		78	Helicase_C: Helicase conserved C-terminal domain;	99.59
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	99.58
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	99.58
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.57
PF04408		102	HA2: Helicase associated domain (HA2); InterPro: I	99.52
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	99.5
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	99.49
smart00847		92	HA2 Helicase associated domain (HA2) Add an annota	99.49
PRK12326		764	preprotein translocase subunit SecA; Reviewed	99.46
KOG0921		1282	consensus Dosage compensation complex, subunit MLE	99.44
smart00490		82	HELICc helicase superfamily c-terminal domain.	99.42
KOG1123		776	consensus RNA polymerase II transcription initiati	99.39
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	99.35
smart00487		201	DEXDc DEAD-like helicases superfamily.	99.3
PRK14873		665	primosome assembly protein PriA; Provisional	99.29
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	99.27
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	99.24
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	99.21
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	99.21
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	99.18
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	99.17
CHL00122		870	secA preprotein translocase subunit SecA; Validate	99.16
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	99.02
COG4889		1518	Predicted helicase [General function prediction on	98.95
KOG0387		923	consensus Transcription-coupled repair protein CSB	98.94
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	98.9
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	98.89
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	98.86
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	98.79
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	98.67
KOG0384		1373	consensus Chromodomain-helicase DNA-binding protei	98.4
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	98.3
KOG1000		689	consensus Chromatin remodeling protein HARP/SMARCA	98.19
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	98.11
PF00448		196	SRP54: SRP54-type protein, GTPase domain; InterPro	98.09
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	98.02
PF13604		196	AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL	98.0
PF13245		76	AAA_19: Part of AAA domain	97.99
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	97.91
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	97.91
PRK12723		388	flagellar biosynthesis regulator FlhF; Provisional	97.78
TIGR02768		744	TraA_Ti Ti-type conjugative transfer relaxase TraA	97.74
TIGR01447		586	recD exodeoxyribonuclease V, alpha subunit. This f	97.74
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	97.73
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	97.72
TIGR01448		720	recD_rel helicase, putative, RecD/TraA family. Thi	97.67
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	97.67
COG0610		962	Type I site-specific restriction-modification syst	97.64
PRK10875		615	recD exonuclease V subunit alpha; Provisional	97.6
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	97.59
PRK14722		374	flhF flagellar biosynthesis regulator FlhF; Provis	97.59
PF05970		364	PIF1: PIF1-like helicase; InterPro: IPR010285 This	97.58
PRK11889		436	flhF flagellar biosynthesis regulator FlhF; Provis	97.5
COG1419		407	FlhF Flagellar GTP-binding protein [Cell motility	97.5
PRK06526		254	transposase; Provisional	97.47
PRK13889		988	conjugal transfer relaxase TraA; Provisional	97.47
PRK14974		336	cell division protein FtsY; Provisional	97.46
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	97.46
PRK05703		424	flhF flagellar biosynthesis regulator FlhF; Valida	97.45
TIGR03015		269	pepcterm_ATPase putative secretion ATPase, PEP-CTE	97.44
smart00382		148	AAA ATPases associated with a variety of cellular	97.44
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	97.42
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	97.42
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	97.42
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	97.42
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	97.37
PRK13826		1102	Dtr system oriT relaxase; Provisional	97.36
PRK08181		269	transposase; Validated	97.26
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	97.24
PF13307		167	Helicase_C_2: Helicase C-terminal domain; PDB: 4A1	97.23
PRK07952		244	DNA replication protein DnaC; Validated	97.22
PF13173		128	AAA_14: AAA domain	97.21
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	97.2
PRK10416		318	signal recognition particle-docking protein FtsY;	97.18
PRK12726		407	flagellar biosynthesis regulator FlhF; Provisional	97.18
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	97.18
PRK04296		190	thymidine kinase; Provisional	97.17
PRK12727		559	flagellar biosynthesis regulator FlhF; Provisional	97.15
PRK10536		262	hypothetical protein; Provisional	97.15
PRK14721		420	flhF flagellar biosynthesis regulator FlhF; Provis	97.15
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	97.14
PRK14723		767	flhF flagellar biosynthesis regulator FlhF; Provis	97.11
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	97.06
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	97.05
PRK06995		484	flhF flagellar biosynthesis regulator FlhF; Valida	97.04
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	97.01
cd03216		163	ABC_Carb_Monos_I This family represents the domain	96.96
PRK12724		432	flagellar biosynthesis regulator FlhF; Provisional	96.96
PF07517		266	SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011	96.94
PF05729		166	NACHT: NACHT domain	96.94
TIGR03499		282	FlhF flagellar biosynthetic protein FlhF.	96.91
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	96.9
COG1122		235	CbiO ABC-type cobalt transport system, ATPase comp	96.9
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	96.89
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	96.89
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	96.88
PF00004		132	AAA: ATPase family associated with various cellula	96.88
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	96.88
TIGR00376		637	DNA helicase, putative. The gene product may repre	96.87
PF00580		315	UvrD-helicase: UvrD/REP helicase N-terminal domain	96.85
PRK09183		259	transposase/IS protein; Provisional	96.84
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	96.83
TIGR02782		299	TrbB_P P-type conjugative transfer ATPase TrbB. Th	96.83
PRK08903		227	DnaA regulatory inactivator Hda; Validated	96.81
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	96.8
PRK06835		329	DNA replication protein DnaC; Validated	96.78
PRK13851		344	type IV secretion system protein VirB11; Provision	96.78
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	96.78
KOG1803		649	consensus DNA helicase [Replication, recombination	96.74
cd03246		173	ABCC_Protease_Secretion This family represents the	96.74
PF00437		270	T2SE: Type II/IV secretion system protein; InterPr	96.72
PRK06731		270	flhF flagellar biosynthesis regulator FlhF; Valida	96.7
PRK08727		233	hypothetical protein; Validated	96.69
cd01130		186	VirB11-like_ATPase Type IV secretory pathway compo	96.67
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	96.67
PRK13900		332	type IV secretion system ATPase VirB11; Provisiona	96.63
PRK13833		323	conjugal transfer protein TrbB; Provisional	96.59
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	96.59
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	96.55
TIGR01425		429	SRP54_euk signal recognition particle protein SRP5	96.55
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	96.53
PRK06893		229	DNA replication initiation factor; Validated	96.52
TIGR00064		272	ftsY signal recognition particle-docking protein F	96.5
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	96.47
PF12340		229	DUF3638: Protein of unknown function (DUF3638); In	96.47
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	96.45
PF02456		369	Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR	96.42
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	96.42
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	96.41
PRK00771		437	signal recognition particle protein Srp54; Provisi	96.41
PF13555		62	AAA_29: P-loop containing region of AAA domain	96.39
PRK13894		319	conjugal transfer ATPase TrbB; Provisional	96.38
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	96.37
cd03215		182	ABC_Carb_Monos_II This family represents domain II	96.34
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	96.34
KOG0058		716	consensus Peptide exporter, ABC superfamily [Intra	96.33
PRK08084		235	DNA replication initiation factor; Provisional	96.32
COG1119		257	ModF ABC-type molybdenum transport system, ATPase	96.31
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	96.3
PRK08116		268	hypothetical protein; Validated	96.3
COG1484		254	DnaC DNA replication protein [DNA replication, rec	96.28
COG3842		352	PotA ABC-type spermidine/putrescine transport syst	96.26
PRK00149		450	dnaA chromosomal replication initiation protein; R	96.25
COG3840		231	ThiQ ABC-type thiamine transport system, ATPase co	96.23
COG4555		245	NatA ABC-type Na+ transport system, ATPase compone	96.23
PRK12402		337	replication factor C small subunit 2; Reviewed	96.22
PRK05642		234	DNA replication initiation factor; Validated	96.22
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	96.21
COG4618		580	ArpD ABC-type protease/lipase transport system, AT	96.21
KOG1802		935	consensus RNA helicase nonsense mRNA reducing fact	96.2
KOG2373		514	consensus Predicted mitochondrial DNA helicase twi	96.2
PRK08939		306	primosomal protein DnaI; Reviewed	96.16
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	96.16
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	96.15
PRK09087		226	hypothetical protein; Validated	96.13
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	96.13
COG2256		436	MGS1 ATPase related to the helicase subunit of the	96.13
PF06862		442	DUF1253: Protein of unknown function (DUF1253); In	96.1
PRK06620		214	hypothetical protein; Validated	96.1
PRK10867		433	signal recognition particle protein; Provisional	96.09
PRK14087		450	dnaA chromosomal replication initiation protein; P	96.07
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	96.06
COG4962		355	CpaF Flp pilus assembly protein, ATPase CpaF [Intr	96.03
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	96.02
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	96.0
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	95.98
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	95.98
COG0630		312	VirB11 Type IV secretory pathway, VirB11 component	95.98
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	95.88
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	95.87
COG4604		252	CeuD ABC-type enterochelin transport system, ATPas	95.86
PRK06921		266	hypothetical protein; Provisional	95.85
PHA02533		534	17 large terminase protein; Provisional	95.85
PRK11432		351	fbpC ferric transporter ATP-binding subunit; Provi	95.84
cd03115		173	SRP The signal recognition particle (SRP) mediates	95.84
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	95.84
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	95.82
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	95.74
PF05127		177	Helicase_RecD: Helicase; InterPro: IPR007807 This	95.74
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	95.72
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	95.7
TIGR03375		694	type_I_sec_LssB type I secretion system ATPase, Ls	95.69
PRK08533		230	flagellar accessory protein FlaH; Reviewed	95.64
PRK14088		440	dnaA chromosomal replication initiation protein; P	95.64
PRK14712		1623	conjugal transfer nickase/helicase TraI; Provision	95.63
PRK12377		248	putative replication protein; Provisional	95.63
PRK11174		588	cysteine/glutathione ABC transporter membrane/ATP-	95.63
PRK13709		1747	conjugal transfer nickase/helicase TraI; Provision	95.6
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	95.6
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	95.58
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	95.56
COG4181		228	Predicted ABC-type transport system involved in ly	95.54
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	95.54
TIGR00959		428	ffh signal recognition particle protein. This mode	95.53
TIGR02524		358	dot_icm_DotB Dot/Icm secretion system ATPase DotB.	95.51
COG1135		339	AbcC ABC-type metal ion transport system, ATPase c	95.49
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	95.49
COG0552		340	FtsY Signal recognition particle GTPase [Intracell	95.47
COG3638		258	ABC-type phosphate/phosphonate transport system, A	95.45
COG4988		559	CydD ABC-type transport system involved in cytochr	95.44
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	95.43
TIGR03258		362	PhnT 2-aminoethylphosphonate ABC transport system,	95.4
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	95.39
PRK05973		237	replicative DNA helicase; Provisional	95.38
PRK09536		402	btuD corrinoid ABC transporter ATPase; Reviewed	95.38
PRK04195		482	replication factor C large subunit; Provisional	95.37
TIGR03796		710	NHPM_micro_ABC1 NHPM bacteriocin system ABC transp	95.36
PRK11607		377	potG putrescine transporter ATP-binding subunit; P	95.35
COG1444		758	Predicted P-loop ATPase fused to an acetyltransfer	95.35
COG4136		213	ABC-type uncharacterized transport system, ATPase	95.34
PF01637		234	Arch_ATPase: Archaeal ATPase; InterPro: IPR011579	95.33
KOG1805		1100	consensus DNA replication helicase [Replication, r	95.33
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	95.32
TIGR00596		814	rad1 DNA repair protein (rad1). This family is bas	95.32
KOG0057		591	consensus Mitochondrial Fe/S cluster exporter, ABC	95.31
COG4152		300	ABC-type uncharacterized transport system, ATPase	95.3
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	95.3
COG4178		604	ABC-type uncharacterized transport system, permeas	95.29
PRK00411		394	cdc6 cell division control protein 6; Reviewed	95.28
cd01129		264	PulE-GspE PulE/GspE The type II secretory pathway	95.28
PF13872		303	AAA_34: P-loop containing NTP hydrolase pore-1	95.27
COG2804		500	PulE Type II secretory pathway, ATPase PulE/Tfp pi	95.26
PRK13657		588	cyclic beta-1,2-glucan ABC transporter; Provisiona	95.26
TIGR00958		711	3a01208 Conjugate Transporter-2 (CT2) Family prote	95.24
COG3910		233	Predicted ATPase [General function prediction only	95.24
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	95.22
PHA02544		316	44 clamp loader, small subunit; Provisional	95.22
PRK11176		582	lipid transporter ATP-binding/permease protein; Pr	95.17
PLN03025		319	replication factor C subunit; Provisional	95.17
TIGR02525		372	plasmid_TraJ plasmid transfer ATPase TraJ. Members	95.16
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	95.14
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	95.13
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	95.12
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	95.1
COG4615		546	PvdE ABC-type siderophore export system, fused ATP	95.09
COG1131		293	CcmA ABC-type multidrug transport system, ATPase c	95.08
COG2805		353	PilT Tfp pilus assembly protein, pilus retraction	95.08
TIGR02857		529	CydD thiol reductant ABC exporter, CydD subunit. U	95.08
cd03227		162	ABC_Class2 ABC-type Class 2 contains systems invol	95.05
PRK14086		617	dnaA chromosomal replication initiation protein; P	95.05
KOG2340		698	consensus Uncharacterized conserved protein [Funct	95.04
PRK11054		684	helD DNA helicase IV; Provisional	94.99
PRK13342		413	recombination factor protein RarA; Reviewed	94.99
COG3845		501	ABC-type uncharacterized transport systems, ATPase	94.98
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	94.96
cd00820		107	PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC	94.96
PRK10522		547	multidrug transporter membrane component/ATP-bindi	94.96
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	94.95
COG4586		325	ABC-type uncharacterized transport system, ATPase	94.94
TIGR02760		1960	TraI_TIGR conjugative transfer relaxase protein Tr	94.93
TIGR01842		544	type_I_sec_PrtD type I secretion system ABC transp	94.89
COG4525		259	TauB ABC-type taurine transport system, ATPase com	94.84
COG1127		263	Ttg2A ABC-type transport system involved in resist	94.82
PRK11160		574	cysteine/glutathione ABC transporter membrane/ATP-	94.82
TIGR02204		576	MsbA_rel ABC transporter, permease/ATP-binding pro	94.8
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	94.8
TIGR01420		343	pilT_fam pilus retraction protein PilT. This model	94.79
PRK10789		569	putative multidrug transporter membrane\ATP-bindin	94.75
PF00931		287	NB-ARC: NB-ARC domain; InterPro: IPR002182 This is	94.74
COG3267		269	ExeA Type II secretory pathway, component ExeA (pr	94.73
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	94.7
PRK12422		445	chromosomal replication initiation protein; Provis	94.69
PF00005		137	ABC_tran: ABC transporter This structure is on hol	94.68
COG2274		709	SunT ABC-type bacteriocin/lantibiotic exporters, c	94.67
TIGR03797		686	NHPM_micro_ABC2 NHPM bacteriocin system ABC transp	94.67
PRK10436		462	hypothetical protein; Provisional	94.67
cd01393		226	recA_like RecA is a bacterial enzyme which has rol	94.64
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	94.62
TIGR02203		571	MsbA_lipidA lipid A export permease/ATP-binding pr	94.61
TIGR02012		321	tigrfam_recA protein RecA. This model describes or	94.6
KOG0054		1381	consensus Multidrug resistance-associated protein/	94.6
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	94.58
PRK10790		592	putative multidrug transporter membrane\ATP-bindin	94.57
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	94.57
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	94.57
TIGR01193		708	bacteriocin_ABC ABC-type bacteriocin transporter.	94.56
cd01123		235	Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r	94.55
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	94.52
PRK11823		446	DNA repair protein RadA; Provisional	94.51
PF13207		121	AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6	94.5
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	94.48
PF01443		234	Viral_helicase1: Viral (Superfamily 1) RNA helicas	94.46
TIGR01192		585	chvA glucan exporter ATP-binding protein. This mod	94.46
PHA03333		752	putative ATPase subunit of terminase; Provisional	94.44
TIGR01846		694	type_I_sec_HlyB type I secretion system ABC transp	94.44
TIGR03238		504	dnd_assoc_3 dnd system-associated protein 3. cereu	94.42
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	94.41
PLN03232		1495	ABC transporter C family member; Provisional	94.39
KOG2028		554	consensus ATPase related to the helicase subunit o	94.38
PRK10919		672	ATP-dependent DNA helicase Rep; Provisional	94.36
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	94.34
PTZ00293		211	thymidine kinase; Provisional	94.32
TIGR03263		180	guanyl_kin guanylate kinase. Members of this famil	94.31
COG4619		223	ABC-type uncharacterized transport system, ATPase	94.3
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	94.27
COG4133		209	CcmA ABC-type transport system involved in cytochr	94.26
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	94.25
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	94.23
PF05707		193	Zot: Zonular occludens toxin (Zot); InterPro: IPR0	94.21
PLN03130		1622	ABC transporter C family member; Provisional	94.2
PF00265		176	TK: Thymidine kinase; InterPro: IPR001267 Thymidin	94.16
PF03969		362	AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654	94.15
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	94.14
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	94.12
PRK00300		205	gmk guanylate kinase; Provisional	94.11
KOG1131		755	consensus RNA polymerase II transcription initiati	94.1
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	94.08
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	94.08
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	94.07
PF03354		477	Terminase_1: Phage Terminase ; InterPro: IPR005021	94.04
TIGR00150		133	HI0065_YjeE ATPase, YjeE family. Members of this f	94.04
PRK05580		679	primosome assembly protein PriA; Validated	94.02
cd03269		210	ABC_putative_ATPase This subfamily is involved in	94.0
PRK09354		349	recA recombinase A; Provisional	93.99
PRK10078		186	ribose 1,5-bisphosphokinase; Provisional	93.99
TIGR00954		659	3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA	93.97
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	93.97
TIGR02688		449	conserved hypothetical protein TIGR02688. Members	93.97
COG1123		539	ATPase components of various ABC-type transport sy	93.95
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	93.9
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	93.9
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	93.88
PLN03232		1495	ABC transporter C family member; Provisional	93.88
TIGR00957		1522	MRP_assoc_pro multi drug resistance-associated pro	93.87
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	93.86
KOG2228		408	consensus Origin recognition complex, subunit 4 [R	93.86
CHL00176		638	ftsH cell division protein; Validated	93.85
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	93.85
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	93.84
TIGR02238		313	recomb_DMC1 meiotic recombinase Dmc1. This model d	93.84
PRK13341		725	recombination factor protein RarA/unknown domain f	93.83
TIGR02533		486	type_II_gspE general secretory pathway protein E.	93.82
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	93.82
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	93.81
KOG1970		634	consensus Checkpoint RAD17-RFC complex, RAD17/RAD2	93.8
COG0396		251	sufC Cysteine desulfurase activator ATPase [Posttr	93.79
COG2884		223	FtsE Predicted ATPase involved in cell division [C	93.79
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	93.78
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	93.78
PF13671		143	AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1	93.77
PF02367		123	UPF0079: Uncharacterised P-loop hydrolase UPF0079;	93.76
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	93.74
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	93.72
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	93.71
PF12846		304	AAA_10: AAA-like domain	93.7
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	93.7
PRK04301		317	radA DNA repair and recombination protein RadA; Va	93.69
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	93.69
cd03282		204	ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS	93.68
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	93.68
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	93.65
COG1117		253	PstB ABC-type phosphate transport system, ATPase c	93.65
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	93.65
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	93.63
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	93.63
TIGR00595		505	priA primosomal protein N'. All proteins in this f	93.63
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	93.63
PTZ00112		1164	origin recognition complex 1 protein; Provisional	93.62
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	93.62
PRK09112		351	DNA polymerase III subunit delta'; Validated	93.62
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	93.62
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	93.62
COG4167		267	SapF ABC-type antimicrobial peptide transport syst	93.59
cd03268		208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	93.58
PRK13539		207	cytochrome c biogenesis protein CcmA; Provisional	93.56
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	93.55
TIGR02322		179	phosphon_PhnN phosphonate metabolism protein/1,5-b	93.54
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	93.53
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	93.52
PF13871		278	Helicase_C_4: Helicase_C-like	93.51
PRK13764		602	ATPase; Provisional	93.51
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	93.51
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	93.5
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	93.49
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	93.48
COG0541		451	Ffh Signal recognition particle GTPase [Intracellu	93.46
PTZ00265		1466	multidrug resistance protein (mdr1); Provisional	93.45
cd03237		246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	93.43
TIGR01978		243	sufC FeS assembly ATPase SufC. SufC is part of the	93.43

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

Probab=100.00  E-value=5.7e-98  Score=755.97  Aligned_cols=477  Identities=56%  Similarity=0.905  Sum_probs=460.1

Q ss_pred             HHHHHHHhhcCCCcHHHHHHHHHHHhcCCeEEEEcCCCCchhhHHHHHHHhccccCCCcEEEEeCccHHHHHHHHHHHHH
Q 008735           30 RRQKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVTQPRRVAAVTVAKRVAE  109 (555)
Q Consensus        30 ~~~~~~~~~~~l~~~~~Q~~~i~~i~~~~~~ii~apTGsGKT~~l~~~i~~~~~~~~~~~i~~~~P~r~l~~~~~~~~~~  109 (555)
                      ....+..+|..||++++..+++..+.++++++|+|+|||||||++|+++++.++...|. |.|++|+|.+|..++++++.
T Consensus        39 ~~~~i~~qR~~LPI~~~r~~il~~ve~nqvlIviGeTGsGKSTQipQyL~eaG~~~~g~-I~~TQPRRVAavslA~RVAe  117 (674)
T KOG0922|consen   39 TNLSIQEQRESLPIYKYRDQILYAVEDNQVLIVIGETGSGKSTQIPQYLAEAGFASSGK-IACTQPRRVAAVSLAKRVAE  117 (674)
T ss_pred             cccCHHHhhccCCHHHHHHHHHHHHHHCCEEEEEcCCCCCccccHhHHHHhcccccCCc-EEeecCchHHHHHHHHHHHH
Confidence            45567788899999999999999999999999999999999999999999999988876 99999999999999999999


Q ss_pred             HhCCccCCEEEEEEecCCCCCchhhHH---------HhhcCCCCCCCceeEeecccccccchhHHHHHHHHHHHhhcccc
Q 008735          110 ESGVELGQRVGYSIRFDDRTSTSTRIK---------EALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSA  180 (555)
Q Consensus       110 ~~~~~~~~~vg~~~~~~~~~~~~~~i~---------~~~~~~~l~~~~~iIiDE~He~~~~~d~ll~~l~~~~~~~~~~~  180 (555)
                      +.+..+|..|||.++++..++..|+++         +++.||.++++++||+||||||+..+|.++++||+++.+|    
T Consensus       118 E~~~~lG~~VGY~IRFed~ts~~TrikymTDG~LLRE~l~Dp~LskYsvIIlDEAHERsl~TDiLlGlLKki~~~R----  193 (674)
T KOG0922|consen  118 EMGCQLGEEVGYTIRFEDSTSKDTRIKYMTDGMLLREILKDPLLSKYSVIILDEAHERSLHTDILLGLLKKILKKR----  193 (674)
T ss_pred             HhCCCcCceeeeEEEecccCCCceeEEEecchHHHHHHhcCCccccccEEEEechhhhhhHHHHHHHHHHHHHhcC----
Confidence            999999999999999999998888765         7788999999999999999999999999999999999999    


Q ss_pred             cCCCCCCCCCCcchhhhccCCCCcccchhhhccccCCCCceEEEeccCCCHHHHHhhhCCCCeEEeCCccccceEEEcCC
Q 008735          181 DGHSNGNNNNENSDMILDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLY  260 (555)
Q Consensus       181 ~~~~~~~~~~~~~d~~l~~~~~~~~~~~l~~~~~~~~~~~~ii~~SAT~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~  260 (555)
                                                           +++|+|+||||+|.+.|.+||++++++.++|+.+|+++.|...
T Consensus       194 -------------------------------------~~LklIimSATlda~kfS~yF~~a~i~~i~GR~fPVei~y~~~  236 (674)
T KOG0922|consen  194 -------------------------------------PDLKLIIMSATLDAEKFSEYFNNAPILTIPGRTFPVEILYLKE  236 (674)
T ss_pred             -------------------------------------CCceEEEEeeeecHHHHHHHhcCCceEeecCCCCceeEEeccC
Confidence                                                 8999999999999999999999999999999999999999999


Q ss_pred             CCCChHHHHHHHHHHHHhcCCCCcEEEEcCCHHHHHHHHHHHHHHhhcCCCCCCCeEEEEecCCCCHHHHHhhcCcCCCC
Q 008735          261 PEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAG  340 (555)
Q Consensus       261 ~~~~~~~~~~~~~~~~~~~~~~~~iLVF~~t~~~~~~l~~~L~~~~~~~~~~~~~~~v~~lh~~l~~~~r~~i~~~f~~g  340 (555)
                      +..+|++..+..+.+++.++++|.||||++++++++.+++.|.+.......+.+. .+.++||.|+.++|.+||...+.|
T Consensus       237 p~~dYv~a~~~tv~~Ih~~E~~GDILvFLtGqeEIe~~~~~l~e~~~~~~~~~~~-~~lply~aL~~e~Q~rvF~p~p~g  315 (674)
T KOG0922|consen  237 PTADYVDAALITVIQIHLTEPPGDILVFLTGQEEIEAACELLRERAKSLPEDCPE-LILPLYGALPSEEQSRVFDPAPPG  315 (674)
T ss_pred             CchhhHHHHHHHHHHHHccCCCCCEEEEeCCHHHHHHHHHHHHHHhhhccccCcc-eeeeecccCCHHHhhccccCCCCC
Confidence            9999999999999999999999999999999999999999999987766655555 789999999999999999999999


Q ss_pred             CcEEEEecCccccccccCCeEEEEeCCcccceeecCCCCccccceeecCHHhHHHHhcccCCCCCCEEEEccChhhHhcc
Q 008735          341 FRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGMESLLVVPISKAQALQRSGRAGREGPGKCFRLYPENEFDKL  420 (555)
Q Consensus       341 ~~~vlvaT~~~e~Gvdip~v~~VId~g~~~~~~yd~~~~~~~l~~~p~s~~~~~Qr~GRaGR~~~G~~~~l~~~~~~~~~  420 (555)
                      .+|||+|||++|++++||+|.||||+|+.|.+.|++..|+..|...|+|++++.||+|||||.++|+||+||++++|+.|
T Consensus       316 ~RKvIlsTNIAETSlTI~GI~YVVDsG~vK~~~y~p~~g~~~L~v~~ISkasA~QRaGRAGRt~pGkcyRLYte~~~~~~  395 (674)
T KOG0922|consen  316 KRKVILSTNIAETSLTIDGIRYVVDSGFVKQKKYNPRTGLDSLIVVPISKASANQRAGRAGRTGPGKCYRLYTESAYDKM  395 (674)
T ss_pred             cceEEEEcceeeeeEEecceEEEEcCCceEEEeeccccCccceeEEechHHHHhhhcccCCCCCCceEEEeeeHHHHhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCcccccCchHHHHHHhhcCCCCccCCcCCCCCcHHHHHHHHHHHHHcCCccCCCCCCHHHHhhcccCCCChHHHH
Q 008735          421 EDSTKPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYSK  500 (555)
Q Consensus       421 ~~~~~pei~~~~l~~~~l~l~~~~~~~~~~~~~~~~p~~~~~~~al~~L~~~g~l~~~~~~T~~lG~~~~~~~~~~~~~~  500 (555)
                      +..+.|||.|++|...+|++|++|++|+..|+|++||+.+++..|++.|..+|+||++|.+|.|+|+.|+.+|++|.++|
T Consensus       396 ~~~~~PEI~R~~Ls~~vL~Lkalgi~d~l~F~f~d~P~~~~l~~AL~~L~~lgald~~g~lt~p~G~~ma~~Pl~p~lsk  475 (674)
T KOG0922|consen  396 PLQTVPEIQRVNLSSAVLQLKALGINDPLRFPFIDPPPPEALEEALEELYSLGALDDRGKLTSPLGRQMAELPLEPHLSK  475 (674)
T ss_pred             ccCCCCceeeechHHHHHHHHhcCCCCcccCCCCCCCChHHHHHHHHHHHhcCcccCcCCcCchHHhhhhhcCCCcchhh
Confidence            99999999999999999999999999999999999999999999999999999999999999889999999999999999


Q ss_pred             HHHHhhhcCCHHHHHHHHHhhcCCCcccCChhhHHH-HHHHhhhccCCCC
Q 008735          501 ALIVAGQFNCLEEMLITVAMLSVESIFFRSPGEVRR-GKKCNEIFCKSRW  549 (555)
Q Consensus       501 ~l~~~~~~~~~~~~l~i~a~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~  549 (555)
                      +++.+..++|++++++|+|+||++++|.+|.+.+.. ++..|++|....-
T Consensus       476 ~ll~s~~~gc~~e~l~i~a~Lsv~~~f~~p~~~~~~~a~~~~~kf~~~eG  525 (674)
T KOG0922|consen  476 MLLKSSELGCSEEILTIAAMLSVQSVFSRPKDKKAEDADRKRAKFANPEG  525 (674)
T ss_pred             hhhhccccCCcchhhhheeeeeccceecCccchhhhhhhHHHHhhcCccc
Confidence            999999999999999999999999999999998777 9999999988765

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only]	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>PF04408 HA2: Helicase associated domain (HA2); InterPro: IPR007502 This presumed domain is about 90 amino acid residues in length	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>smart00847 HA2 Helicase associated domain (HA2) Add an annotation	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]	Back alignment and domain information

>smart00490 HELICc helicase superfamily c-terminal domain	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription]	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics]	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A	Back alignment and domain information

>PF13245 AAA_19: Part of AAA domain	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK12723 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA	Back alignment and domain information

>TIGR01447 recD exodeoxyribonuclease V, alpha subunit	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>TIGR01448 recD_rel helicase, putative, RecD/TraA family	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>PRK10875 recD exonuclease V subunit alpha; Provisional	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins	Back alignment and domain information

>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion]	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>PRK13889 conjugal transfer relaxase TraA; Provisional	Back alignment and domain information

>PRK14974 cell division protein FtsY; Provisional	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>PRK13826 Dtr system oriT relaxase; Provisional	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A	Back alignment and domain information

>PRK07952 DNA replication protein DnaC; Validated	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>PRK10416 signal recognition particle-docking protein FtsY; Provisional	Back alignment and domain information

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>PRK12727 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PRK10536 hypothetical protein; Provisional	Back alignment and domain information

>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK12724 flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane	Back alignment and domain information

>PF05729 NACHT: NACHT domain	Back alignment and domain information

>TIGR03499 FlhF flagellar biosynthetic protein FlhF	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00376 DNA helicase, putative	Back alignment and domain information

>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>PRK06835 DNA replication protein DnaC; Validated	Back alignment and domain information

>PRK13851 type IV secretion system protein VirB11; Provisional	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>KOG1803 consensus DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]	Back alignment and domain information

>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK13900 type IV secretion system ATPase VirB11; Provisional	Back alignment and domain information

>PRK13833 conjugal transfer protein TrbB; Provisional	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>TIGR01425 SRP54_euk signal recognition particle protein SRP54	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR00064 ftsY signal recognition particle-docking protein FtsY	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging []	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>PRK00771 signal recognition particle protein Srp54; Provisional	Back alignment and domain information

>PF13555 AAA_29: P-loop containing region of AAA domain	Back alignment and domain information

>PRK13894 conjugal transfer ATPase TrbB; Provisional	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]	Back alignment and domain information

>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification]	Back alignment and domain information

>KOG2373 consensus Predicted mitochondrial DNA helicase twinkle [Replication, recombination and repair]	Back alignment and domain information

>PRK08939 primosomal protein DnaI; Reviewed	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ]	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK10867 signal recognition particle protein; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>PHA02533 17 large terminase protein; Provisional	Back alignment and domain information

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK14712 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>PRK13709 conjugal transfer nickase/helicase TraI; Provisional	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>TIGR00959 ffh signal recognition particle protein	Back alignment and domain information

>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB	Back alignment and domain information

>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05973 replicative DNA helicase; Provisional	Back alignment and domain information

>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein	Back alignment and domain information

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only]	Back alignment and domain information

>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP	Back alignment and domain information

>KOG1805 consensus DNA replication helicase [Replication, recombination and repair]	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>TIGR00596 rad1 DNA repair protein (rad1)	Back alignment and domain information

>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP)	Back alignment and domain information

>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1	Back alignment and domain information

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional	Back alignment and domain information

>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein	Back alignment and domain information

>COG3910 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit	Back alignment and domain information

>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>KOG2340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PRK11054 helD DNA helicase IV; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis	Back alignment and domain information

>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI	Back alignment and domain information

>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family	Back alignment and domain information

>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01420 pilT_fam pilus retraction protein PilT	Back alignment and domain information

>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals []	Back alignment and domain information

>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems	Back alignment and domain information

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]	Back alignment and domain information

>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10436 hypothetical protein; Provisional	Back alignment and domain information

>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA	Back alignment and domain information

>TIGR02012 tigrfam_recA protein RecA	Back alignment and domain information

>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism]	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter	Back alignment and domain information

>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK11823 DNA repair protein RadA; Provisional	Back alignment and domain information

>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases	Back alignment and domain information

>TIGR01192 chvA glucan exporter ATP-binding protein	Back alignment and domain information

>PHA03333 putative ATPase subunit of terminase; Provisional	Back alignment and domain information

>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family	Back alignment and domain information

>TIGR03238 dnd_assoc_3 dnd system-associated protein 3	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>PRK10919 ATP-dependent DNA helicase Rep; Provisional	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00293 thymidine kinase; Provisional	Back alignment and domain information

>TIGR03263 guanyl_kin guanylate kinase	Back alignment and domain information

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot)	Back alignment and domain information

>PLN03130 ABC transporter C family member; Provisional	Back alignment and domain information

>PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2	Back alignment and domain information

>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK00300 gmk guanylate kinase; Provisional	Back alignment and domain information

>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase)	Back alignment and domain information

>TIGR00150 HI0065_YjeE ATPase, YjeE family	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>PRK09354 recA recombinase A; Provisional	Back alignment and domain information

>PRK10078 ribose 1,5-bisphosphokinase; Provisional	Back alignment and domain information

>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02688 conserved hypothetical protein TIGR02688	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP)	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>TIGR02533 type_II_gspE general secretory pathway protein E	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>KOG1970 consensus Checkpoint RAD17-RFC complex, RAD17/RAD24 component [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B	Back alignment and domain information

>PF02367 UPF0079: Uncharacterised P-loop hydrolase UPF0079; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>PF12846 AAA_10: AAA-like domain	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK04301 radA DNA repair and recombination protein RadA; Validated	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>PF13871 Helicase_C_4: Helicase_C-like	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]	Back alignment and domain information

>PTZ00265 multidrug resistance protein (mdr1); Provisional	Back alignment and domain information

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor	Back alignment and domain information

>TIGR01978 sufC FeS assembly ATPase SufC	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		555
3kx2_B		767	Crystal Structure Of Prp43p In Complex With Adp Len		1e-109
2xau_A		773	Crystal Structure Of The Prp43p Deah-Box Rna Helica		1e-109
3llm_A		235	Crystal Structure Analysis Of A Rna Helicase Length		3e-16
3i4u_A		270	Crystal Structure Analysis Of A Helicase Associated		6e-11

>pdb|3KX2|B Chain B, Crystal Structure Of Prp43p In Complex With Adp Length = 767

Back alignment and structure

Iteration: 1

Score = 390 bits (1003), Expect = e-109, Method: Compositional matrix adjust. Identities = 226/530 (42%), Positives = 308/530 (58%), Gaps = 60/530 (11%) Query: 34 ILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQF-LFHAGFCRDGKLIGV 92 IL+ R+ LP+ + ++ + N I++ VGETGSGKTTQ+PQF LF + + Sbjct: 86 ILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVAC 145 Query: 93 TQPXXXXXXXXXXXXXEESGVELGQRVGYSIRFDDRTSTSTRIK---------EALLDPY 143 TQP EE V+LG+ VGYSIRF+++TS T +K EA+ D Sbjct: 146 TQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHD 205 Query: 144 LSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSXXXXXXXXSDMILDRGNDT 203 LSRYS II+DEAHERT+ TD+L+GLLK+V R Sbjct: 206 LSRYSCIILDEAHERTLATDILMGLLKQVVKRRPD------------------------- 240 Query: 204 NGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEP 263 LK+IIMSA+LDA F YF A + V GR +PVE+ YT + Sbjct: 241 ----------------LKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVELYYTPEFQR 284 Query: 264 DYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQL--PEASRKLVTVPI 321 DYLD+ + T+ Q+H E GDIL+FLTG++EIE R + QL E L P+ Sbjct: 285 DYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPL 344 Query: 322 FSSLPSEQQMRVFAPAAAGF-----RKVILATNIAETSVTIPGIKYVIDPGFVKARLYDP 376 + SLP QQ R+F PA RKV+++TNIAETS+TI GI YV+DPGF K ++Y+P Sbjct: 345 YGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNP 404 Query: 377 VKGMESLLVVPISKAQALQRSGRAGREGPGKCFRLYPENEFDK-LEDSTKPEIKRCNLSN 435 +ESLLV PISKA A QR+GRAGR PGKCFRLY E F K L + + PEI R NLS+ Sbjct: 405 RIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSS 464 Query: 436 VILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLD 495 +L+LK LG+DD++ FDFM+ P+ +++++LE+L L L D+ L+ P+G ++ PLD Sbjct: 465 TVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLT-PLGRLASQFPLD 523 Query: 496 PIYSKALIVAGQFNCLEEMLITVAMLSVESIFFRSPGEVRRGKKCNEIFC 545 P+ + LI + +F C +E+L VAMLSV ++F R + +R IF Sbjct: 524 PMLAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKRADDAKNIFA 573

PyMOL of 3kx2

>pdb|2XAU|A Chain A, Crystal Structure Of The Prp43p Deah-Box Rna Helicase In Complex With Adp Length = 773

Back alignment and structure

>pdb|3LLM|A Chain A, Crystal Structure Analysis Of A Rna Helicase Length = 235

Back alignment and structure

>pdb|3I4U|A Chain A, Crystal Structure Analysis Of A Helicase Associated Domain Length = 270

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		555
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	0.0
2jlq_A		451	Serine protease subunit NS3; ribonucleoprotein, nu	5e-88
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	4e-87
2z83_A		459	Helicase/nucleoside triphosphatase; hydrolase, mem	7e-86
2whx_A		618	Serine protease/ntpase/helicase NS3; transcription	5e-78
1yks_A		440	Genome polyprotein [contains: flavivirin protease	1e-77
3llm_A		235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	4e-76
3o8b_A		666	HCV NS3 protease/helicase; ntpase, RNA, translocat	3e-75
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	6e-75
3i4u_A		270	ATP-dependent RNA helicase DHX8; splicing, ATP-bin	4e-33
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	3e-21
1wp9_A		494	ATP-dependent RNA helicase, putative; ATPase, DNA	4e-04

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Length = 773	Back alignment and structure

 Score =  741 bits (1916), Expect = 0.0
 Identities = 235/538 (43%), Positives = 324/538 (60%), Gaps = 60/538 (11%)

Query: 25  NDSSSRRQKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFL-FHAGF 83
            + + +   IL+ R+ LP+ +     ++  + N I++ VGETGSGKTTQ+PQF+ F    
Sbjct: 77  REFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMP 136

Query: 84  CRDGKLIGVTQPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDDRTSTSTRIK------- 136
             +   +  TQPRRVAA++VA+RVAEE  V+LG+ VGYSIRF+++TS  T +K       
Sbjct: 137 HLENTQVACTQPRRVAAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGML 196

Query: 137 --EALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNNNENSD 194
             EA+ D  LSRYS II+DEAHERT+ TD+L+GLLK+V   R                  
Sbjct: 197 LREAMEDHDLSRYSCIILDEAHERTLATDILMGLLKQVVKRRP----------------- 239

Query: 195 MILDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVE 254
                                    LK+IIMSA+LDA  F  YF  A  + V GR +PVE
Sbjct: 240 ------------------------DLKIIIMSATLDAEKFQRYFNDAPLLAVPGRTYPVE 275

Query: 255 ILYTLYPEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQLP--EA 312
           + YT   + DYLD+ + T+ Q+H  E  GDIL+FLTG++EIE   R +     QL   E 
Sbjct: 276 LYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEG 335

Query: 313 SRKLVTVPIFSSLPSEQQMRVFAPAAAGF-----RKVILATNIAETSVTIPGIKYVIDPG 367
              L   P++ SLP  QQ R+F PA         RKV+++TNIAETS+TI GI YV+DPG
Sbjct: 336 CGPLSVYPLYGSLPPHQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPG 395

Query: 368 FVKARLYDPVKGMESLLVVPISKAQALQRSGRAGREGPGKCFRLYPENEFDK-LEDSTKP 426
           F K ++Y+P   +ESLLV PISKA A QR+GRAGR  PGKCFRLY E  F K L + + P
Sbjct: 396 FSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFQKELIEQSYP 455

Query: 427 EIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKLSDPVG 486
           EI R NLS+ +L+LK LG+DD++ FDFM+ P+  +++++LE+L  L  L D+  L+ P+G
Sbjct: 456 EILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNLT-PLG 514

Query: 487 HQMARLPLDPIYSKALIVAGQFNCLEEMLITVAMLSVESIFFRSPGEVRRGKKCNEIF 544
              ++ PLDP+ +  LI + +F C +E+L  VAMLSV ++F R   + +R      IF
Sbjct: 515 RLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKRADDAKNIF 572

PyMOL of 2xau

>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Length = 431	Back alignment and structure

>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459	Back alignment and structure

>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440	Back alignment and structure

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Length = 235	Back alignment and structure

>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Length = 673	Back alignment and structure

>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens} Length = 270	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		555
2xau_A		773	PRE-mRNA-splicing factor ATP-dependent RNA helica;	100.0
2va8_A		715	SSO2462, SKI2-type helicase; hydrolase, DNA repair	100.0
2p6r_A		702	Afuhel308 helicase; protein-DNA complex, SF2 helic	100.0
2zj8_A		720	DNA helicase, putative SKI2-type helicase; RECA fo	100.0
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	100.0
4f92_B		1724	U5 small nuclear ribonucleoprotein 200 kDa helica;	100.0
2db3_A		434	ATP-dependent RNA helicase VASA; DEAD-BOX, protein	100.0
3fht_A		412	ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box	100.0
3eiq_A		414	Eukaryotic initiation factor 4A-I; PDCD4, anti-onc	100.0
3pey_A		395	ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A	100.0
2i4i_A		417	ATP-dependent RNA helicase DDX3X; DEAD, structural	100.0
2v1x_A		591	ATP-dependent DNA helicase Q1; DNA strand annealin	100.0
2j0s_A		410	ATP-dependent RNA helicase DDX48; mRNA processing,	100.0
1hv8_A		367	Putative ATP-dependent RNA helicase MJ0669; RNA-bi	100.0
1xti_A		391	Probable ATP-dependent RNA helicase P47; alpha-bet	100.0
1s2m_A		400	Putative ATP-dependent RNA helicase DHH1; ATP-bind	100.0
3fmp_B		479	ATP-dependent RNA helicase DDX19B; nuclear porin,	100.0
1oyw_A		523	RECQ helicase, ATP-dependent DNA helicase; winged	100.0
3i5x_A		563	ATP-dependent RNA helicase MSS116; protein-RNA com	100.0
3l9o_A		1108	ATP-dependent RNA helicase DOB1; REC-A fold, winge	100.0
1fuu_A		394	Yeast initiation factor 4A; IF4A, helicase, DEAD-b	100.0
3sqw_A		579	ATP-dependent RNA helicase MSS116, mitochondrial;	100.0
3o8b_A		666	HCV NS3 protease/helicase; ntpase, RNA, translocat	100.0
4a4z_A		997	Antiviral helicase SKI2; hydrolase, ATPase, mRNA d	100.0
2z0m_A		337	337AA long hypothetical ATP-dependent RNA helicase	100.0
2xgj_A		1010	ATP-dependent RNA helicase DOB1; hydrolase-RNA com	100.0
2jlq_A		451	Serine protease subunit NS3; ribonucleoprotein, nu	100.0
2z83_A		459	Helicase/nucleoside triphosphatase; hydrolase, mem	100.0
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	100.0
3fho_A		508	ATP-dependent RNA helicase DBP5; mRNA export, ATPa	100.0
2whx_A		618	Serine protease/ntpase/helicase NS3; transcription	100.0
3rc3_A		677	ATP-dependent RNA helicase SUPV3L1, mitochondrial;	100.0
1yks_A		440	Genome polyprotein [contains: flavivirin protease	100.0
2ykg_A		696	Probable ATP-dependent RNA helicase DDX58; hydrola	100.0
2wv9_A		673	Flavivirin protease NS2B regulatory subunit, FLAV	100.0
2v6i_A		431	RNA helicase; membrane, hydrolase, transmembrane,	100.0
4a2p_A		556	RIG-I, retinoic acid inducible protein I; hydrolas	100.0
1wp9_A		494	ATP-dependent RNA helicase, putative; ATPase, DNA	100.0
3tbk_A		555	RIG-I helicase domain; DECH helicase, ATP binding,	100.0
4a2q_A		797	RIG-I, retinoic acid inducible protein I; hydrolas	100.0
2eyq_A		1151	TRCF, transcription-repair coupling factor; MFD, S	100.0
1gm5_A		780	RECG; helicase, replication restart; HET: DNA ADP;	99.98
4a2w_A		936	RIG-I, retinoic acid inducible protein I; hydrolas	99.98
4ddu_A		1104	Reverse gyrase; topoisomerase, DNA supercoiling, a	99.97
4gl2_A		699	Interferon-induced helicase C domain-containing P;	99.97
2fwr_A		472	DNA repair protein RAD25; DNA unwinding, XPB, DNA	99.96
1gku_B		1054	Reverse gyrase, TOP-RG; topoisomerase, DNA superco	99.96
2oca_A		510	DAR protein, ATP-dependent DNA helicase UVSW; ATP-	99.96
1tf5_A		844	Preprotein translocase SECA subunit; ATPase, helic	99.96
3h1t_A		590	Type I site-specific restriction-modification syst	99.95
2fsf_A		853	Preprotein translocase SECA subunit; ATPase, DNA-R	99.95
3eaq_A		212	Heat resistant RNA dependent ATPase; DEAD box RNA	99.94
1nkt_A		922	Preprotein translocase SECA 1 subunit; preprotein	99.94
3dmq_A		968	RNA polymerase-associated protein RAPA; SWF2/SNF2,	99.92
3i32_A		300	Heat resistant RNA dependent ATPase; RNA helicase,	99.92
1c4o_A		664	DNA nucleotide excision repair enzyme UVRB; uvrabc	99.9
3llm_A		235	ATP-dependent RNA helicase A; alpha-beta-alpha, st	99.9
3jux_A		822	Protein translocase subunit SECA; protein transloc	99.9
1z63_A		500	Helicase of the SNF2/RAD54 hamily; protein-DNA com	99.89
2w00_A		1038	HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri	99.88
2rb4_A		175	ATP-dependent RNA helicase DDX25; rossmann fold, s	99.87
2hjv_A		163	ATP-dependent RNA helicase DBPA; parallel alpha-be	99.87
1z3i_X		644	Similar to RAD54-like; recombination ATPase helica	99.87
1fuk_A		165	Eukaryotic initiation factor 4A; helicase, DEAD-bo	99.86
1t5i_A		172	C_terminal domain of A probable ATP-dependent RNA	99.86
2jgn_A		185	DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp	99.85
2p6n_A		191	ATP-dependent RNA helicase DDX41; DEAD, structural	99.85
2d7d_A		661	Uvrabc system protein B; helicase, protein-DNA-ADP	99.83
3mwy_W		800	Chromo domain-containing protein 1; SWI2/SNF2 ATPa	99.83
2yjt_D		170	ATP-dependent RNA helicase SRMB, regulator of ribo	99.72
3iuy_A		228	Probable ATP-dependent RNA helicase DDX53; REC-A-l	99.76
2oxc_A		230	Probable ATP-dependent RNA helicase DDX20; DEAD, s	99.76
3fe2_A		242	Probable ATP-dependent RNA helicase DDX5; DEAD, AD	99.76
3fmo_B		300	ATP-dependent RNA helicase DDX19B; nuclear porin,	99.75
1q0u_A		219	Bstdead; DEAD protein, RNA binding protein; 1.85A	99.75
2pl3_A		236	Probable ATP-dependent RNA helicase DDX10; DEAD, s	99.75
3ber_A		249	Probable ATP-dependent RNA helicase DDX47; DEAD, A	99.75
3bor_A		237	Human initiation factor 4A-II; translation initiat	99.74
1qde_A		224	EIF4A, translation initiation factor 4A; DEAD box	99.74
1vec_A		206	ATP-dependent RNA helicase P54; DEAD-box protein,	99.74
1t6n_A		220	Probable ATP-dependent RNA helicase; RECA-like fol	99.74
3ly5_A		262	ATP-dependent RNA helicase DDX18; alpha-beta, stru	99.74
2gxq_A		207	Heat resistant RNA dependent ATPase; RNA helicase,	99.73
3dkp_A		245	Probable ATP-dependent RNA helicase DDX52; DEAD, A	99.72
3i4u_A		270	ATP-dependent RNA helicase DHX8; splicing, ATP-bin	99.72
1wrb_A		253	DJVLGB; RNA helicase, DEAD BOX, VASA, structural g	99.69
2ipc_A		997	Preprotein translocase SECA subunit; nucleotide bi	99.58
3b6e_A		216	Interferon-induced helicase C domain-containing P;	99.52
2vl7_A		540	XPD; helicase, unknown function; 2.25A {Sulfolobus	99.52
1z5z_A		271	Helicase of the SNF2/RAD54 family; hydrolase, reco	99.49
2fz4_A		237	DNA repair protein RAD25; RECA-like domain, DNA da	99.39
1rif_A		282	DAR protein, DNA helicase UVSW; bacteriophage, REC	99.38
3crv_A		551	XPD/RAD3 related DNA helicase; XPD helicase DNA re	99.27
1w36_D		608	RECD, exodeoxyribonuclease V alpha chain; recombin	98.22
3e1s_A		574	Exodeoxyribonuclease V, subunit RECD; alpha and be	97.71
3upu_A		459	ATP-dependent DNA helicase DDA; RECA-like domain,	97.69
4a15_A		620	XPD helicase, ATP-dependent DNA helicase TA0057; h	97.63
4a15_A		620	XPD helicase, ATP-dependent DNA helicase TA0057; h	97.38
2orw_A		184	Thymidine kinase; TMTK, TP4A, transferase; HET: 4T	97.34
2o0j_A		385	Terminase, DNA packaging protein GP17; nucleotide-	97.23
2b8t_A		223	Thymidine kinase; deoxyribonucleoside kinase, zinc	97.22
3ec2_A		180	DNA replication protein DNAC; helicase loader, rep	97.21
2kjq_A		149	DNAA-related protein; solution structure, NESG, st	97.16
3kl4_A		433	SRP54, signal recognition 54 kDa protein; signal r	97.12
3cpe_A		592	Terminase, DNA packaging protein GP17; large termi	97.11
4b3f_X		646	DNA-binding protein smubp-2; hydrolase, helicase;	97.05
1xx6_A		191	Thymidine kinase; NESG, northeast structural genom	96.86
2gk6_A		624	Regulator of nonsense transcripts 1; UPF1, helicas	96.86
3te6_A		318	Regulatory protein SIR3; heterochromatin, gene sil	96.73
2j9r_A		214	Thymidine kinase; TK1, DNK, lasso, transferase, AT	96.72
2w0m_A		235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	96.65
2wjy_A		800	Regulator of nonsense transcripts 1; nonsense medi	96.63
2xzl_A		802	ATP-dependent helicase NAM7; hydrolase-RNA complex	96.63
2w58_A		202	DNAI, primosome component (helicase loader); ATP-b	96.61
1l8q_A		324	Chromosomal replication initiator protein DNAA; AA	96.61
1vma_A		306	Cell division protein FTSY; TM0570, structural gen	96.59
3dm5_A		443	SRP54, signal recognition 54 kDa protein; protein-	96.48
2px0_A		296	Flagellar biosynthesis protein FLHF; SRP GTPase, f	96.46
2pt7_A		330	CAG-ALFA; ATPase, protein-protein complex, type IV	96.44
3jvv_A		356	Twitching mobility protein; hexameric P-loop ATPas	96.37
3bos_A		242	Putative DNA replication factor; P-loop containing	96.33
3b85_A		208	Phosphate starvation-inducible protein; PHOH2, ATP	96.26
3e70_C		328	DPA, signal recognition particle receptor; FTSY, S	96.26
1njg_A		250	DNA polymerase III subunit gamma; rossman-like fol	96.19
3vkw_A		446	Replicase large subunit; alpha/beta domain, helica	96.17
2chg_A		226	Replication factor C small subunit; DNA-binding pr	96.14
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	96.12
2r2a_A		199	Uncharacterized protein; zonular occludens toxin,	96.04
3h4m_A		285	Proteasome-activating nucleotidase; ATPase, PAN, A	96.02
1w4r_A		195	Thymidine kinase; type II, human, cytosolic, phosp	96.0
2z4s_A		440	Chromosomal replication initiator protein DNAA; AA	95.9
3b9q_A		302	Chloroplast SRP receptor homolog, alpha subunit CP	95.88
2orv_A		234	Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2	95.86
2qen_A		350	Walker-type ATPase; unknown function; HET: ADP; 2.	95.81
3lfu_A		647	DNA helicase II; SF1 helicase, ATP-binding, DNA da	95.78
1ls1_A		295	Signal recognition particle protein; FFH, SRP54, S	95.71
2v1u_A		387	Cell division control protein 6 homolog; DNA repli	95.68
2zpa_A		671	Uncharacterized protein YPFI; RNA modification enz	95.65
2yhs_A		503	FTSY, cell division protein FTSY; cell cycle, prot	95.64
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	95.64
2og2_A		359	Putative signal recognition particle receptor; nuc	95.6
1fnn_A		389	CDC6P, cell division control protein 6; ORC1, AAA	95.6
3e2i_A		219	Thymidine kinase; Zn-binding, ATP-binding, DNA syn	95.56
3vfd_A		389	Spastin; ATPase, microtubule severing, hydrolase;	95.55
2qby_B		384	CDC6 homolog 3, cell division control protein 6 ho	95.55
1zu4_A		320	FTSY; GTPase, signal recognition particle, SRP, re	95.49
2qby_A		386	CDC6 homolog 1, cell division control protein 6 ho	95.45
1znw_A		207	Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans	95.44
1jr3_A		373	DNA polymerase III subunit gamma; processivity, pr	95.41
1kgd_A		180	CASK, peripheral plasma membrane CASK; maguk, guan	95.35
3tr0_A		205	Guanylate kinase, GMP kinase; purines, pyrimidines	95.33
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	95.28
1rj9_A		304	FTSY, signal recognition protein; SRP-GTPase domai	95.26
2eyu_A		261	Twitching motility protein PILT; pilus retraction	95.24
1z6g_A		218	Guanylate kinase; structural genomics, SGC, struct	95.22
1lvg_A		198	Guanylate kinase, GMP kinase; transferase; HET: AD	95.2
2qz4_A		262	Paraplegin; AAA+, SPG7, protease, ADP, structural	95.08
2gza_A		361	Type IV secretion system protein VIRB11; ATPase, h	95.05
4gp7_A		171	Metallophosphoesterase; polynucleotide kinase phos	95.0
1iqp_A		327	RFCS; clamp loader, extended AAA-ATPase domain, co	94.91
2r6a_A		454	DNAB helicase, replicative helicase; replication,	94.91
2qp9_X		355	Vacuolar protein sorting-associated protein 4; ATP	94.91
3cf0_A		301	Transitional endoplasmic reticulum ATPase; AAA, P9	94.9
1sxj_E		354	Activator 1 40 kDa subunit; clamp loader, processi	94.9
3hgt_A		328	HDA1 complex subunit 3; RECA-like domain, SWI2/SNF	94.84
3eie_A		322	Vacuolar protein sorting-associated protein 4; AAA	94.82
1zp6_A		191	Hypothetical protein ATU3015; alpha-beta protein.,	94.8
2j41_A		207	Guanylate kinase; GMP, GMK, transferase, ATP-bindi	94.77
2oap_1		511	GSPE-2, type II secretion system protein; hexameri	94.77
1s96_A		219	Guanylate kinase, GMP kinase; E.coli, dimer, SAD,	94.76
3u61_B		324	DNA polymerase accessory protein 44; AAA+, ATP hyd	94.75
3pfi_A		338	Holliday junction ATP-dependent DNA helicase RUVB;	94.73
2fna_A		357	Conserved hypothetical protein; structural genomic	94.71
3tif_A		235	Uncharacterized ABC transporter ATP-binding prote;	94.7
3tau_A		208	Guanylate kinase, GMP kinase; structural genomics,	94.69
1htw_A		158	HI0065; nucleotide-binding fold, structural genomi	94.67
3a00_A		186	Guanylate kinase, GMP kinase; domain movement, dim	94.66
1a5t_A		334	Delta prime, HOLB; zinc finger, DNA replication; 2	94.59
2ehv_A		251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	94.58
3ney_A		197	55 kDa erythrocyte membrane protein; structural ge	94.53
1p9r_A		418	General secretion pathway protein E; bacterial typ	94.5
1uaa_A		673	REP helicase, protein (ATP-dependent DNA helicase	94.49
4f4c_A		1321	Multidrug resistance protein PGP-1; ABC transporte	94.38
2pcj_A		224	ABC transporter, lipoprotein-releasing system ATP-	94.35
3pvs_A		447	Replication-associated recombination protein A; ma	94.35
3gfo_A		275	Cobalt import ATP-binding protein CBIO 1; structur	94.34
3lnc_A		231	Guanylate kinase, GMP kinase; ALS collaborative cr	94.32
2cbz_A		237	Multidrug resistance-associated protein 1; ABC pro	94.3
1j8m_F		297	SRP54, signal recognition 54 kDa protein; signalin	94.23
3n70_A		145	Transport activator; sigma-54, ntpase, PSI, MCSG,	94.22
2q6t_A		444	DNAB replication FORK helicase; hydrolase; 2.90A {	94.2
1sgw_A		214	Putative ABC transporter; structural genomics, P p	94.18
2chq_A		319	Replication factor C small subunit; DNA-binding pr	94.12
2pze_A		229	Cystic fibrosis transmembrane conductance regulat;	94.1
4g1u_C		266	Hemin import ATP-binding protein HMUV; membrane tr	94.06
2zu0_C		267	Probable ATP-dependent transporter SUFC; iron-sulf	94.06
2ff7_A		247	Alpha-hemolysin translocation ATP-binding protein	94.04
1b0u_A		262	Histidine permease; ABC transporter, transport pro	94.03
1pjr_A		724	PCRA; DNA repair, DNA replication, SOS response, h	94.02
2d2e_A		250	SUFC protein; ABC-ATPase, SUF protein, 310-helix,	94.01
3c8u_A		208	Fructokinase; YP_612366.1, putative fructose trans	94.0
1hqc_A		324	RUVB; extended AAA-ATPase domain, complex with nuc	94.0
1ji0_A		240	ABC transporter; ATP binding protein, structural g	93.98
1g6h_A		257	High-affinity branched-chain amino acid transport	93.98
2ewv_A		372	Twitching motility protein PILT; pilus retraction	93.97
2olj_A		263	Amino acid ABC transporter; ABC domain, ATPase, hy	93.94
3u4q_A		1232	ATP-dependent helicase/nuclease subunit A; helicas	93.94
3vaa_A		199	Shikimate kinase, SK; structural genomics, center	93.93
3co5_A		143	Putative two-component system transcriptional RES	93.91
1vpl_A		256	ABC transporter, ATP-binding protein; TM0544, stru	93.89
1sxj_B		323	Activator 1 37 kDa subunit; clamp loader, processi	93.89
2ghi_A		260	Transport protein; multidrug resistance protein, M	93.87
2v9p_A		305	Replication protein E1; AAA+ molecular motor, DNA	93.81
1mv5_A		243	LMRA, multidrug resistance ABC transporter ATP-bin	93.8
2ihy_A		279	ABC transporter, ATP-binding protein; ATPase, ABC	93.78
2qi9_C		249	Vitamin B12 import ATP-binding protein BTUD; inner	93.78
2ffh_A		425	Protein (FFH); SRP54, signal recognition particle,	93.76
4eun_A		200	Thermoresistant glucokinase; putative sugar kinase	93.76
2ixe_A		271	Antigen peptide transporter 1; ABC ATPase, hydrola	93.74
4a74_A		231	DNA repair and recombination protein RADA; hydrola	93.73
4f4c_A		1321	Multidrug resistance protein PGP-1; ABC transporte	93.73
2nq2_C		253	Hypothetical ABC transporter ATP-binding protein H	93.66
2cvh_A		220	DNA repair and recombination protein RADB; filamen	93.65
1ye8_A		178	Protein THEP1, hypothetical UPF0334 kinase-like pr	93.58
2yz2_A		266	Putative ABC transporter ATP-binding protein TM_0;	93.57
1n0w_A		243	DNA repair protein RAD51 homolog 1; DNA repair, ho	93.47
3asz_A		211	Uridine kinase; cytidine phosphorylation, transfer	93.46
3nh6_A		306	ATP-binding cassette SUB-family B member 6, mitoc;	93.44
3fvq_A		359	Fe(3+) IONS import ATP-binding protein FBPC; nucle	93.43
1jbk_A		195	CLPB protein; beta barrel, chaperone; 1.80A {Esche	93.35
2i3b_A		189	HCR-ntpase, human cancer-related ntpase; AAA, ross	93.32
1kag_A		173	SKI, shikimate kinase I; transferase, structural g	93.31
2qor_A		204	Guanylate kinase; phosphotransferase, purine metab	93.24
3tqc_A		321	Pantothenate kinase; biosynthesis of cofactors, pr	93.23
2bdt_A		189	BH3686; alpha-beta protein, structural genomics, P	93.2
1cr0_A		296	DNA primase/helicase; RECA-type protein fold, tran	93.15
1z47_A		355	CYSA, putative ABC-transporter ATP-binding protein	93.12
3rlf_A		381	Maltose/maltodextrin import ATP-binding protein M;	93.1
2bbs_A		290	Cystic fibrosis transmembrane conductance regulato	93.06
1knq_A		175	Gluconate kinase; ALFA/beta structure, transferase	93.01
4a1f_A		338	DNAB helicase, replicative DNA helicase; hydrolase	93.0
2yyz_A		359	Sugar ABC transporter, ATP-binding protein; sugar	92.99
3aez_A		312	Pantothenate kinase; transferase, homodimer, COA b	92.98
3hu3_A		489	Transitional endoplasmic reticulum ATPase; VCP, tr	92.92
2onk_A		240	Molybdate/tungstate ABC transporter, ATP-binding p	92.9
2gno_A		305	DNA polymerase III, gamma subunit-related protein;	92.89
2it1_A		362	362AA long hypothetical maltose/maltodextrin trans	92.88
3exa_A		322	TRNA delta(2)-isopentenylpyrophosphate transferase	92.77
3uie_A		200	Adenylyl-sulfate kinase 1, chloroplastic; rossmann	92.74
1v43_A		372	Sugar-binding transport ATP-binding protein; ATPas	92.72
1kht_A		192	Adenylate kinase; phosphotransferase, signaling pr	92.71
2jeo_A		245	Uridine-cytidine kinase 1; UCK, transferase, ATP-b	92.71
2p65_A		187	Hypothetical protein PF08_0063; CLPB, malaria, str	92.71
3tui_C		366	Methionine import ATP-binding protein METN; ABC-tr	92.67
3d31_A		348	Sulfate/molybdate ABC transporter, ATP-binding pro	92.67
2pjz_A		263	Hypothetical protein ST1066; ATP binding protein,	92.62
1g29_1		372	MALK, maltose transport protein MALK; ATPase, acti	92.62
3gd7_A		390	Fusion complex of cystic fibrosis transmembrane co	92.61
2dr3_A		247	UPF0273 protein PH0284; RECA superfamily ATPase, h	92.56
3a8t_A		339	Adenylate isopentenyltransferase; rossmann fold pr	92.53
1gm5_A		780	RECG; helicase, replication restart; HET: DNA ADP;	92.53
2qmh_A		205	HPR kinase/phosphorylase; V267F mutation, ATP-bind	92.42
1qvr_A		854	CLPB protein; coiled coil, AAA ATPase, chaperone;	92.37
3trf_A		185	Shikimate kinase, SK; amino acid biosynthesis, tra	92.28
1qhx_A		178	CPT, protein (chloramphenicol phosphotransferase);	92.24
2bbw_A		246	Adenylate kinase 4, AK4; nucleotide kinase, nucleo	92.22
1ex7_A		186	Guanylate kinase; substrate-induced FIT, domain mo	92.19
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	92.17
1oxx_K		353	GLCV, glucose, ABC transporter, ATP binding protei	92.08
2ze6_A		253	Isopentenyl transferase; crown GALL tumor, cytokin	92.08
3lw7_A		179	Adenylate kinase related protein (ADKA-like); AMP,	91.98
2zts_A		251	Putative uncharacterized protein PH0186; KAIC like	91.96
3kta_A		182	Chromosome segregation protein SMC; structural mai	91.91
2d7d_A		661	Uvrabc system protein B; helicase, protein-DNA-ADP	91.88
3cm0_A		186	Adenylate kinase; ATP-binding, cytoplasm, nucleoti	91.87
3umf_A		217	Adenylate kinase; rossmann fold, transferase; 2.05	91.84
3kb2_A		173	SPBC2 prophage-derived uncharacterized protein YOR	91.73
2v3c_C		432	SRP54, signal recognition 54 kDa protein; nucleoti	91.71
1f2t_A		149	RAD50 ABC-ATPase; DNA double-strand break repair,	91.68
2bwj_A		199	Adenylate kinase 5; phosphoryl transfer reaction,	91.64
1nij_A		318	Hypothetical protein YJIA; structural genomics, P-	91.57
2c95_A		196	Adenylate kinase 1; transferase, AP4A, nucleotide	91.57
2xxa_A		433	Signal recognition particle protein; protein trans	91.52
2qt1_A		207	Nicotinamide riboside kinase 1; non-protein kinase	91.52
2f1r_A		171	Molybdopterin-guanine dinucleotide biosynthesis pr	91.51
4e22_A		252	Cytidylate kinase; P-loop, CMP/ATP binding, transf	91.47
1nlf_A		279	Regulatory protein REPA; replicative DNA helicase	91.43
2qgz_A		308	Helicase loader, putative primosome component; str	91.42
3iij_A		180	Coilin-interacting nuclear ATPase protein; alpha a	91.37
1zd8_A		227	GTP:AMP phosphotransferase mitochondrial; ATP:AMP	91.34
3foz_A		316	TRNA delta(2)-isopentenylpyrophosphate transferas;	91.31
1rz3_A		201	Hypothetical protein rbstp0775; MCSG, structural g	91.28
1y63_A		184	LMAJ004144AAA protein; structural genomics, protei	91.27
1cke_A		227	CK, MSSA, protein (cytidine monophosphate kinase);	91.26
2pez_A		179	Bifunctional 3'-phosphoadenosine 5'- phosphosulfat	91.24
1in4_A		334	RUVB, holliday junction DNA helicase RUVB; AAA+-cl	91.19
2j37_W		504	Signal recognition particle 54 kDa protein (SRP54)	91.1
2v54_A		204	DTMP kinase, thymidylate kinase; nucleotide biosyn	91.0
2npi_A		460	Protein CLP1; CLP1-PCF11 complex, ATP binding, ter	91.0
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	90.98
3lda_A		400	DNA repair protein RAD51; DNA binding protein, ATP	90.97
1ly1_A		181	Polynucleotide kinase; PNK, phosphatase, transfera	90.94
4ag6_A		392	VIRB4 ATPase, type IV secretory pathway VIRB4 comp	90.92
1tev_A		196	UMP-CMP kinase; ploop, NMP binding region, LID reg	90.81
1m7g_A		211	Adenylylsulfate kinase; APS kinase, transferase, s	90.8
3t61_A		202	Gluconokinase; PSI-biology, structural genomics, p	90.8
2rhm_A		193	Putative kinase; P-loop containing nucleoside trip	90.75
1sq5_A		308	Pantothenate kinase; P-loop, transferase; HET: PAU	90.67
1pzn_A		349	RAD51, DNA repair and recombination protein RAD51,	90.66
2vp4_A		230	Deoxynucleoside kinase; ATP-binding, DNA synthesis	90.65
1tq4_A		413	IIGP1, interferon-inducible GTPase; interferon gam	90.48
3sr0_A		206	Adenylate kinase; phosphoryl transfer analogue, AL	90.47
3tlx_A		243	Adenylate kinase 2; structural genomics, structura	90.45
2bjv_A		265	PSP operon transcriptional activator; AAA, transcr	90.34
3sop_A		270	Neuronal-specific septin-3; hydrolase; HET: GDP; 2	90.26
2plr_A		213	DTMP kinase, probable thymidylate kinase; TMP-bind	90.22
2yvu_A		186	Probable adenylyl-sulfate kinase; transferase, str	90.21
3cmu_A		2050	Protein RECA, recombinase A; homologous recombinat	90.19
3b5x_A		582	Lipid A export ATP-binding/permease protein MSBA;	90.09
1v5w_A		343	DMC1, meiotic recombination protein DMC1/LIM15 hom	90.07
3crm_A		323	TRNA delta(2)-isopentenylpyrophosphate transferase	89.97
2yv5_A		302	YJEQ protein; hydrolase, GTPase, permutation, stru	89.91
1sxj_C		340	Activator 1 40 kDa subunit; clamp loader, processi	89.91
3d3q_A		340	TRNA delta(2)-isopentenylpyrophosphate transferase	89.89
3hws_A		363	ATP-dependent CLP protease ATP-binding subunit CL;	89.87
1aky_A		220	Adenylate kinase; ATP:AMP phosphotransferase, myok	89.86
1yqt_A		538	RNAse L inhibitor; ATP-binding cassette, ribosome	89.85
3nwj_A		250	ATSK2; P loop, shikimate, nucleoside monophosphate	89.83
1gvn_B		287	Zeta; postsegregational killing system, plasmid; 1	89.79
1e9r_A		437	Conjugal transfer protein TRWB; coupling protein,	89.79
1np6_A		174	Molybdopterin-guanine dinucleotide biosynthesis pr	89.79
3qf7_A		365	RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.	89.78
2r44_A		331	Uncharacterized protein; putative ATPase, structur	89.73
2ius_A		512	DNA translocase FTSK; nucleotide-binding, chromoso	89.73
2jaq_A		205	Deoxyguanosine kinase; transferase, deoxyribonucle	89.69
3fb4_A		216	Adenylate kinase; psychrophIle, phosphotransferase	89.62
2if2_A		204	Dephospho-COA kinase; alpha-beta protein, structur	89.6
2wwf_A		212	Thymidilate kinase, putative; transferase, malaria	89.57
3dl0_A		216	Adenylate kinase; phosphotransferase, zinc coordin	89.53
3b60_A		582	Lipid A export ATP-binding/permease protein MSBA;	89.5
3hr8_A		356	Protein RECA; alpha and beta proteins (A/B, A+B),	89.49
2rcn_A		358	Probable GTPase ENGC; YJEQ, circularly permuted, G	89.46
1zak_A		222	Adenylate kinase; ATP:AMP-phosphotransferase, tran	89.44
1nks_A		194	Adenylate kinase; thermophilic, transferase; HET:	89.39
1lv7_A		257	FTSH; alpha/beta domain, four helix bundle, hydrol	89.39
1zuh_A		168	Shikimate kinase; alpha-beta protein, transferase;	89.38
3b9p_A		297	CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc	89.37
1ofh_A		310	ATP-dependent HSL protease ATP-binding subunit HSL	89.35
3qf4_B		598	Uncharacterized ABC transporter ATP-binding prote	89.35
4eaq_A		229	DTMP kinase, thymidylate kinase; structural genomi	89.35
1nn5_A		215	Similar to deoxythymidylate kinase (thymidylate K;	89.27
1xjc_A		169	MOBB protein homolog; structural genomics, midwest	89.27
1jjv_A		206	Dephospho-COA kinase; P-loop nucleotide-binding fo	89.22
1lw7_A		365	Transcriptional regulator NADR; NMN, NMN adenylyl	89.21
3bh0_A		315	DNAB-like replicative helicase; ATPase, replicatio	89.21
2cdn_A		201	Adenylate kinase; phosphoryl transfer, associative	89.2
1via_A		175	Shikimate kinase; structural genomics, transferase	89.13
3k1j_A		604	LON protease, ATP-dependent protease LON; ATP-bind	89.12
2z43_A		324	DNA repair and recombination protein RADA; archaea	89.11
4a82_A		578	Cystic fibrosis transmembrane conductance regulat;	89.1
2vli_A		183	Antibiotic resistance protein; transferase, tunica	89.06
2zr9_A		349	Protein RECA, recombinase A; recombination, RECA m	89.06
2eyq_A		1151	TRCF, transcription-repair coupling factor; MFD, S	89.01
1g5t_A		196	COB(I)alamin adenosyltransferase; P-loop protein,	89.0
2qag_B		427	Septin-6, protein NEDD5; cell cycle, cell division	88.96
1ixz_A		254	ATP-dependent metalloprotease FTSH; AAA domain fol	88.91
1svm_A		377	Large T antigen; AAA+ fold, viral protein; HET: AT	88.87
2yl4_A		595	ATP-binding cassette SUB-family B member 10, mitoc	88.84
3qks_A		203	DNA double-strand break repair RAD50 ATPase; RECA-	88.82
1odf_A		290	YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser	88.82
1e6c_A		173	Shikimate kinase; phosphoryl transfer, ADP, shikim	88.71
1gtv_A		214	TMK, thymidylate kinase; transferase, transferase	88.68
3eph_A		409	TRNA isopentenyltransferase; transferase, alternat	88.64
2qm8_A		337	GTPase/ATPase; G protein, G3E, metallochaperone, c	88.6
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	88.47
1ukz_A		203	Uridylate kinase; transferase; HET: ADP AMP; 1.90A	88.46
2obl_A		347	ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O	88.37
1yqt_A		538	RNAse L inhibitor; ATP-binding cassette, ribosome	88.18
3be4_A		217	Adenylate kinase; malaria, cryptosporidium parvum	88.16
2z0h_A		197	DTMP kinase, thymidylate kinase; ATP-binding, nucl	88.16
2iyv_A		184	Shikimate kinase, SK; transferase, aromatic amino	88.14
4fcw_A		311	Chaperone protein CLPB; AAA domain; HET: ADP; 2.35	88.09
4tmk_A		213	Protein (thymidylate kinase); ATP:DTMP phosphotran	88.09
1pui_A		210	ENGB, probable GTP-binding protein ENGB; structura	88.08
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	88.03
1qf9_A		194	UMP/CMP kinase, protein (uridylmonophosphate/cytid	88.0
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	87.98
3qf4_A		587	ABC transporter, ATP-binding protein; multidrug tr	87.97
1ak2_A		233	Adenylate kinase isoenzyme-2; nucleoside monophosp	87.96
3ozx_A		538	RNAse L inhibitor; ATP binding cassette protein, h	87.88
3io5_A		333	Recombination and repair protein; storage dimer, i	87.85
2i1q_A		322	DNA repair and recombination protein RADA; ATPase,	87.77
1e4v_A		214	Adenylate kinase; transferase(phosphotransferase);	87.77
1sxj_D		353	Activator 1 41 kDa subunit; clamp loader, processi	87.76
2x8a_A		274	Nuclear valosin-containing protein-like; nuclear p	87.73
3nbx_X		500	ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu	87.72
2pt5_A		168	Shikimate kinase, SK; aromatic amino acid biosynth	87.72
2pbr_A		195	DTMP kinase, thymidylate kinase; transferase, nucl	87.67
1u0l_A		301	Probable GTPase ENGC; permutation, OB-fold, zinc-f	87.62
2xb4_A		223	Adenylate kinase; ATP-binding, nucleotide-binding,	87.52
4edh_A		213	DTMP kinase, thymidylate kinase; structural genomi	87.5
3cf2_A		806	TER ATPase, transitional endoplasmic reticulum ATP	87.48
2dpy_A		438	FLII, flagellum-specific ATP synthase; beta barrel	87.46
3a4m_A		260	L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m	87.38
1vht_A		218	Dephospho-COA kinase; structural genomics, transfe	87.35
1iy2_A		278	ATP-dependent metalloprotease FTSH; AAA domain fol	87.31
3v9p_A		227	DTMP kinase, thymidylate kinase; ssgcid, STRU geno	87.3
1uf9_A		203	TT1252 protein; P-loop, nucleotide binding domain,	87.28
1tue_A		212	Replication protein E1; helicase, replication, E1E	87.27
2p5t_B		253	PEZT; postsegregational killing system, phosphoryl	87.25
3cr8_A		552	Sulfate adenylyltranferase, adenylylsulfate kinase	87.21
3ozx_A		538	RNAse L inhibitor; ATP binding cassette protein, h	87.18
3bgw_A		444	DNAB-like replicative helicase; ATPase, replicatio	87.12
3auy_A		371	DNA double-strand break repair RAD50 ATPase; DNA r	87.1
2oxc_A		230	Probable ATP-dependent RNA helicase DDX20; DEAD, s	87.05
1ojl_A		304	Transcriptional regulatory protein ZRAR; response	87.04
1t6n_A		220	Probable ATP-dependent RNA helicase; RECA-like fol	87.04
3qkt_A		339	DNA double-strand break repair RAD50 ATPase; RECA-	87.04
3uk6_A		368	RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding	86.78
3ux8_A		670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	86.75
1u94_A		356	RECA protein, recombinase A; homologous recombinat	86.69
1oix_A		191	RAS-related protein RAB-11A; small G protein, intr	86.68
3lv8_A		236	DTMP kinase, thymidylate kinase; structural genomi	86.61
3ux8_A		670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	86.49
3euj_A		483	Chromosome partition protein MUKB, linker; MUKB, M	86.43
2f9l_A		199	RAB11B, member RAS oncogene family; RAB11B GTPase,	86.43
3r20_A		233	Cytidylate kinase; structural genomics, seattle st	86.27
2iw3_A		986	Elongation factor 3A; acetylation, ATP-binding, pr	86.1
3tmk_A		216	Thymidylate kinase; phosphotransferase; HET: T5A;	86.03
3d8b_A		357	Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s	85.96
3oiy_A		414	Reverse gyrase helicase domain; topoisomerase, DNA	85.84
3t15_A		293	Ribulose bisphosphate carboxylase/oxygenase activ	85.61
1vec_A		206	ATP-dependent RNA helicase P54; DEAD-box protein,	85.61
1e69_A		322	Chromosome segregation SMC protein; structural mai	85.55
1w1w_A		430	Structural maintenance of chromosome 1; cohesin, c	85.38
1xwi_A		322	SKD1 protein; VPS4B, AAA ATPase, protein transport	85.23
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	85.22
3fe2_A		242	Probable ATP-dependent RNA helicase DDX5; DEAD, AD	85.21
2www_A		349	Methylmalonic aciduria type A protein, mitochondri	85.07
1wb9_A		800	DNA mismatch repair protein MUTS; DNA-binding, ATP	84.95
1q3t_A		236	Cytidylate kinase; nucleotide monophosphate kinase	84.9
1t9h_A		307	YLOQ, probable GTPase ENGC; N-terminal beta-barrel	84.9
1um8_A		376	ATP-dependent CLP protease ATP-binding subunit CL;	84.76
4hlc_A		205	DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri	84.74
1ewq_A		765	DNA mismatch repair protein MUTS; multiple domains	84.42
2o5v_A		359	DNA replication and repair protein RECF; ABC ATPas	84.36
2grj_A		192	Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp	84.31
1xp8_A		366	RECA protein, recombinase A; recombination, radior	84.3
2dyk_A		161	GTP-binding protein; GTPase, ribosome-binding prot	84.28
2vhj_A		331	Ntpase P4, P4; non- hydrolysable ATP analogue, hyd	84.24
3m6a_A		543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	84.15
2l8b_A		189	Protein TRAI, DNA helicase I; RECD, hydrolase; NMR	84.12
3pxg_A		468	Negative regulator of genetic competence CLPC/MEC;	84.05
3thx_B		918	DNA mismatch repair protein MSH3; ABC family ATPas	84.05
3ice_A		422	Transcription termination factor RHO; transcriptio	84.02
2gj8_A		172	MNME, tRNA modification GTPase TRME; G-domain dime	84.0
4aby_A		415	DNA repair protein RECN; hydrolase, double strand	83.97
1qde_A		224	EIF4A, translation initiation factor 4A; DEAD box	83.92
3bor_A		237	Human initiation factor 4A-II; translation initiat	83.84
2wji_A		165	Ferrous iron transport protein B homolog; membrane	83.81
2ce2_X		166	GTPase HRAS; signaling protein, guanine nucleotide	83.8
1z2a_A		168	RAS-related protein RAB-23; RAB GTPase, vesicular	83.7
2c9o_A		456	RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-	83.66
3ber_A		249	Probable ATP-dependent RNA helicase DDX47; DEAD, A	83.6
3im1_A		328	Protein SNU246, PRE-mRNA-splicing helicase BRR2; A	83.34
2ged_A		193	SR-beta, signal recognition particle receptor beta	83.33
1qhl_A		227	Protein (cell division protein MUKB); SMC, chromos	83.28
1ltq_A		301	Polynucleotide kinase; phosphatase, alpha/beta, P-	83.26
3ake_A		208	Cytidylate kinase; CMP kinase, CMP complex, open c	83.13
4b4t_J		405	26S protease regulatory subunit 8 homolog; hydrola	82.91
4b4t_H		467	26S protease regulatory subunit 7 homolog; hydrola	82.89
1ky3_A		182	GTP-binding protein YPT7P; vesicular traffic, GTP	82.88
2ocp_A		241	DGK, deoxyguanosine kinase; protein-nucleotide com	82.78
3thx_A		934	DNA mismatch repair protein MSH2; ABC family ATPas	82.75
1z0j_A		170	RAB-22, RAS-related protein RAB-22A; RAB GTPase, R	82.7
2v1x_A		591	ATP-dependent DNA helicase Q1; DNA strand annealin	82.69
1q57_A		503	DNA primase/helicase; dntpase, DNA replication, tr	82.63
3tqf_A		181	HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co	82.62
2r62_A		268	Cell division protease FTSH homolog; ATPase domain	82.58
1uj2_A		252	Uridine-cytidine kinase 2; alpha/beta mononucleoti	82.53
1g8p_A		350	Magnesium-chelatase 38 kDa subunit; parallel beta	82.52
1kao_A		167	RAP2A; GTP-binding protein, small G protein, GDP,	82.52
1a7j_A		290	Phosphoribulokinase; transferase, calvin cycle; 2.	82.52
1ek0_A		170	Protein (GTP-binding protein YPT51); vesicular tra	82.48
1g16_A		170	RAS-related protein SEC4; G protein RAB, signaling	82.29
1u8z_A		168	RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH	82.28
2wjg_A		188	FEOB, ferrous iron transport protein B homolog; me	82.28
1c9k_A		180	COBU, adenosylcobinamide kinase; alpha/beta struct	82.28
2iut_A		574	DNA translocase FTSK; nucleotide-binding, chromoso	82.22
2p67_A		341	LAO/AO transport system kinase; ARGK, structural G	82.13
2f6r_A		281	COA synthase, bifunctional coenzyme A synthase; 18	82.07
1u0j_A		267	DNA replication protein; AAA+ protein, P-loop atpa	82.04
2iw3_A		986	Elongation factor 3A; acetylation, ATP-binding, pr	81.91
2erx_A		172	GTP-binding protein DI-RAS2; GTP hydrolysis, trans	81.9
1wms_A		177	RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p	81.86
3ld9_A		223	DTMP kinase, thymidylate kinase; ssgcid, NIH, niai	81.81
1svi_A		195	GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro	81.74
2zan_A		444	Vacuolar protein sorting-associating protein 4B; S	81.68
1c1y_A		167	RAS-related protein RAP-1A; GTP-binding proteins,	81.53
2zej_A		184	Dardarin, leucine-rich repeat kinase 2; parkinson'	81.51

>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B*	Back alignment and structure

Probab=100.00  E-value=2e-75  Score=647.13  Aligned_cols=489  Identities=48%  Similarity=0.786  Sum_probs=441.1

Q ss_pred             CCCCCCC-hhHHHHHHHhhcCCCcHHHHHHHHHHHhcCCeEEEEcCCCCchhhHHHHHHHhccccCC-CcEEEEeCccHH
Q 008735           21 KPFFNDS-SSRRQKILQQRKSLPIASVEKRLVEEVRKNDILIIVGETGSGKTTQLPQFLFHAGFCRD-GKLIGVTQPRRV   98 (555)
Q Consensus        21 ~~~~~~~-~~~~~~~~~~~~~l~~~~~Q~~~i~~i~~~~~~ii~apTGsGKT~~l~~~i~~~~~~~~-~~~i~~~~P~r~   98 (555)
                      .+|..+. ++.+.+.+.+++.+|++.+|+++...+..+++++++||||||||+++|+++.......+ +..+++++|+++
T Consensus        72 ~~f~~~~l~~~~~~~l~~r~~lP~~~q~~~i~~~l~~~~~vii~gpTGSGKTtllp~ll~~~~~~~~~g~~ilvl~P~r~  151 (773)
T 2xau_A           72 NPFTGREFTPKYVDILKIRRELPVHAQRDEFLKLYQNNQIMVFVGETGSGKTTQIPQFVLFDEMPHLENTQVACTQPRRV  151 (773)
T ss_dssp             CTTTCSBCCHHHHHHHHHHTTSGGGGGHHHHHHHHHHCSEEEEECCTTSSHHHHHHHHHHHHHCGGGGTCEEEEEESCHH
T ss_pred             CCccccCCCHHHHHHHHHhhcCChHHHHHHHHHHHhCCCeEEEECCCCCCHHHHHHHHHHHhccccCCCceEEecCchHH
Confidence            4566655 66788899999999999999999999999999999999999999999999877654332 557999999999


Q ss_pred             HHHHHHHHHHHHhCCccCCEEEEEEecCCCCCch---------hhHHHhhcCCCCCCCceeEeecccccccchhHHHHHH
Q 008735           99 AAVTVAKRVAEESGVELGQRVGYSIRFDDRTSTS---------TRIKEALLDPYLSRYSAIIVDEAHERTVHTDVLLGLL  169 (555)
Q Consensus        99 l~~~~~~~~~~~~~~~~~~~vg~~~~~~~~~~~~---------~~i~~~~~~~~l~~~~~iIiDE~He~~~~~d~ll~~l  169 (555)
                      ++.+++++++..++..++..+||..+++......         .....++.++.+.++++||+||+|+|..+.+.++.++
T Consensus       152 La~q~~~~l~~~~~~~v~~~vG~~i~~~~~~~~~~~I~v~T~G~l~r~l~~~~~l~~~~~lIlDEah~R~ld~d~~~~~l  231 (773)
T 2xau_A          152 AAMSVAQRVAEEMDVKLGEEVGYSIRFENKTSNKTILKYMTDGMLLREAMEDHDLSRYSCIILDEAHERTLATDILMGLL  231 (773)
T ss_dssp             HHHHHHHHHHHHTTCCBTTTEEEEETTEEECCTTCSEEEEEHHHHHHHHHHSTTCTTEEEEEECSGGGCCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhCCchhheecceeccccccCCCCCEEEECHHHHHHHHhhCccccCCCEEEecCccccccchHHHHHHH
Confidence            9999999999999989999999887654433222         2223556678899999999999999999999999999


Q ss_pred             HHHHHhhcccccCCCCCCCCCCcchhhhccCCCCcccchhhhccccCCCCceEEEeccCCCHHHHHhhhCCCCeEEeCCc
Q 008735          170 KKVQNARSKSADGHSNGNNNNENSDMILDRGNDTNGINTLKQCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGR  249 (555)
Q Consensus       170 ~~~~~~~~~~~~~~~~~~~~~~~~d~~l~~~~~~~~~~~l~~~~~~~~~~~~ii~~SAT~~~~~~~~~~~~~~~~~~~~~  249 (555)
                      +.+...+                                         ++.++|+||||++.+.+++|+++.+++.++++
T Consensus       232 ~~l~~~~-----------------------------------------~~~~iIl~SAT~~~~~l~~~~~~~~vi~v~gr  270 (773)
T 2xau_A          232 KQVVKRR-----------------------------------------PDLKIIIMSATLDAEKFQRYFNDAPLLAVPGR  270 (773)
T ss_dssp             HHHHHHC-----------------------------------------TTCEEEEEESCSCCHHHHHHTTSCCEEECCCC
T ss_pred             HHHHHhC-----------------------------------------CCceEEEEeccccHHHHHHHhcCCCcccccCc
Confidence            9988776                                         78899999999999999999999999999999


Q ss_pred             cccceEEEcCCCCCChHHHHHHHHHHHHhcCCCCcEEEEcCCHHHHHHHHHHHHHHhhcC--CCCCCCeEEEEecCCCCH
Q 008735          250 QFPVEILYTLYPEPDYLDATLITIFQVHLDEAPGDILVFLTGQEEIESVERLVQERLLQL--PEASRKLVTVPIFSSLPS  327 (555)
Q Consensus       250 ~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iLVF~~t~~~~~~l~~~L~~~~~~~--~~~~~~~~v~~lh~~l~~  327 (555)
                      .++++.+|...+..++....+..+..++....++++||||+++++++.+++.|.+.+..+  .....++.+.++||+|+.
T Consensus       271 ~~pv~~~~~~~~~~~~~~~~l~~l~~~~~~~~~g~iLVF~~~~~~i~~l~~~L~~~~~~l~~~~~~~~~~v~~lhg~l~~  350 (773)
T 2xau_A          271 TYPVELYYTPEFQRDYLDSAIRTVLQIHATEEAGDILLFLTGEDEIEDAVRKISLEGDQLVREEGCGPLSVYPLYGSLPP  350 (773)
T ss_dssp             CCCEEEECCSSCCSCHHHHHHHHHHHHHHHSCSCEEEEECSCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEECTTCCH
T ss_pred             ccceEEEEecCCchhHHHHHHHHHHHHHHhcCCCCEEEECCCHHHHHHHHHHHHHHHHhhcccccCCCeEEEEeCCCCCH
Confidence            999999999988888888888888888877778999999999999999999998643221  112237899999999999


Q ss_pred             HHHHhhcCcCC-----CCCcEEEEecCccccccccCCeEEEEeCCcccceeecCCCCccccceeecCHHhHHHHhcccCC
Q 008735          328 EQQMRVFAPAA-----AGFRKVILATNIAETSVTIPGIKYVIDPGFVKARLYDPVKGMESLLVVPISKAQALQRSGRAGR  402 (555)
Q Consensus       328 ~~r~~i~~~f~-----~g~~~vlvaT~~~e~Gvdip~v~~VId~g~~~~~~yd~~~~~~~l~~~p~s~~~~~Qr~GRaGR  402 (555)
                      ++|.++++.|+     +|.++||||||++|+|||+|+|++|||+|+.+.+.||+..|+..+...|+|.++|.||+|||||
T Consensus       351 ~eR~~v~~~f~~~~~~~g~~kVlVAT~iae~GidIp~v~~VId~g~~k~~~yd~~~g~~~L~~~p~S~~s~~QR~GRaGR  430 (773)
T 2xau_A          351 HQQQRIFEPAPESHNGRPGRKVVISTNIAETSLTIDGIVYVVDPGFSKQKVYNPRIRVESLLVSPISKASAQQRAGRAGR  430 (773)
T ss_dssp             HHHGGGGSCCCCCSSSSCCEEEEEECTHHHHTCCCTTEEEEEECSEEEEEEEETTTTEEEEEEEECCHHHHHHHHHGGGS
T ss_pred             HHHHHHHhhcccccCCCCceEEEEeCcHHHhCcCcCCeEEEEeCCCccceeeccccCccccccccCCHHHHHhhccccCC
Confidence            99999999999     9999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCEEEEccChhhH-hcccCCCCCcccccCchHHHHHHhhcCCCCccCCcCCCCCcHHHHHHHHHHHHHcCCccCCCCC
Q 008735          403 EGPGKCFRLYPENEF-DKLEDSTKPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRASIIKSLEQLFLLGALTDDCKL  481 (555)
Q Consensus       403 ~~~G~~~~l~~~~~~-~~~~~~~~pei~~~~l~~~~l~l~~~~~~~~~~~~~~~~p~~~~~~~al~~L~~~g~l~~~~~~  481 (555)
                      .++|.||+||+++++ +.+.+...|||.+.+|..++|+++.+|+.++..|+|++||+.+.+..|++.|..+|+||++|++
T Consensus       431 ~~~G~~~~l~~~~~~~~~l~~~~~pEi~r~~L~~~~L~l~~~gi~~~~~f~~~~~p~~~~i~~a~~~L~~lgald~~~~l  510 (773)
T 2xau_A          431 TRPGKCFRLYTEEAFQKELIEQSYPEILRSNLSSTVLELKKLGIDDLVHFDFMDPPAPETMMRALEELNYLACLDDEGNL  510 (773)
T ss_dssp             SSSEEEEESSCHHHHHHTSCSSCCCGGGGSCCHHHHHHHHHTTCCCGGGCCCSSCCCHHHHHHHHHHHHHTTSBCTTSCB
T ss_pred             CCCCEEEEEecHHHhcccccccCCCccccCcHHHHHHHHHHcCCCChhhccccCCCcHHHHHHHHHHHHHcCCcccCCCc
Confidence            999999999999999 5699999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHhhcccCCCChHHHHHHHHhhhcCCHHHHHHHHHhhcCCCcccCChhhHHHHHHHhhhccCCCCCCCC
Q 008735          482 SDPVGHQMARLPLDPIYSKALIVAGQFNCLEEMLITVAMLSVESIFFRSPGEVRRGKKCNEIFCKSRWRSPH  553 (555)
Q Consensus       482 T~~lG~~~~~~~~~~~~~~~l~~~~~~~~~~~~l~i~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  553 (555)
                      |+ +|+.|+.+|++|++|++|+.+..++|++++++|+|+|+++++|..|.++++.++.+|++|.+..  |||
T Consensus       511 T~-lG~~~a~~pl~p~~~~~l~~~~~~~c~~~~l~i~a~ls~~~~f~~~~~~~~~~~~~~~~f~~~~--~D~  579 (773)
T 2xau_A          511 TP-LGRLASQFPLDPMLAVMLIGSFEFQCSQEILTIVAMLSVPNVFIRPTKDKKRADDAKNIFAHPD--GDH  579 (773)
T ss_dssp             CH-HHHHHTTSSSCHHHHHHHHHGGGGTCHHHHHHHHHHHTSCCCBCCCTTCHHHHHHHHHTTCCTT--BHH
T ss_pred             Ch-hhhhhccccCCHHHHHHHHhhcccCchhHHHHHHHhcccCCcccCChHHHHHHHHHHHhccCCC--CcH
Confidence            97 9999999999999999999999999999999999999999999999999999999999997543  555

PyMOL of 2xau

>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus}	Back alignment and structure

>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A	Back alignment and structure

>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A*	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B	Back alignment and structure

>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster}	Back alignment and structure

>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B	Back alignment and structure

>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens}	Back alignment and structure

>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A*	Back alignment and structure

>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens}	Back alignment and structure

>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A*	Back alignment and structure

>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A	Back alignment and structure

>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A	Back alignment and structure

>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A	Back alignment and structure

>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens}	Back alignment and structure

>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A*	Back alignment and structure

>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A	Back alignment and structure

>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae}	Back alignment and structure

>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A*	Back alignment and structure

>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C}	Back alignment and structure

>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ...	Back alignment and structure

>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A	Back alignment and structure

>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A	Back alignment and structure

>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A*	Back alignment and structure

>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A	Back alignment and structure

>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A	Back alignment and structure

>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A*	Back alignment and structure

>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A*	Back alignment and structure

>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus}	Back alignment and structure

>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A	Back alignment and structure

>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A*	Back alignment and structure

>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus}	Back alignment and structure

>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos}	Back alignment and structure

>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1	Back alignment and structure

>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19	Back alignment and structure

>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos}	Back alignment and structure

>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A	Back alignment and structure

>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens}	Back alignment and structure

>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A*	Back alignment and structure

>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B*	Back alignment and structure

>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4}	Back alignment and structure

>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A	Back alignment and structure

>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus}	Back alignment and structure

>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A*	Back alignment and structure

>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A	Back alignment and structure

>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A	Back alignment and structure

>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12}	Back alignment and structure

>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus}	Back alignment and structure

>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A*	Back alignment and structure

>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens}	Back alignment and structure

>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A*	Back alignment and structure

>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A	Back alignment and structure

>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B*	Back alignment and structure

>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens}	Back alignment and structure

>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis}	Back alignment and structure

>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19	Back alignment and structure

>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens}	Back alignment and structure

>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens}	Back alignment and structure

>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B*	Back alignment and structure

>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae}	Back alignment and structure

>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli}	Back alignment and structure

>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens}	Back alignment and structure

>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A*	Back alignment and structure

>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A	Back alignment and structure

>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens}	Back alignment and structure

>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19	Back alignment and structure

>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens}	Back alignment and structure

>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens}	Back alignment and structure

>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A*	Back alignment and structure

>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A	Back alignment and structure

>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens}	Back alignment and structure

>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A	Back alignment and structure

>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens}	Back alignment and structure

>3i4u_A ATP-dependent RNA helicase DHX8; splicing, ATP-binding, hydrolase, mRNA processing, splicing, nucleotide-binding, nucleus, phosphoprotein, SPLI; 2.10A {Homo sapiens}	Back alignment and structure

>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19	Back alignment and structure

>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus}	Back alignment and structure

>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens}	Back alignment and structure

>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii}	Back alignment and structure

>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19	Back alignment and structure

>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19	Back alignment and structure

>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23	Back alignment and structure

>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1*	Back alignment and structure

>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D*	Back alignment and structure

>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A*	Back alignment and structure

>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4}	Back alignment and structure

>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A*	Back alignment and structure

>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A*	Back alignment and structure

>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A*	Back alignment and structure

>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A*	Back alignment and structure

>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A*	Back alignment and structure

>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A*	Back alignment and structure

>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B}	Back alignment and structure

>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A	Back alignment and structure

>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A*	Back alignment and structure

>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A	Back alignment and structure

>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A	Back alignment and structure

>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae}	Back alignment and structure

>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A*	Back alignment and structure

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}	Back alignment and structure

>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A	Back alignment and structure

>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426}	Back alignment and structure

>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A*	Back alignment and structure

>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10	Back alignment and structure

>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus}	Back alignment and structure

>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A*	Back alignment and structure

>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A	Back alignment and structure

>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A*	Back alignment and structure

>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A	Back alignment and structure

>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032}	Back alignment and structure

>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*	Back alignment and structure

>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A*	Back alignment and structure

>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus}	Back alignment and structure

>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus}	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58}	Back alignment and structure

>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii}	Back alignment and structure

>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A*	Back alignment and structure

>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A*	Back alignment and structure

>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana}	Back alignment and structure

>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14	Back alignment and structure

>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi}	Back alignment and structure

>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A*	Back alignment and structure

>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A*	Back alignment and structure

>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix}	Back alignment and structure

>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12}	Back alignment and structure

>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A*	Back alignment and structure

>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana}	Back alignment and structure

>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus}	Back alignment and structure

>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens}	Back alignment and structure

>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A	Back alignment and structure

>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus}	Back alignment and structure

>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A	Back alignment and structure

>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B*	Back alignment and structure

>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii}	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A*	Back alignment and structure

>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D*	Back alignment and structure

>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus}	Back alignment and structure

>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum}	Back alignment and structure

>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1	Back alignment and structure

>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens}	Back alignment and structure

>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis}	Back alignment and structure

>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A*	Back alignment and structure

>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A	Back alignment and structure

>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A*	Back alignment and structure

>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus}	Back alignment and structure

>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A	Back alignment and structure

>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C	Back alignment and structure

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25	Back alignment and structure

>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus}	Back alignment and structure

>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1	Back alignment and structure

>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A*	Back alignment and structure

>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B*	Back alignment and structure

>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp}	Back alignment and structure

>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20	Back alignment and structure

>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A*	Back alignment and structure

>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes}	Back alignment and structure

>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A	Back alignment and structure

>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E*	Back alignment and structure

>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0	Back alignment and structure

>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A*	Back alignment and structure

>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19	Back alignment and structure

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}	Back alignment and structure

>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A	Back alignment and structure

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli}	Back alignment and structure

>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124}	Back alignment and structure

>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum}	Back alignment and structure

>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}	Back alignment and structure

>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F	Back alignment and structure

>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli}	Back alignment and structure

>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus}	Back alignment and structure

>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12	Back alignment and structure

>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A	Back alignment and structure

>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A	Back alignment and structure

>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis}	Back alignment and structure

>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A	Back alignment and structure

>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A*	Back alignment and structure

>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12	Back alignment and structure

>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B*	Back alignment and structure

>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A*	Back alignment and structure

>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP}	Back alignment and structure

>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C*	Back alignment and structure

>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A*	Back alignment and structure

>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A*	Back alignment and structure

>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J*	Back alignment and structure

>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A*	Back alignment and structure

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae}	Back alignment and structure

>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}	Back alignment and structure

>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A*	Back alignment and structure

>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12	Back alignment and structure

>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus}	Back alignment and structure

>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C	Back alignment and structure

>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A	Back alignment and structure

>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP}	Back alignment and structure

>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*	Back alignment and structure

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*	Back alignment and structure

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}	Back alignment and structure

>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}	Back alignment and structure

>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A*	Back alignment and structure

>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11	Back alignment and structure

>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima}	Back alignment and structure

>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A*	Back alignment and structure

>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A*	Back alignment and structure

>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae}	Back alignment and structure

>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11	Back alignment and structure

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2	Back alignment and structure

>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax}	Back alignment and structure

>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii}	Back alignment and structure

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25	Back alignment and structure

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*	Back alignment and structure

>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius}	Back alignment and structure

>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A	Back alignment and structure

>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A*	Back alignment and structure

>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A*	Back alignment and structure

>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori}	Back alignment and structure

>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima}	Back alignment and structure

>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A*	Back alignment and structure

>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A*	Back alignment and structure

>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12	Back alignment and structure

>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii}	Back alignment and structure

>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A	Back alignment and structure

>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A*	Back alignment and structure

>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A*	Back alignment and structure

>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A	Back alignment and structure

>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A*	Back alignment and structure

>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum}	Back alignment and structure

>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C	Back alignment and structure

>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12	Back alignment and structure

>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A	Back alignment and structure

>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens}	Back alignment and structure

>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii}	Back alignment and structure

>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus}	Back alignment and structure

>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19	Back alignment and structure

>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A*	Back alignment and structure

>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20	Back alignment and structure

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii}	Back alignment and structure

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A*	Back alignment and structure

>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A	Back alignment and structure

>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A*	Back alignment and structure

>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A	Back alignment and structure

>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A	Back alignment and structure

>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii}	Back alignment and structure

>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X*	Back alignment and structure

>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B*	Back alignment and structure

>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus}	Back alignment and structure

>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni}	Back alignment and structure

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A*	Back alignment and structure

>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B	Back alignment and structure

>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A*	Back alignment and structure

>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens}	Back alignment and structure

>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1	Back alignment and structure

>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A	Back alignment and structure

>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9	Back alignment and structure

>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A*	Back alignment and structure

>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus}	Back alignment and structure

>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis}	Back alignment and structure

>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3}	Back alignment and structure

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A	Back alignment and structure

>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A*	Back alignment and structure

>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A	Back alignment and structure

>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6	Back alignment and structure

>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1	Back alignment and structure

>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A*	Back alignment and structure

>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A*	Back alignment and structure

>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A*	Back alignment and structure

>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A	Back alignment and structure

>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A*	Back alignment and structure

>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae}	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*	Back alignment and structure

>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1	Back alignment and structure

>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A	Back alignment and structure

>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A*	Back alignment and structure

>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti}	Back alignment and structure

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus}	Back alignment and structure

>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A*	Back alignment and structure

>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11	Back alignment and structure

>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A*	Back alignment and structure

>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A*	Back alignment and structure

>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A*	Back alignment and structure

>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum}	Back alignment and structure

>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A*	Back alignment and structure

>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens}	Back alignment and structure

>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii}	Back alignment and structure

>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix}	Back alignment and structure

>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli}	Back alignment and structure

>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae}	Back alignment and structure

>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A	Back alignment and structure

>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A	Back alignment and structure

>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus}	Back alignment and structure

>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228}	Back alignment and structure

>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A	Back alignment and structure

>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A*	Back alignment and structure

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}	Back alignment and structure

>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana}	Back alignment and structure

>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B*	Back alignment and structure

>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A*	Back alignment and structure

>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A	Back alignment and structure

>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A*	Back alignment and structure

>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A*	Back alignment and structure

>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A*	Back alignment and structure

>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus}	Back alignment and structure

>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus}	Back alignment and structure

>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A*	Back alignment and structure

>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A*	Back alignment and structure

>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A	Back alignment and structure

>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}	Back alignment and structure

>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V	Back alignment and structure

>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1	Back alignment and structure

>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1	Back alignment and structure

>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20	Back alignment and structure

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A*	Back alignment and structure

>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster}	Back alignment and structure

>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A*	Back alignment and structure

>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}	Back alignment and structure

>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A	Back alignment and structure

>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A*	Back alignment and structure

>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10	Back alignment and structure

>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1	Back alignment and structure

>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1	Back alignment and structure

>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1}	Back alignment and structure

>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A	Back alignment and structure

>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2	Back alignment and structure

>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus}	Back alignment and structure

>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A*	Back alignment and structure

>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A	Back alignment and structure

>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans}	Back alignment and structure

>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ...	Back alignment and structure

>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1	Back alignment and structure

>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A*	Back alignment and structure

>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens}	Back alignment and structure

>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A*	Back alignment and structure

>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A	Back alignment and structure

>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A*	Back alignment and structure

>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6	Back alignment and structure

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A*	Back alignment and structure

>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A*	Back alignment and structure

>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A*	Back alignment and structure

>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A*	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A*	Back alignment and structure

>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A*	Back alignment and structure

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}	Back alignment and structure

>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II}	Back alignment and structure

>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A*	Back alignment and structure

>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A*	Back alignment and structure

>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A*	Back alignment and structure

>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A*	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}	Back alignment and structure

>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A*	Back alignment and structure

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}	Back alignment and structure

>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4}	Back alignment and structure

>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A*	Back alignment and structure

>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A*	Back alignment and structure

>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20	Back alignment and structure

>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens}	Back alignment and structure

>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli}	Back alignment and structure

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus}	Back alignment and structure

>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus}	Back alignment and structure

>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8	Back alignment and structure

>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A*	Back alignment and structure

>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A*	Back alignment and structure

>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A*	Back alignment and structure

>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium}	Back alignment and structure

>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A*	Back alignment and structure

>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A	Back alignment and structure

>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20	Back alignment and structure

>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis}	Back alignment and structure

>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1	Back alignment and structure

>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20	Back alignment and structure

>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae}	Back alignment and structure

>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans}	Back alignment and structure

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}	Back alignment and structure

>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1}	Back alignment and structure

>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B*	Back alignment and structure

>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A*	Back alignment and structure

>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium}	Back alignment and structure

>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B	Back alignment and structure

>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D*	Back alignment and structure

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}	Back alignment and structure

>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A	Back alignment and structure

>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B*	Back alignment and structure

>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A*	Back alignment and structure

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}	Back alignment and structure

>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A*	Back alignment and structure

>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A*	Back alignment and structure

>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A*	Back alignment and structure

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A	Back alignment and structure

>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A*	Back alignment and structure

>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens}	Back alignment and structure

>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A*	Back alignment and structure

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A	Back alignment and structure

>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19	Back alignment and structure

>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12	Back alignment and structure

>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens}	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A	Back alignment and structure

>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens}	Back alignment and structure

>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A*	Back alignment and structure

>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1	Back alignment and structure

>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8	Back alignment and structure

>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20	Back alignment and structure

>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A*	Back alignment and structure

>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A*	Back alignment and structure

>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans}	Back alignment and structure

>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima}	Back alignment and structure

>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1	Back alignment and structure

>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus}	Back alignment and structure

>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A*	Back alignment and structure

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A	Back alignment and structure

>2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli}	Back alignment and structure

>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis}	Back alignment and structure

>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B*	Back alignment and structure

>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A	Back alignment and structure

>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A	Back alignment and structure

>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans}	Back alignment and structure

>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A	Back alignment and structure

>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A*	Back alignment and structure

>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A*	Back alignment and structure

>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ...	Back alignment and structure

>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A*	Back alignment and structure

>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A*	Back alignment and structure

>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens}	Back alignment and structure

>3im1_A Protein SNU246, PRE-mRNA-splicing helicase BRR2; ATPase, RNA helicase, rnpase, RNA unwindase, molecular model mRNA splicing; 1.65A {Saccharomyces cerevisiae} PDB: 3im2_A* 3hib_A	Back alignment and structure

>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12	Back alignment and structure

>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A	Back alignment and structure

>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A*	Back alignment and structure

>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A*	Back alignment and structure

>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1	Back alignment and structure

>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A*	Back alignment and structure

>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A*	Back alignment and structure

>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A*	Back alignment and structure

>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2	Back alignment and structure

>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii}	Back alignment and structure

>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A*	Back alignment and structure

>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A*	Back alignment and structure

>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G	Back alignment and structure

>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R*	Back alignment and structure

>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6	Back alignment and structure

>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8	Back alignment and structure

>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A	Back alignment and structure

>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A*	Back alignment and structure

>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii}	Back alignment and structure

>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A	Back alignment and structure

>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A*	Back alignment and structure

>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10	Back alignment and structure

>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus}	Back alignment and structure

>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A	Back alignment and structure

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A	Back alignment and structure

>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8	Back alignment and structure

>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A*	Back alignment and structure

>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis}	Back alignment and structure

>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A*	Back alignment and structure

>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A	Back alignment and structure

>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D*	Back alignment and structure

>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		555
d1yksa2		299	c.37.1.14 (A:325-623) YFV helicase domain {Yellow	1e-39
d2bmfa2		305	c.37.1.14 (A:178-482) Dengue virus helicase {Dengu	1e-39
d1a1va1		136	c.37.1.14 (A:190-325) HCV helicase domain {Human h	2e-22
d1yksa1		140	c.37.1.14 (A:185-324) YFV helicase domain {Yellow	8e-11
d1wp9a2		286	c.37.1.19 (A:201-486) putative ATP-dependent RNA h	3e-06
d2fwra1		200	c.37.1.19 (A:257-456) DNA repair protein RAD25 {Ar	8e-04

>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: YFV helicase domain
species: Yellow fever virus [TaxId: 11089]

 Score =  144 bits (364), Expect = 1e-39
 Identities = 39/260 (15%), Positives = 80/260 (30%), Gaps = 26/260 (10%)

Query: 280 EAPGDILVFLTGQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAA 339
                   FL        +   +++    +         V +       +   +      
Sbjct: 34  ADKRPTAWFLPSIRAANVMAASLRKAGKSV---------VVLNRKTFEREYPTIKQKK-- 82

Query: 340 GFRKVILATNIAETSVTIPGIKYVIDPGF-VKARLYDPVKGMESLLVVPISKAQALQRSG 398
                ILAT+IAE    +  ++ V+D     K  L D  + +     + IS + A QR G
Sbjct: 83  --PDFILATDIAEMGANL-CVERVLDCRTAFKPVLVDEGRKVAIKGPLRISASSAAQRRG 139

Query: 399 RAGREGPGKCFR--LYPENEFDKLEDSTKPEIKRCNLSNVILQLKALGVDDIIGFDFMEK 456
           R GR  P +      Y E   +              L N+ ++   +     +       
Sbjct: 140 RIGR-NPNRDGDSYYYSEPTSENNAHHVCWLEASMLLDNMEVRGGMVAPLYGVEGTKTPV 198

Query: 457 PSRASIIKSLEQLFLLGALTDDCKLSDPVGHQMARLPLDPIYSKALIVAGQFNCLEEMLI 516
                 ++  ++      +  +C L   +  Q+A+  L     K      + + +     
Sbjct: 199 SPGEMRLRDDQRKVFRELV-RNCDLPVWLSWQVAKAGLKTNDRKWCFEGPEEHEILNDS- 256

Query: 517 TVAMLSVESIFFRSPGEVRR 536
                  E++  R+PG  ++
Sbjct: 257 ------GETVKCRAPGGAKK 270

PyMOL of d1yksa2

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136	Back information, alignment and structure

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 140	Back information, alignment and structure

>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286	Back information, alignment and structure

>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 200	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		555
d2bmfa2		305	Dengue virus helicase {Dengue virus type 2 [TaxId:	100.0
d1yksa2		299	YFV helicase domain {Yellow fever virus [TaxId: 11	99.91
d1oywa3		200	RecQ helicase domain {Escherichia coli [TaxId: 562	99.89
d1c4oa2		174	Nucleotide excision repair enzyme UvrB {Thermus th	99.89
d1fuka_		162	Initiation factor 4a {Baker's yeast (Saccharomyces	99.89
d2j0sa2		168	Probable ATP-dependent RNA helicase DDX48 {Human (	99.89
d1hv8a2		155	Putative DEAD box RNA helicase {Archaeon Methanoco	99.89
d1s2ma2		171	Putative ATP-dependent RNA helicase DHH1 {Baker's	99.89
d2rb4a1		168	ATP-dependent RNA helicase DDX25 {Human (Homo sapi	99.88
d1t5la2		181	Nucleotide excision repair enzyme UvrB {Bacillus c	99.88
d1t5ia_		168	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	99.87
d1jr6a_		138	HCV helicase domain {Human hepatitis C virus (HCV)	99.84
d2p6ra4		201	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	99.84
d2j0sa1		222	Probable ATP-dependent RNA helicase DDX48 {Human (	99.78
d1veca_		206	DEAD box RNA helicase rck/p54 {Human (Homo sapiens	99.78
d2p6ra3		202	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	99.78
d1hv8a1		208	Putative DEAD box RNA helicase {Archaeon Methanoco	99.78
d2g9na1		218	Initiation factor 4a {Human (Homo sapiens) [TaxId:	99.76
d1t6na_		207	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	99.76
d1qdea_		212	Initiation factor 4a {Baker's yeast (Saccharomyces	99.76
d1wp9a2		286	putative ATP-dependent RNA helicase PF2015 {Pyroco	99.75
d1wrba1		238	putative ATP-dependent RNA helicase VlgB {Flatworm	99.73
d1a1va2		299	HCV helicase domain {Human hepatitis C virus (HCV)	99.71
d1q0ua_		209	Probable DEAD box RNA helicase YqfR {Bacillus stea	99.7
d1a1va1		136	HCV helicase domain {Human hepatitis C virus (HCV)	99.69
d1s2ma1		206	Putative ATP-dependent RNA helicase DHH1 {Baker's	99.69
d2eyqa5		211	Transcription-repair coupling factor, TRCF {Escher	99.67
d1gm5a4		206	RecG helicase domain {Thermotoga maritima [TaxId:	99.66
d1oywa2		206	RecQ helicase domain {Escherichia coli [TaxId: 562	99.64
d1gkub1		237	Helicase-like "domain" of reverse gyrase {Archaeon	99.63
d1wp9a1		200	putative ATP-dependent RNA helicase PF2015 {Pyroco	99.6
d1yksa1		140	YFV helicase domain {Yellow fever virus [TaxId: 11	99.59
d2fwra1		200	DNA repair protein RAD25 {Archaeoglobus fulgidus [	99.55
d1gkub2		248	Helicase-like "domain" of reverse gyrase {Archaeon	99.5
d2fz4a1		206	DNA repair protein RAD25 {Archaeoglobus fulgidus [	99.5
d2eyqa3		233	Transcription-repair coupling factor, TRCF {Escher	99.38
d1rifa_		282	DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]	99.36
d1gm5a3		264	RecG helicase domain {Thermotoga maritima [TaxId:	99.33
d1z3ix1		346	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	99.01
d1tf5a4		175	Translocation ATPase SecA, nucleotide-binding doma	98.87
d1z5za1		244	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	98.84
d1nkta4		219	Translocation ATPase SecA, nucleotide-binding doma	98.14
d1z3ix2		298	Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI	97.97
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	97.94
d1z63a1		230	Helicase of the SNF2/Rad54 hamily {Sulfolobus solf	97.81
d1okkd2		207	GTPase domain of the signal recognition particle r	97.75
d2qy9a2		211	GTPase domain of the signal recognition particle r	97.66
d1ls1a2		207	GTPase domain of the signal sequence recognition p	97.65
d1vmaa2		213	GTPase domain of the signal recognition particle r	97.65
d1j8yf2		211	GTPase domain of the signal sequence recognition p	97.5
d1tf5a3		273	Translocation ATPase SecA, nucleotide-binding doma	97.12
d1sgwa_		200	Putative ABC transporter PF0895 {Pyrococcus furios	97.01
d1uaaa1		306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	96.99
d1v43a3		239	Hypothetical protein PH0022, N-terminal domain {Py	96.86
d1l2ta_		230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	96.84
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	96.8
d1gm5a3		264	RecG helicase domain {Thermotoga maritima [TaxId:	96.76
d2awna2		232	Maltose transport protein MalK, N-terminal domain	96.76
d1g2912		240	Maltose transport protein MalK, N-terminal domain	96.66
d1pjra1		318	DEXX box DNA helicase {Bacillus stearothermophilus	96.56
d2eyqa3		233	Transcription-repair coupling factor, TRCF {Escher	96.53
d2pmka1		241	Haemolysin B ATP-binding protein {Escherichia coli	96.47
d1nkta3		288	Translocation ATPase SecA, nucleotide-binding doma	96.32
d1oxxk2		242	Glucose transport protein GlcV, N-terminal domain	96.3
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	96.18
d1g6oa_		323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	95.99
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	95.93
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	95.72
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	95.68
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	95.59
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	95.54
g1qhh.1		623	DEXX box DNA helicase {Bacillus stearothermophilus	95.49
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	95.22
d2b8ta1		139	Thymidine kinase, TK1, N-terminal domain {Ureaplas	95.18
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	95.15
d1p9ra_		401	Extracellular secretion NTPase EpsE {Vibrio choler	95.13
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	95.05
d1zp6a1		176	Hypothetical protein Atu3015 {Agrobacterium tumefa	94.96
d3adka_		194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	94.8
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	94.69
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	94.68
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	94.64
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	94.55
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	94.55
d1jj7a_		251	Peptide transporter Tap1, C-terminal ABC domain {H	94.51
d1t5la1		413	Nucleotide excision repair enzyme UvrB {Bacillus c	94.46
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	94.34
d1r0wa_		281	Cystic fibrosis transmembrane conductance regulato	94.32
d1znwa1		182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	94.28
d3b60a1		253	Multidrug resistance ABC transporter MsbA, C-termi	94.25
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	94.22
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	94.22
d1mv5a_		242	Multidrug resistance ABC transporter LmrA, C-termi	94.17
d3dhwc1		240	Methionine import ATP-binding protein MetN {Escher	94.16
d3d31a2		229	Sulfate/molybdate ABC transporter, ATP-binding pro	94.13
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	94.12
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	94.11
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	93.97
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	93.82
d2hyda1		255	Putative multidrug export ATP-binding/permease pro	93.8
d1ji0a_		240	Branched chain aminoacid ABC transporter {Thermoto	93.52
d1s96a_		205	Guanylate kinase {Escherichia coli [TaxId: 562]}	93.42
d1l7vc_		231	ABC transporter involved in vitamin B12 uptake, Bt	93.37
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	93.32
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	93.31
d1xx6a1		141	Thymidine kinase, TK1, N-terminal domain {Clostrid	93.26
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	93.26
d1ak2a1		190	Adenylate kinase {Cow (Bos taurus), mitochondrial	93.18
d1n0wa_		242	DNA repair protein Rad51, catalytic domain {Human	93.13
d1zina1		182	Adenylate kinase {Bacillus stearothermophilus [Tax	93.09
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	93.04
d1g41a_		443	HslU {Haemophilus influenzae [TaxId: 727]}	92.97
d1ukza_		196	Uridylate kinase {Baker's yeast (Saccharomyces cer	92.86
d1kgda_		178	Guanylate kinase-like domain of Cask {Human (Homo	92.85
d1s3ga1		182	Adenylate kinase {Bacillus globisporus [TaxId: 145	92.84
d1teva_		194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	92.84
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	92.82
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	92.81
d1b0ua_		258	ATP-binding subunit of the histidine permease {Sal	92.79
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	92.79
d1szpa2		251	DNA repair protein Rad51, catalytic domain {Baker'	92.73
d1e4va1		179	Adenylate kinase {Escherichia coli [TaxId: 562]}	92.73
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	92.72
d1gkya_		186	Guanylate kinase {Baker's yeast (Saccharomyces cer	92.68
d1zaka1		189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	92.66
d2onka1		240	Molybdate/tungstate import ATP-binding protein Wtp	92.64
d1vpla_		238	Putative ABC transporter TM0544 {Thermotoga mariti	92.59
d1g6ha_		254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	92.5
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	92.5
d1yj5a2		172	5' polynucleotide kinase-3' phosphatase, C-termina	92.49
d2cdna1		181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	92.38
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	92.3
d1pzna2		254	DNA repair protein Rad51, catalytic domain {Archae	92.29
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	92.07
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	92.03
d1um8a_		364	ClpX {Helicobacter pylori [TaxId: 210]}	91.99
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	91.93
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	91.93
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	91.93
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	91.9
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	91.88
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	91.86
d2ak3a1		189	Adenylate kinase {Cow (Bos taurus), mitochondrial	91.82
d1lvga_		190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	91.68
d2p6ra1		85	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	91.62
d1akya1		180	Adenylate kinase {Baker's yeast (Saccharomyces cer	91.56
d4tmka_		210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	91.22
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	91.02
d1tf7a1		242	Circadian clock protein KaiC {Synechococcus sp. st	90.77
d1e9ra_		433	Bacterial conjugative coupling protein TrwB {Esche	90.49
d1ckea_		225	CMP kinase {Escherichia coli [TaxId: 562]}	90.49
d1v5wa_		258	Meiotic recombination protein DMC1/LIM15 homolog {	90.4
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	90.35
d1yrba1		244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	89.74
d2i1qa2		258	DNA repair protein Rad51, catalytic domain {Archae	89.72
d1htwa_		158	Hypothetical protein HI0065 {Haemophilus influenza	89.41
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	89.19
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	89.14
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	89.02
d1q3ta_		223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	88.99
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	88.92
d1c4oa1		408	Nucleotide excision repair enzyme UvrB {Thermus th	88.91
d1nn5a_		209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	88.9
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	88.84
d1u0la2		225	Probable GTPase EngC (YjeQ), C-terminal domain {Th	88.7
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	88.54
d2vp4a1		197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	88.51
d1hv8a1		208	Putative DEAD box RNA helicase {Archaeon Methanoco	88.19
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	88.11
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	87.88
g1f2t.1		292	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	87.64
g1xew.1		329	Smc head domain {Pyrococcus furiosus [TaxId: 2261]	87.3
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	87.3
d1tmka_		214	Thymidylate kinase {Baker's yeast (Saccharomyces c	87.23
d1g8pa_		333	ATPase subunit of magnesium chelatase, BchI {Rhodo	87.12
d1nija1		222	Hypothetical protein YjiA, N-terminal domain {Esch	87.0
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	86.73
d1qhla_		222	Cell division protein MukB {Escherichia coli [TaxI	86.69
d1u94a1		263	RecA protein, ATPase-domain {Escherichia coli [Tax	86.35
d1p5zb_		241	Deoxycytidine kinase {Human (Homo sapiens) [TaxId:	86.3
d2j0sa1		222	Probable ATP-dependent RNA helicase DDX48 {Human (	86.17
d1w1wa_		427	Smc head domain {Baker's yeast (Saccharomyces cere	86.06
g1ii8.1		369	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	85.75
d2fh5b1		207	Signal recognition particle receptor beta-subunit	85.74
d1nlfa_		274	Hexameric replicative helicase repA {Escherichia c	85.2
d1sq5a_		308	Pantothenate kinase PanK {Escherichia coli [TaxId:	85.18
d1wb9a2		234	DNA repair protein MutS, the C-terminal domain {Es	84.98
d1veca_		206	DEAD box RNA helicase rck/p54 {Human (Homo sapiens	84.59
d1m7ga_		208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	84.58
d1e69a_		308	Smc head domain {Thermotoga maritima [TaxId: 2336]	84.49
d1ny5a2		247	Transcriptional activator sigm54 (NtrC1), C-termin	84.45
d1r8sa_		160	ADP-ribosylation factor {Human (Homo sapiens), ARF	84.22
d1w36b1		485	Exodeoxyribonuclease V beta chain (RecB), N-termin	84.0
d1mkya1		171	Probable GTPase Der, N-terminal and middle domains	83.9
d1ewqa2		224	DNA repair protein MutS, the C-terminal domain {Th	83.75
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	83.69
d2ocpa1		241	Deoxyguanosine kinase {Human (Homo sapiens) [TaxId	83.6
d1t6na_		207	Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo	83.28
d1knxa2		177	HPr kinase HprK C-terminal domain {Mycoplasma pneu	83.09
d1uf9a_		191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	82.75
d1svma_		362	Papillomavirus large T antigen helicase domain {Si	82.61
d1kkma_		176	HPr kinase HprK C-terminal domain {Lactobacillus c	82.52
d1odfa_		286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	82.47
d1jjva_		205	Dephospho-CoA kinase {Haemophilus influenzae [TaxI	82.04
d2qm8a1		323	Metallochaperone MeaB {Methylobacterium extorquens	82.01
d1f6ba_		186	SAR1 {Chinese hamster (Cricetulus griseus) [TaxId:	81.94
d1upta_		169	ADP-ribosylation factor {Human (Homo sapiens), ARL	81.64
d1ksha_		165	ADP-ribosylation factor {Mouse (Mus musculus), ARL	81.5
d1gsia_		208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	81.39
d1nrjb_		209	Signal recognition particle receptor beta-subunit	81.31
d1vhta_		208	Dephospho-CoA kinase {Escherichia coli [TaxId: 562	80.93
d1wmsa_		174	Rab9a {Human (Homo sapiens) [TaxId: 9606]}	80.83
d1ko7a2		169	HPr kinase HprK C-terminal domain {Staphylococcus	80.83
d2bv3a2		276	Elongation factor G (EF-G), N-terminal (G) domain	80.77
d1svia_		195	Probable GTPase EngB {Bacillus subtilis [TaxId: 14	80.76
d3raba_		169	Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	80.66
d2cxxa1		184	GTP-binding protein engB {Pyrococcus horikoshii [T	80.63
d1mo6a1		269	RecA protein, ATPase-domain {Mycobacterium tubercu	80.36
d2qtvb1		166	SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta	80.23
d1xbta1		133	Thymidine kinase, TK1, N-terminal domain {Human (H	80.05

>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RNA helicase
domain: Dengue virus helicase
species: Dengue virus type 2 [TaxId: 11060]

Probab=100.00  E-value=4.3e-34  Score=282.76  Aligned_cols=289  Identities=16%  Similarity=0.141  Sum_probs=192.5

Q ss_pred             HhcCCeEEEEcCCCCchhhHHHHHHHhccccCCCcEEEEeCccHHHHHHHHHHHHHHhCCccCCEEEEEEecCC--CCCc
Q 008735           54 VRKNDILIIVGETGSGKTTQLPQFLFHAGFCRDGKLIGVTQPRRVAAVTVAKRVAEESGVELGQRVGYSIRFDD--RTST  131 (555)
Q Consensus        54 i~~~~~~ii~apTGsGKT~~l~~~i~~~~~~~~~~~i~~~~P~r~l~~~~~~~~~~~~~~~~~~~vg~~~~~~~--~~~~  131 (555)
                      +.+|+++++.||||||||+.+...++..... .+.+++++.|+++|+.|+++++............+.......  ...+
T Consensus         6 ~~~~~~~lv~~~TGsGKT~~~l~~~~~~~~~-~~~~~lvi~Ptr~La~q~~~~l~~~~~~~~~~~~~~~~~~~~~i~~~t   84 (305)
T d2bmfa2           6 FRKKRLTIMDLHPGAGKTKRYLPAIVREAIK-RGLRTLILAPTRVVAAEMEEALRGLPIRYQTPAIRAEHTGREIVDLMC   84 (305)
T ss_dssp             SSTTCEEEECCCTTSSTTTTHHHHHHHHHHH-HTCCEEEEESSHHHHHHHHHHTTTSCCBCCC--------CCCSEEEEE
T ss_pred             hhcCCcEEEEECCCCCHHHHHHHHHHHHHHh-cCCEEEEEccHHHHHHHHHHHHhcCCcceeeeEEeecccCccccccCC
Confidence            5689999999999999996443333332222 245789999999999999887654322111111111111111  1112


Q ss_pred             hhhHH-HhhcCCCCCCCceeEeecccccccchhHHHHHHHHHHHhhcccccCCCCCCCCCCcchhhhccCCCCcccchhh
Q 008735          132 STRIK-EALLDPYLSRYSAIIVDEAHERTVHTDVLLGLLKKVQNARSKSADGHSNGNNNNENSDMILDRGNDTNGINTLK  210 (555)
Q Consensus       132 ~~~i~-~~~~~~~l~~~~~iIiDE~He~~~~~d~ll~~l~~~~~~~~~~~~~~~~~~~~~~~~d~~l~~~~~~~~~~~l~  210 (555)
                      ...+. .+.....+.+++++|+||+|+...+...+.++++.....                                   
T Consensus        85 ~~~l~~~~~~~~~~~~~~~vViDE~H~~~~~~~~~~~~l~~~~~~-----------------------------------  129 (305)
T d2bmfa2          85 HATFTMRLLSPIRVPNYNLIIMDEAHFTDPASIAARGYISTRVEM-----------------------------------  129 (305)
T ss_dssp             HHHHHHHHTSSSCCCCCSEEEEESTTCCSHHHHHHHHHHHHHHHH-----------------------------------
T ss_pred             cHHHHHHHhcCccccceeEEEeeeeeecchhhHHHHHHHHHhhcc-----------------------------------
Confidence            22222 334456688999999999999888777777776655432                                   


Q ss_pred             hccccCCCCceEEEeccCCCHHHHHhhhCCCCeEEeCCccccceEEEcCCCCCChHHHHHHHHHHHHhcCCCCcEEEEcC
Q 008735          211 QCQGRKFAPLKLIIMSASLDARGFSEYFGCAKAVHVQGRQFPVEILYTLYPEPDYLDATLITIFQVHLDEAPGDILVFLT  290 (555)
Q Consensus       211 ~~~~~~~~~~~ii~~SAT~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iLVF~~  290 (555)
                             .+.++++||||++...........++.          ......+.......     .. .....++++||||+
T Consensus       130 -------~~~~~v~~SAT~~~~~~~~~~~~~~~~----------~~~~~~~~~~~~~~-----~~-~~~~~~~~~lvf~~  186 (305)
T d2bmfa2         130 -------GEAAGIFMTATPPGSRDPFPQSNAPIM----------DEEREIPERSWNSG-----HE-WVTDFKGKTVWFVP  186 (305)
T ss_dssp             -------TSCEEEEECSSCTTCCCSSCCCSSCEE----------EEECCCCCSCCSSC-----CH-HHHSSCSCEEEECS
T ss_pred             -------ccceEEEeecCCCcceeeecccCCcce----------EEEEeccHHHHHHH-----HH-HHHhhCCCEEEEec
Confidence                   678999999999543211111111111          11111111100000     00 11234788999999


Q ss_pred             CHHHHHHHHHHHHHHhhcCCCCCCCeEEEEecCCCCHHHHHhhcCcCCCCCcEEEEecCccccccccCCeEEEEeCCccc
Q 008735          291 GQEEIESVERLVQERLLQLPEASRKLVTVPIFSSLPSEQQMRVFAPAAAGFRKVILATNIAETSVTIPGIKYVIDPGFVK  370 (555)
Q Consensus       291 t~~~~~~l~~~L~~~~~~~~~~~~~~~v~~lh~~l~~~~r~~i~~~f~~g~~~vlvaT~~~e~Gvdip~v~~VId~g~~~  370 (555)
                      ++++++++++.|++.         ++.+..+||++..+++    ..|++|..+++|||+++++|+|+ ++++|||+|...
T Consensus       187 ~~~~~~~l~~~L~~~---------~~~~~~l~~~~~~~~~----~~~~~~~~~~lvaT~~~~~G~~~-~~~~Vi~~~~~~  252 (305)
T d2bmfa2         187 SIKAGNDIAACLRKN---------GKKVIQLSRKTFDSEY----IKTRTNDWDFVVTTDISEMGANF-KAERVIDPRRCM  252 (305)
T ss_dssp             CHHHHHHHHHHHHHH---------TCCCEECCTTCHHHHG----GGGGTSCCSEEEECGGGGTTCCC-CCSEEEECCEEE
T ss_pred             cHHHHHHHHHHHHhC---------CCCEEEeCCcChHHHH----hhhhccchhhhhhhHHHHhcCCC-CccEEEEcCCce
Confidence            999999999999987         7788999999876554    45678999999999999999999 688899988765


Q ss_pred             c--eeecCCCCccccceeecCHHhHHHHhcccCCCCCC-EEEEccChh
Q 008735          371 A--RLYDPVKGMESLLVVPISKAQALQRSGRAGREGPG-KCFRLYPEN  415 (555)
Q Consensus       371 ~--~~yd~~~~~~~l~~~p~s~~~~~Qr~GRaGR~~~G-~~~~l~~~~  415 (555)
                      .  ..||+..+...+...|+|.++|+||+|||||.|.| ....+|..+
T Consensus       253 ~~~~~~~~~~~~~~~~~~~~s~~~~~Qr~GR~GR~~~~~~~~~~~~~~  300 (305)
T d2bmfa2         253 KPVILTDGEERVILAGPMPVTHSSAAQRRGRVGRNPKNENDQYIYMGE  300 (305)
T ss_dssp             EEEEECSSSCEEEEEEEEECCHHHHHHHHTTSSCSSSCCCEEEEECSC
T ss_pred             eeeEecCCCCceEEeccccCCHHHHhhhhcCcCcCCCCceEEEEECCC
Confidence            3  35788787777888899999999999999999944 455566554

PyMOL of d2bmfa2

>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]}	Back information, alignment and structure

>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}	Back information, alignment and structure

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}	Back information, alignment and structure

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}	Back information, alignment and structure

>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}	Back information, alignment and structure

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}	Back information, alignment and structure

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}	Back information, alignment and structure

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}	Back information, alignment and structure

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2p6ra1 a.4.5.43 (A:404-488) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}	Back information, alignment and structure

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}	Back information, alignment and structure

>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]}	Back information, alignment and structure

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}	Back information, alignment and structure

>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}	Back information, alignment and structure

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}	Back information, alignment and structure

>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}	Back information, alignment and structure

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]}	Back information, alignment and structure

>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure