Citrus Sinensis ID: 009003

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------
MAASSPLLTSEHSKKTKPNRRKRTRKGGEAEKLDSLKWNHSFSAEDNDPFAFLVGSNELDGGFLSLEEIDEASYNLQIPKPEKGKPGKKLNSKKRKRSSANEEDSGDGDGDGDEDGSGVQKQEEKNLKNETGKKKKKKKKGKKIKTVEESVAVSNGPDDAEEELVNEAEISTEFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGLPIMQRLLEEREKAAKMLEDKGEEAEKYAPKGHLRALIITPTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWELMSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNKGQSEQTQNCVTVSSLQRKKRQTLVFSATIALSADFRKKLKHGSLKSKQSVNGLNSIETLSERAGMRANVAIVDLTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGRTIVFCTSIAALRHISSLLKILGIDVWTLHAQMQQRARLKLFSQMITWIRKRPKGDRGKD
cccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHccccHHHHHHHccccccccHHHHHHHcccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHccccEEEcccHHHHHHHHcccccccccccccEEEEEcccHHHccccHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEEEccccHHHHHHHHHcccccccccccccHHHHHHHHHccccccEEEEEccccccccccEEEEEEcccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcHHHHccccccccccc
cccccccccccccccccccHccccccccHHHHHHcccccccccccccccccEEEcccccccccccHHHccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccEEcccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHccccccccHccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHccccEEEEcccHHHHHHHcccccEEEHHHEEEEEEHHHHHHHHccccHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccEEEEEEccccccccEEEEEEEEccHHHHHHHHHHHHccccccEEEEEEcHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHcccc
maassplltsehskktkpnrrkrtrkggeaekldslkwnhsfsaedndpfaflvgsneldggflsleeideasynlqipkpekgkpgkklnskkrkrssaneedsgdgdgdgdedgsgvqKQEEKNlknetgkkkkkkkkgkkiKTVEESvavsngpddaeeELVNEAEISTEFDawnelrlhplLMKSIYrlqfkeptpiqkacipaaahqgkdvigaaetgsgktlaFGLPIMQRLLEEREKAAKMLEDKgeeaekyapkghlralIITPTRELALQVTDHLKGVAKGINVRVvpivggmsTEKQERLLkarpevvvgtpgrlwelmsggeKHLVELHTLSFFVLDEADRMIENGHFRELQSIIdmlpmtngsnkgqseqtqncvtvsslqrkkrqTLVFSATIALSADFRKKLkhgslkskqsvnglnSIETLSERAGMRANVAIVDLTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGRTIVFCTSIAALRHISSLLKILGIDVWTLHAQMQQRARLKLFSQMITWIrkrpkgdrgkd
maassplltsehskktkpnrrkrtrkggeaekldslkwnhSFSAEDNDPFAFLVGSNELDGGFLSLEEIDEASynlqipkpekgkpgkklnskkrkrssaneedsgdgdgdgdedgsgvqkqeeknlknetgkkkkkkkkgkkiktveesvavsngpddaEEELVNEAEISTEFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGLPIMQRLLEEREKAAKMLEDKgeeaekyapkghLRALIITPTRELALQVTDHLkgvakginvrvvPIVGGMSTEkqerllkarpevvvgtpGRLWELMSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNKGQSEQTQNCVTVsslqrkkrqtlVFSATIALSADFRKKLKhgslkskqsvnglNSIETLSERAGMRANVAIVDLTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGRTIVFCTSIAALRHISSLLKILGIDVWTLHAQMQQRARLKLFSQMItwirkrpkgdrgkd
MAASSPLLTSEHSkktkpnrrkrtrkGGEAEKLDSLKWNHSFSAEDNDPFAFLVGSNELDGGFLSLEEIDEASYNLQIpkpekgkpgkklnskkrkrssANeedsgdgdgdgdedgsgVQKQeeknlknetgkkkkkkkkgkkiktveeSVAVSNGPDDAEEELVNEAEISTEFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGLPIMQRLLEEREKAAKMLEDKGEEAEKYAPKGHLRALIITPTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWELMSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNKGQSEQTQNCVTVSSLQRKKRQTLVFSATIALSADFRKKLKHGSLKSKQSVNGLNSIETLSERAGMRANVAIVDLTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGRTIVFCTSIAALRHISSLLKILGIDVWTLHAQMQQRARLKLFSQMITWIRKRPKGDRGKD
************************************************PFAFLVGSNELDGGFLSLEEI****************************************************************************************************ISTEFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGLPIMQRL************************GHLRALIITPTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWELMSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDML****************************QTLVFSATIALSADFR*************************RAGMRANVAIVDLTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGRTIVFCTSIAALRHISSLLKILGIDVWTLHAQMQQRARLKLFSQMITWIR**********
*****************************************FSAEDNDPFAFLVGSNELDGGFLSLEEIDEAS*****************************************************************************************************DAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGLPIMQRLLEERE***************YAPKGHLRALIITPTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWELMSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNKGQSEQ*********LQRKKRQTLVFSATIALSADF**********************TLSERAGMRANVAIVDLTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGRTIVFCTSIAALRHISSLLKILGIDVWTLHAQMQQRARLKLFSQMITWIRKRPKGDRGKD
*****************************AEKLDSLKWNHSFSAEDNDPFAFLVGSNELDGGFLSLEEIDEASYNLQIPKPE****************************************************************VEESVAVSNGPDDAEEELVNEAEISTEFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGLPIMQRLLEEREKAAKMLEDKGEEAEKYAPKGHLRALIITPTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWELMSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNG******************QRKKRQTLVFSATIALSADFRKKLKHGSLKSKQSVNGLNSIETLSERAGMRANVAIVDLTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGRTIVFCTSIAALRHISSLLKILGIDVWTLHAQMQQRARLKLFSQMITWIRK*********
******************************EKLDSLKWNHSFSAEDNDPFAFLVGSNELDGGFLSLEEIDEASYNL***********************************************************************EESVAVSNGPDDAEEELVNEAEISTEFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGLPIMQRLLEER******************PKGHLRALIITPTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWELMSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLP*******************SSLQRKKRQTLVFSATIALSADFRKKLKHGSLKSKQSVNGLNSIETLSERAGMRANVAIVDLTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGRTIVFCTSIAALRHISSLLKILGIDVWTLHAQMQQRARLKLFSQMITWIRKRPKGDRGK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASSPLLTSEHSKKTKPNRRKRTRKGGEAEKLDSLKWNHSFSAEDNDPFAFLVGSNELDGGFLSLEEIDEASYNLQIPKPEKGKPGKKLNSKKRKRSSANEEDSGDGDGDGDEDGSGVxxxxxxxxxxxxxxxxxxxxxGKKIKTVEESVAVSNGPDDAEEELVNEAEISTEFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGLPIxxxxxxxxxxxxxxxxxxxxxxxxxAPKGHLRALIITPTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWELMSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNKGQSEQTQNCVTVSSLQRKKRQTLVFSATIALSADFRKKLKHGSLKSKQSVNGLNSIETLSERAGMRANVAIVDLTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGRTIVFCTSIAALRHISSLLKILGIDVWTLHAQMQQRARLKLFSQMITWIRKRPKGDRGKD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query547 2.2.26 [Sep-21-2011]
Q93Y39 826 DEAD-box ATP-dependent RN yes no 0.694 0.460 0.719 1e-152
A3AVH5 832 DEAD-box ATP-dependent RN yes no 0.648 0.426 0.693 1e-143
A2XVF7 832 DEAD-box ATP-dependent RN N/A no 0.648 0.426 0.693 1e-143
Q54TD7 940 ATP-dependent RNA helicas yes no 0.696 0.405 0.349 2e-69
Q2UMY7 757 ATP-dependent RNA helicas yes no 0.844 0.610 0.337 2e-60
A6R9U4 772 ATP-dependent RNA helicas N/A no 0.636 0.450 0.368 2e-59
Q5BCI0 770 ATP-dependent RNA helicas yes no 0.616 0.437 0.393 4e-58
A1DMT9 777 ATP-dependent RNA helicas N/A no 0.638 0.449 0.368 8e-58
Q0CI35 774 ATP-dependent RNA helicas N/A no 0.632 0.447 0.374 1e-57
P0CQ91 772 ATP-dependent RNA helicas N/A no 0.782 0.554 0.356 5e-57
>sp|Q93Y39|RH13_ARATH DEAD-box ATP-dependent RNA helicase 13 OS=Arabidopsis thaliana GN=RH13 PE=2 SV=3 Back     alignment and function desciption
 Score =  540 bits (1391), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 274/381 (71%), Positives = 323/381 (84%), Gaps = 1/381 (0%)

Query: 148 EESVAVSNGPDDAEEELVNEAEISTEFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIP 207
           +++ AVS   DD  EE V E EI  EF AW+ +RLHPLLMKSIYRL FKEPT IQKAC  
Sbjct: 163 QDASAVSCDGDDTVEEQVEEEEIPPEFSAWSSMRLHPLLMKSIYRLDFKEPTKIQKACFN 222

Query: 208 AAAHQGKDVIGAAETGSGKTLAFGLPIMQRLLEEREKAAKMLEDKGEEAEKYAPKGHLRA 267
            AA+QGKDVIGAAETGSGKTLAFGLPI+QRLL+EREK  K+   KGEEA+KYA  G+LRA
Sbjct: 223 VAAYQGKDVIGAAETGSGKTLAFGLPILQRLLDEREKVGKLYALKGEEAQKYAADGYLRA 282

Query: 268 LIITPTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWE 327
           LIITPTRELALQVT+HL+  AK ++V+VVPIVGGM +EKQER LK +PE+VV TPGRLWE
Sbjct: 283 LIITPTRELALQVTEHLENAAKNLSVKVVPIVGGMFSEKQERRLKEKPEIVVATPGRLWE 342

Query: 328 LMSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNKGQSEQTQNCV 387
           LMS GEKHLVELH+LSFFVLDEADRM+E GHFRELQSI+D+LP+T+  N+G+++  ++  
Sbjct: 343 LMSAGEKHLVELHSLSFFVLDEADRMVERGHFRELQSILDLLPVTDKPNEGKTQTVKSND 402

Query: 388 TVSSLQRKKRQTLVFSATIALSADFRKKLKHGSLKSKQSVNG-LNSIETLSERAGMRANV 446
           TV ++ +KKRQT VFSATIALS+DFRKKLK GS KSKQS +G +NSIE LSERAGMR NV
Sbjct: 403 TVLNVPKKKRQTFVFSATIALSSDFRKKLKRGSSKSKQSSSGEVNSIEVLSERAGMRDNV 462

Query: 447 AIVDLTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGRTIVFCTSIAALRHISSLL 506
           AI+DLT   +LA K+EESFI+C+E++KDAYLYYILSVHGQGRTIVFCTS+  LRHIS LL
Sbjct: 463 AIIDLTTTSILAPKIEESFIKCEEKEKDAYLYYILSVHGQGRTIVFCTSVTDLRHISGLL 522

Query: 507 KILGIDVWTLHAQMQQRARLK 527
           KILG+DV TL ++M+QRARLK
Sbjct: 523 KILGLDVCTLFSEMKQRARLK 543

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|A3AVH5|RH13_ORYSJ DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. japonica GN=Os04g0510400 PE=2 SV=2 Back     alignment and function description
>sp|A2XVF7|RH13_ORYSI DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. indica GN=OsI_016050 PE=2 SV=2 Back     alignment and function description
>sp|Q54TD7|DDX24_DICDI ATP-dependent RNA helicase ddx24 OS=Dictyostelium discoideum GN=ddx24 PE=3 SV=1 Back     alignment and function description
>sp|Q2UMY7|MAK5_ASPOR ATP-dependent RNA helicase mak5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mak5 PE=3 SV=1 Back     alignment and function description
>sp|A6R9U4|MAK5_AJECN ATP-dependent RNA helicase MAK5 OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=MAK5 PE=3 SV=1 Back     alignment and function description
>sp|Q5BCI0|MAK5_EMENI ATP-dependent RNA helicase mak5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mak5 PE=3 SV=1 Back     alignment and function description
>sp|A1DMT9|MAK5_NEOFI ATP-dependent RNA helicase mak5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mak5 PE=3 SV=1 Back     alignment and function description
>sp|Q0CI35|MAK5_ASPTN ATP-dependent RNA helicase mak5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mak5 PE=3 SV=2 Back     alignment and function description
>sp|P0CQ91|MAK5_CRYNB ATP-dependent RNA helicase MAK5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MAK5 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query547
225433316 788 PREDICTED: DEAD-box ATP-dependent RNA he 0.910 0.631 0.731 0.0
356520440 810 PREDICTED: DEAD-box ATP-dependent RNA he 0.932 0.629 0.682 0.0
357505253 798 DEAD-box ATP-dependent RNA helicase [Med 0.910 0.624 0.659 0.0
255554328496 dead box ATP-dependent RNA helicase, put 0.882 0.973 0.695 0.0
449458872 848 PREDICTED: DEAD-box ATP-dependent RNA he 0.952 0.614 0.614 0.0
449509127 784 PREDICTED: DEAD-box ATP-dependent RNA he 0.923 0.644 0.614 0.0
224107545 847 predicted protein [Populus trichocarpa] 0.815 0.526 0.655 1e-163
297834580 831 DEAD-box ATP-dependent RNA helicase 13 [ 0.694 0.457 0.724 1e-155
227202696 827 AT3G16840 [Arabidopsis thaliana] 0.700 0.463 0.718 1e-151
79404523 826 DEAD-box ATP-dependent RNA helicase 13 [ 0.694 0.460 0.719 1e-151
>gi|225433316|ref|XP_002282504.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 13 [Vitis vinifera] gi|296083755|emb|CBI23744.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/518 (73%), Positives = 420/518 (81%), Gaps = 20/518 (3%)

Query: 15  KTKPNRRKRTRKGGEAEKLDSLKWNHSFSAEDNDPFAFLVGSNELDGGFLSLEEIDEASY 74
           KT   RRKRT    + E+L+SL WN S    D DPF+  VGS+EL+GGFLSLEEIDE+ Y
Sbjct: 4   KTPNARRKRTAVNPDLERLESLPWNPSLPDVD-DPFSLFVGSDELEGGFLSLEEIDESEY 62

Query: 75  NLQI--PKPE--KGKPGKKLNSKKRKRSSANEEDSGDGDGDGDEDGSGVQKQEEKNLKNE 130
            L+I  P PE  KG P +   SKKRK S  N     D  G G EDG+   ++E  + KN 
Sbjct: 63  GLEIHEPGPEDKKGNPKQSKKSKKRKSSGDN-----DSSGGGVEDGT---EEEVVDKKNF 114

Query: 131 TGKKKKKKKKGKKIKTVEESVAVSNGPDDAEEELVNEAEISTEFDAWNELRLHPLLMKSI 190
             KKKKKKK  KK +T EES  VSN  DD E + V+EAE    F  WNELRLHPLLMKSI
Sbjct: 115 KKKKKKKKKVTKKNQTNEESATVSNDKDDVEGDSVDEAE----FYEWNELRLHPLLMKSI 170

Query: 191 YRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGLPIMQRLLEEREKAAKMLE 250
           +RL FK+PTPIQKACIPAAAHQGKDV+GA+ETGSGKTLA GLPI+QRLLEEREKAA+ L 
Sbjct: 171 HRLGFKQPTPIQKACIPAAAHQGKDVVGASETGSGKTLALGLPILQRLLEEREKAAEPLA 230

Query: 251 DKGEEAEKYAPKGHLRALIITPTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERL 310
           +  EE  KYA  G LRALIITPTRELALQVTDHLK VAKG NVRVVPIVGGMSTEKQERL
Sbjct: 231 ENSEE--KYAEGGILRALIITPTRELALQVTDHLKEVAKGTNVRVVPIVGGMSTEKQERL 288

Query: 311 LKARPEVVVGTPGRLWELMSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLP 370
           LKARPE+VVGTPGRLWELMS GE HLVELH+LSFFVLDEADRM+ENGHF ELQSIID+LP
Sbjct: 289 LKARPEIVVGTPGRLWELMSRGEDHLVELHSLSFFVLDEADRMVENGHFHELQSIIDILP 348

Query: 371 MTNGSNKGQSEQTQNCVTVSSLQRKKRQTLVFSATIALSADFRKKLKHGSLKSKQSVN-G 429
            T+GS +  S+ T+NC TVS++QRKKRQT VFSATIALSADFRKKLK G+L+SKQ +N G
Sbjct: 349 KTSGSMESLSQNTENCFTVSNIQRKKRQTFVFSATIALSADFRKKLKRGALRSKQLMNDG 408

Query: 430 LNSIETLSERAGMRANVAIVDLTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGRT 489
           LNSIETLSERAGMR N AIVDLTN  ++ANKLEESFIEC+EEDKDAYLYYILSVHGQGRT
Sbjct: 409 LNSIETLSERAGMRPNAAIVDLTNASIMANKLEESFIECREEDKDAYLYYILSVHGQGRT 468

Query: 490 IVFCTSIAALRHISSLLKILGIDVWTLHAQMQQRARLK 527
           IVFCTSIAALRH SSLL+ILGI+VWTLHAQMQQRARLK
Sbjct: 469 IVFCTSIAALRHTSSLLRILGINVWTLHAQMQQRARLK 506

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356520440|ref|XP_003528870.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 13-like [Glycine max] Back     alignment and taxonomy information
>gi|357505253|ref|XP_003622915.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] gi|355497930|gb|AES79133.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula] Back     alignment and taxonomy information
>gi|255554328|ref|XP_002518204.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi|223542800|gb|EEF44337.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449458872|ref|XP_004147170.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 13-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449509127|ref|XP_004163501.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 13-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|224107545|ref|XP_002314517.1| predicted protein [Populus trichocarpa] gi|222863557|gb|EEF00688.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297834580|ref|XP_002885172.1| DEAD-box ATP-dependent RNA helicase 13 [Arabidopsis lyrata subsp. lyrata] gi|297331012|gb|EFH61431.1| DEAD-box ATP-dependent RNA helicase 13 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|227202696|dbj|BAH56821.1| AT3G16840 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|79404523|ref|NP_188307.3| DEAD-box ATP-dependent RNA helicase 13 [Arabidopsis thaliana] gi|374095486|sp|Q93Y39.3|RH13_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 13 gi|332642351|gb|AEE75872.1| DEAD-box ATP-dependent RNA helicase 13 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query547
TAIR|locus:2086775 826 AT3G16840 [Arabidopsis thalian 0.687 0.455 0.726 3.5e-152
DICTYBASE|DDB_G0281841 940 ddx24 "DEAD/DEAH box helicase" 0.223 0.129 0.524 4.1e-69
ASPGD|ASPL0000042587 770 AN1750 [Emericella nidulans (t 0.639 0.454 0.389 1.3e-59
UNIPROTKB|A6H7B6 852 DDX24 "DDX24 protein" [Bos tau 0.252 0.161 0.45 8.9e-58
MGI|MGI:1351337 857 Ddx24 "DEAD (Asp-Glu-Ala-Asp) 0.255 0.163 0.448 3.2e-56
WB|WBGene00018890 746 F55F8.2 [Caenorhabditis elegan 0.420 0.308 0.387 3.4e-55
RGD|727929 851 Ddx24 "DEAD (Asp-Glu-Ala-Asp) 0.255 0.164 0.434 9.1e-55
CGD|CAL0005900 782 MAK5 [Candida albicans (taxid: 0.617 0.432 0.352 8.6e-52
UNIPROTKB|F1NJ62 851 F1NJ62 "Uncharacterized protei 0.217 0.139 0.475 1.6e-49
SGD|S000000346 773 MAK5 "Essential nucleolar prot 0.610 0.432 0.338 4.9e-47
TAIR|locus:2086775 AT3G16840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1384 (492.3 bits), Expect = 3.5e-152, Sum P(2) = 3.5e-152
 Identities = 274/377 (72%), Positives = 320/377 (84%)

Query:   152 AVSNGPDDAEEELVNEAEISTEFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAH 211
             AVS   DD  EE V E EI  EF AW+ +RLHPLLMKSIYRL FKEPT IQKAC   AA+
Sbjct:   167 AVSCDGDDTVEEQVEEEEIPPEFSAWSSMRLHPLLMKSIYRLDFKEPTKIQKACFNVAAY 226

Query:   212 QGKDVIGAAETGSGKTLAFGLPIMQRLLEEREKAAKMLEDKGEEAEKYAPKGHLRALIIT 271
             QGKDVIGAAETGSGKTLAFGLPI+QRLL+EREK  K+   KGEEA+KYA  G+LRALIIT
Sbjct:   227 QGKDVIGAAETGSGKTLAFGLPILQRLLDEREKVGKLYALKGEEAQKYAADGYLRALIIT 286

Query:   272 PTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWELMSG 331
             PTRELALQVT+HL+  AK ++V+VVPIVGGM +EKQER LK +PE+VV TPGRLWELMS 
Sbjct:   287 PTRELALQVTEHLENAAKNLSVKVVPIVGGMFSEKQERRLKEKPEIVVATPGRLWELMSA 346

Query:   332 GEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNKGQSEQTQNCVTVSS 391
             GEKHLVELH+LSFFVLDEADRM+E GHFRELQSI+D+LP+T+  N+G+++  ++  TV +
Sbjct:   347 GEKHLVELHSLSFFVLDEADRMVERGHFRELQSILDLLPVTDKPNEGKTQTVKSNDTVLN 406

Query:   392 LQRKKRQTLVFSATIALSADFRKKLKHGSLKSKQSVNG-LNSIETLSERAGMRANVAIVD 450
             + +KKRQT VFSATIALS+DFRKKLK GS KSKQS +G +NSIE LSERAGMR NVAI+D
Sbjct:   407 VPKKKRQTFVFSATIALSSDFRKKLKRGSSKSKQSSSGEVNSIEVLSERAGMRDNVAIID 466

Query:   451 LTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGRTIVFCTSIAALRHISSLLKILG 510
             LT   +LA K+EESFI+C+E++KDAYLYYILSVHGQGRTIVFCTS+  LRHIS LLKILG
Sbjct:   467 LTTTSILAPKIEESFIKCEEKEKDAYLYYILSVHGQGRTIVFCTSVTDLRHISGLLKILG 526

Query:   511 IDVWTLHAQMQQRARLK 527
             +DV TL ++M+QRARLK
Sbjct:   527 LDVCTLFSEMKQRARLK 543
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS
DICTYBASE|DDB_G0281841 ddx24 "DEAD/DEAH box helicase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000042587 AN1750 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|A6H7B6 DDX24 "DDX24 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1351337 Ddx24 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 24" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00018890 F55F8.2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
RGD|727929 Ddx24 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 24" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
CGD|CAL0005900 MAK5 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ62 F1NJ62 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
SGD|S000000346 MAK5 "Essential nucleolar protein" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93Y39RH13_ARATH3, ., 6, ., 4, ., 1, 30.71910.69460.4600yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.914
3rd Layer3.6.40.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
cd00268203 cd00268, DEADc, DEAD-box helicases 9e-70
COG0513 513 COG0513, SrmB, Superfamily II DNA and RNA helicase 2e-68
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 1e-46
PRK11776 460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 2e-46
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 5e-39
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 6e-36
PRK11192 434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 3e-32
PRK10590 456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 6e-31
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 5e-30
PRK04537 572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 2e-29
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 5e-29
PRK11634 629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 6e-28
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 2e-24
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 2e-22
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 5e-21
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 1e-14
COG1205 851 COG1205, COG1205, Distinct helicase family with a 1e-13
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 8e-07
COG1204 766 COG1204, COG1204, Superfamily II helicase [General 6e-06
TIGR04121 803 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA 6e-06
PRK13767 876 PRK13767, PRK13767, ATP-dependent helicase; Provis 1e-05
PRK09751 1490 PRK09751, PRK09751, putative ATP-dependent helicas 2e-05
TIGR03817 742 TIGR03817, DECH_helic, helicase/secretion neighbor 0.001
pfam05786 719 pfam05786, Cnd2, Condensin complex subunit 2 0.004
COG1202 830 COG1202, COG1202, Superfamily II helicase, archaea 0.004
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information 
 Score =  222 bits (568), Expect = 9e-70
 Identities = 90/229 (39%), Positives = 126/229 (55%), Gaps = 46/229 (20%)

Query: 177 WNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGLPIMQ 236
           + EL L P L++ IY L F++PTPIQ   IP     G+DVIG A+TGSGKT AF +PI++
Sbjct: 1   FEELGLSPELLRGIYALGFEKPTPIQARAIPPLL-SGRDVIGQAQTGSGKTAAFLIPILE 59

Query: 237 RLLEEREKAAKMLEDKGEEAEKYAPKGHLRALIITPTRELALQVTDHLKGVAKGINVRVV 296
           +L                       K   +ALI+ PTRELALQ+ +  + + K  N++VV
Sbjct: 60  KLDPSP------------------KKDGPQALILAPTRELALQIAEVARKLGKHTNLKVV 101

Query: 297 PIVGGMSTEKQERLLKARPEVVVGTPGRLWELMSGGEKHLVELHTLSFFVLDEADRMIEN 356
            I GG S +KQ R LK  P +VV TPGRL +L+   E+  ++L  + + VLDEADRM++ 
Sbjct: 102 VIYGGTSIDKQIRKLKRGPHIVVATPGRLLDLL---ERGKLDLSKVKYLVLDEADRMLDM 158

Query: 357 GHFRELQSIIDMLPMTNGSNKGQSEQTQNCVTVSSLQRKKRQTLVFSAT 405
           G   +++ I+ +LP                        K RQTL+FSAT
Sbjct: 159 GFEDQIREILKLLP------------------------KDRQTLLFSAT 183

A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region. Length = 203
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated Back     alignment and domain information
>gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional Back     alignment and domain information
>gnl|CDD|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>gnl|CDD|218747 pfam05786, Cnd2, Condensin complex subunit 2 Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 547
KOG0330 476 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0338 691 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0347 731 consensus RNA helicase [RNA processing and modific 100.0
KOG0331 519 consensus ATP-dependent RNA helicase [RNA processi 100.0
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0343 758 consensus RNA Helicase [RNA processing and modific 100.0
KOG0342 543 consensus ATP-dependent RNA helicase pitchoune [RN 100.0
KOG0340 442 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00110 545 helicase; Provisional 100.0
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0328400 consensus Predicted ATP-dependent RNA helicase FAL 100.0
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 100.0
KOG0346 569 consensus RNA helicase [RNA processing and modific 100.0
KOG0345 567 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 100.0
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0339 731 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0335482 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0326459 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0348 708 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0336629 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0334 997 consensus RNA helicase [RNA processing and modific 100.0
KOG0337 529 consensus ATP-dependent RNA helicase [RNA processi 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0341 610 consensus DEAD-box protein abstrakt [RNA processin 100.0
KOG0332477 consensus ATP-dependent RNA helicase [RNA processi 100.0
KOG0327397 consensus Translation initiation factor 4F, helica 100.0
KOG0350 620 consensus DEAD-box ATP-dependent RNA helicase [RNA 100.0
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG4284 980 consensus DEAD box protein [Transcription] 100.0
PRK02362 737 ski2-like helicase; Provisional 100.0
KOG0344 593 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK00254 720 ski2-like helicase; Provisional 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
KOG0329387 consensus ATP-dependent RNA helicase [RNA processi 100.0
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 100.0
PRK01172 674 ski2-like helicase; Provisional 100.0
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 99.98
PRK14701 1638 reverse gyrase; Provisional 99.97
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 99.97
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.97
PRK10689 1147 transcription-repair coupling factor; Provisional 99.97
COG1202 830 Superfamily II helicase, archaea-specific [General 99.96
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.96
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 99.96
KOG0349 725 consensus Putative DEAD-box RNA helicase DDX1 [RNA 99.96
COG1205 851 Distinct helicase family with a unique C-terminal 99.96
COG1204 766 Superfamily II helicase [General function predicti 99.96
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 99.96
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 99.95
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.95
PHA02558501 uvsW UvsW helicase; Provisional 99.95
PHA02653 675 RNA helicase NPH-II; Provisional 99.94
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 99.94
KOG0952 1230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.94
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 99.94
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.93
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 99.93
KOG2340698 consensus Uncharacterized conserved protein [Funct 99.93
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 99.92
PRK13766 773 Hef nuclease; Provisional 99.91
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 99.91
KOG0926 1172 consensus DEAH-box RNA helicase [RNA processing an 99.91
PRK09200 790 preprotein translocase subunit SecA; Reviewed 99.9
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 99.89
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 99.89
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.89
KOG0351 941 consensus ATP-dependent DNA helicase [Replication, 99.89
KOG0352 641 consensus ATP-dependent DNA helicase [Replication, 99.89
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 99.89
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 99.88
KOG0354 746 consensus DEAD-box like helicase [General function 99.86
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.86
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.86
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.85
PRK05580 679 primosome assembly protein PriA; Validated 99.85
PRK09694 878 helicase Cas3; Provisional 99.85
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.84
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.84
PRK12904 830 preprotein translocase subunit SecA; Reviewed 99.83
KOG0947 1248 consensus Cytoplasmic exosomal RNA helicase SKI2, 99.83
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.83
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 99.82
KOG0353 695 consensus ATP-dependent DNA helicase [General func 99.81
smart00487201 DEXDc DEAD-like helicases superfamily. 99.8
PRK13107 908 preprotein translocase subunit SecA; Reviewed 99.78
TIGR00595 505 priA primosomal protein N'. All proteins in this f 99.78
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.76
PRK04914 956 ATP-dependent helicase HepA; Validated 99.76
KOG0948 1041 consensus Nuclear exosomal RNA helicase MTR4, DEAD 99.76
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.74
KOG0922 674 consensus DEAH-box RNA helicase [RNA processing an 99.74
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 99.72
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 99.72
KOG0950 1008 consensus DNA polymerase theta/eta, DEAD-box super 99.7
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.69
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 99.68
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.68
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.67
KOG0923 902 consensus mRNA splicing factor ATP-dependent RNA h 99.67
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.64
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 99.61
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.61
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.58
KOG0924 1042 consensus mRNA splicing factor ATP-dependent RNA h 99.57
KOG0920 924 consensus ATP-dependent RNA helicase A [RNA proces 99.55
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 99.52
KOG1123 776 consensus RNA polymerase II transcription initiati 99.45
KOG0385 971 consensus Chromatin remodeling complex WSTF-ISWI, 99.44
COG4096 875 HsdR Type I site-specific restriction-modification 99.42
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 99.37
KOG0925 699 consensus mRNA splicing factor ATP-dependent RNA h 99.36
PRK12326 764 preprotein translocase subunit SecA; Reviewed 99.33
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.33
KOG0387 923 consensus Transcription-coupled repair protein CSB 99.29
KOG0951 1674 consensus RNA helicase BRR2, DEAD-box superfamily 99.26
KOG0949 1330 consensus Predicted helicase, DEAD-box superfamily 99.26
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 99.24
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.2
KOG0390 776 consensus DNA repair protein, SNF2 family [Replica 99.17
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.16
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 99.13
CHL00122 870 secA preprotein translocase subunit SecA; Validate 99.12
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.12
smart00489289 DEXDc3 DEAD-like helicases superfamily. 99.12
smart00488289 DEXDc2 DEAD-like helicases superfamily. 99.12
COG1198 730 PriA Primosomal protein N' (replication factor Y) 99.08
KOG09521230 consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup 99.07
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.06
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 99.05
KOG1000 689 consensus Chromatin remodeling protein HARP/SMARCA 99.03
PRK12903 925 secA preprotein translocase subunit SecA; Reviewed 98.99
KOG1002 791 consensus Nucleotide excision repair protein RAD16 98.99
KOG0384 1373 consensus Chromodomain-helicase DNA-binding protei 98.97
KOG0389941 consensus SNF2 family DNA-dependent ATPase [Chroma 98.91
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 98.87
PRK05298 652 excinuclease ABC subunit B; Provisional 98.86
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 98.85
COG4889 1518 Predicted helicase [General function prediction on 98.83
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.81
TIGR02562 1110 cas3_yersinia CRISPR-associated helicase Cas3. The 98.74
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 98.66
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 98.64
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 98.56
PRK14873 665 primosome assembly protein PriA; Provisional 98.55
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 98.54
PRK15483 986 type III restriction-modification system StyLTI en 98.54
KOG0953 700 consensus Mitochondrial RNA helicase SUV3, DEAD-bo 98.41
KOG4439 901 consensus RNA polymerase II transcription terminat 98.39
COG0610 962 Type I site-specific restriction-modification syst 98.29
KOG0386 1157 consensus Chromatin remodeling complex SWI/SNF, co 98.26
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 98.24
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.23
KOG4150 1034 consensus Predicted ATP-dependent RNA helicase [RN 98.22
KOG0388 1185 consensus SNF2 family DNA-dependent ATPase [Replic 98.07
KOG1132 945 consensus Helicase of the DEAD superfamily [Replic 98.03
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.0
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 97.96
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 97.94
KOG1803 649 consensus DNA helicase [Replication, recombination 97.93
KOG1802 935 consensus RNA helicase nonsense mRNA reducing fact 97.89
TIGR00376 637 DNA helicase, putative. The gene product may repre 97.82
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 97.79
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.78
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 97.75
PRK10536262 hypothetical protein; Provisional 97.72
PRK10875 615 recD exonuclease V subunit alpha; Provisional 97.71
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.68
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.67
KOG0921 1282 consensus Dosage compensation complex, subunit MLE 97.67
KOG1015 1567 consensus Transcription regulator XNP/ATRX, DEAD-b 97.66
PF1324576 AAA_19: Part of AAA domain 97.56
PRK12901 1112 secA preprotein translocase subunit SecA; Reviewed 97.51
KOG1133 821 consensus Helicase of the DEAD superfamily [Replic 97.5
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.48
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.37
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 97.36
PRK13826 1102 Dtr system oriT relaxase; Provisional 97.27
KOG18051100 consensus DNA replication helicase [Replication, r 97.26
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.23
PRK13889 988 conjugal transfer relaxase TraA; Provisional 97.17
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.15
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 97.1
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 97.01
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.96
PRK08181269 transposase; Validated 96.94
PRK04296190 thymidine kinase; Provisional 96.94
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.92
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.89
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 96.82
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 96.74
KOG0298 1394 consensus DEAD box-containing helicase-like transc 96.68
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.66
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 96.65
PRK14974336 cell division protein FtsY; Provisional 96.54
PRK06526254 transposase; Provisional 96.51
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 96.41
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.36
KOG1131 755 consensus RNA polymerase II transcription initiati 96.34
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 96.25
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 96.23
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.2
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.19
PRK06893229 DNA replication initiation factor; Validated 96.18
PRK05642234 DNA replication initiation factor; Validated 96.18
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.16
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 96.05
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 96.0
PF03354 477 Terminase_1: Phage Terminase ; InterPro: IPR005021 95.99
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 95.98
PRK12377248 putative replication protein; Provisional 95.93
PRK00149450 dnaA chromosomal replication initiation protein; R 95.88
PTZ001121164 origin recognition complex 1 protein; Provisional 95.86
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 95.83
PRK14087450 dnaA chromosomal replication initiation protein; P 95.83
PHA03368 738 DNA packaging terminase subunit 1; Provisional 95.82
KOG0989346 consensus Replication factor C, subunit RFC4 [Repl 95.82
PRK08116268 hypothetical protein; Validated 95.8
smart00382148 AAA ATPases associated with a variety of cellular 95.78
COG1484254 DnaC DNA replication protein [DNA replication, rec 95.76
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.74
PRK13833323 conjugal transfer protein TrbB; Provisional 95.71
PHA02533 534 17 large terminase protein; Provisional 95.66
PRK11054 684 helD DNA helicase IV; Provisional 95.64
PRK13894319 conjugal transfer ATPase TrbB; Provisional 95.63
PRK08727233 hypothetical protein; Validated 95.62
PRK06921266 hypothetical protein; Provisional 95.6
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 95.51
TIGR00362405 DnaA chromosomal replication initiator protein Dna 95.49
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 95.49
PRK11331459 5-methylcytosine-specific restriction enzyme subun 95.48
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.47
TIGR01074 664 rep ATP-dependent DNA helicase Rep. Designed to id 95.47
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 95.41
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 95.37
PRK07952244 DNA replication protein DnaC; Validated 95.37
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.36
PRK08084235 DNA replication initiation factor; Provisional 95.28
PRK12402337 replication factor C small subunit 2; Reviewed 95.18
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.17
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 95.14
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 95.12
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 95.08
PF13173128 AAA_14: AAA domain 95.07
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 95.01
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 95.0
PRK05707328 DNA polymerase III subunit delta'; Validated 94.93
PRK00411394 cdc6 cell division control protein 6; Reviewed 94.92
PRK06835329 DNA replication protein DnaC; Validated 94.84
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.84
PRK14088440 dnaA chromosomal replication initiation protein; P 94.77
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 94.76
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 94.75
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 94.72
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 94.71
COG2256436 MGS1 ATPase related to the helicase subunit of the 94.65
PRK09183259 transposase/IS protein; Provisional 94.64
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.58
PRK12422445 chromosomal replication initiation protein; Provis 94.56
PHA02544316 44 clamp loader, small subunit; Provisional 94.56
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 94.54
PRK14086617 dnaA chromosomal replication initiation protein; P 94.51
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 94.44
COG3973 747 Superfamily I DNA and RNA helicases [General funct 94.4
PHA03333 752 putative ATPase subunit of terminase; Provisional 94.4
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 94.36
PF00004132 AAA: ATPase family associated with various cellula 94.29
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 94.27
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 94.27
PRK13851344 type IV secretion system protein VirB11; Provision 94.22
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 94.22
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 94.2
PRK08939306 primosomal protein DnaI; Reviewed 94.16
TIGR01073 726 pcrA ATP-dependent DNA helicase PcrA. Designed to 94.15
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 94.13
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 94.05
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 94.02
PRK00771437 signal recognition particle protein Srp54; Provisi 93.99
PHA03372 668 DNA packaging terminase subunit 1; Provisional 93.98
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 93.96
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 93.94
PRK04195 482 replication factor C large subunit; Provisional 93.91
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 93.89
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 93.83
PLN03025319 replication factor C subunit; Provisional 93.81
smart0049082 HELICc helicase superfamily c-terminal domain. 93.7
COG0593408 DnaA ATPase involved in DNA replication initiation 93.67
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 93.66
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 93.6
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 93.59
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 93.53
PRK106891147 transcription-repair coupling factor; Provisional 93.49
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 93.45
KOG0344593 consensus ATP-dependent RNA helicase [RNA processi 93.43
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.4
PRK09112351 DNA polymerase III subunit delta'; Validated 93.37
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 93.34
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacteria 93.3
PRK13342413 recombination factor protein RarA; Reviewed 93.27
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 93.25
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 93.23
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 93.22
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 93.21
TIGR02928365 orc1/cdc6 family replication initiation protein. M 93.19
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 93.17
PHA02244383 ATPase-like protein 93.17
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 93.14
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 93.12
KOG2170344 consensus ATPase of the AAA+ superfamily [General 93.12
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 93.05
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 93.04
COG0630312 VirB11 Type IV secretory pathway, VirB11 component 92.97
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 92.75
PF02534 469 T4SS-DNA_transf: Type IV secretory system Conjugat 92.71
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 92.7
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 92.7
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 92.59
PRK11823446 DNA repair protein RadA; Provisional 92.4
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 92.29
PTZ00293211 thymidine kinase; Provisional 92.28
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 92.28
KOG0991333 consensus Replication factor C, subunit RFC2 [Repl 92.25
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 92.21
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 92.19
PRK06620214 hypothetical protein; Validated 92.17
PRK13897 606 type IV secretion system component VirD4; Provisio 92.14
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 92.1
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 92.09
PRK13341 725 recombination factor protein RarA/unknown domain f 91.96
TIGR03819340 heli_sec_ATPase helicase/secretion neighborhood AT 91.86
PRK08699325 DNA polymerase III subunit delta'; Validated 91.84
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 91.82
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 91.8
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 91.8
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 91.79
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 91.73
KOG0732 1080 consensus AAA+-type ATPase containing the bromodom 91.72
CHL00181287 cbbX CbbX; Provisional 91.65
KOG0733802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 91.59
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 91.59
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 91.55
KOG0745564 consensus Putative ATP-dependent Clp-type protease 91.55
COG11971139 Mfd Transcription-repair coupling factor (superfam 91.48
PRK06067234 flagellar accessory protein FlaH; Validated 91.42
PRK06964342 DNA polymerase III subunit delta'; Validated 91.34
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 91.3
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 91.3
PRK07940394 DNA polymerase III subunit delta'; Validated 91.27
KOG0741744 consensus AAA+-type ATPase [Posttranslational modi 91.25
KOG2028554 consensus ATPase related to the helicase subunit o 91.24
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 91.2
KOG0733 802 consensus Nuclear AAA ATPase (VCP subfamily) [Post 91.08
TIGR00064272 ftsY signal recognition particle-docking protein F 91.04
PRK07471365 DNA polymerase III subunit delta'; Validated 90.96
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 90.91
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 90.85
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 90.84
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 90.68
PTZ00110545 helicase; Provisional 90.66
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 90.64
KOG0742630 consensus AAA+-type ATPase [Posttranslational modi 90.63
COG0470325 HolB ATPase involved in DNA replication [DNA repli 90.55
PRK08769319 DNA polymerase III subunit delta'; Validated 90.5
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 90.38
PRK10416318 signal recognition particle-docking protein FtsY; 90.35
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 90.34
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 90.34
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 90.3
TIGR02688449 conserved hypothetical protein TIGR02688. Members 90.29
PRK13850 670 type IV secretion system protein VirD4; Provisiona 90.28
PRK00440319 rfc replication factor C small subunit; Reviewed 90.27
PF05876 557 Terminase_GpA: Phage terminase large subunit (GpA) 90.26
TIGR00767415 rho transcription termination factor Rho. Members 90.25
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 90.23
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 90.22
KOG0331519 consensus ATP-dependent RNA helicase [RNA processi 90.13
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 90.11
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 90.04
PRK09087226 hypothetical protein; Validated 90.03
PHA00729226 NTP-binding motif containing protein 89.9
PRK10867433 signal recognition particle protein; Provisional 89.89
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 89.86
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 89.86
PF12846304 AAA_10: AAA-like domain 89.85
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 89.81
KOG1016 1387 consensus Predicted DNA helicase, DEAD-box superfa 89.75
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 89.73
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 89.71
PF05729166 NACHT: NACHT domain 89.67
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 89.66
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 89.63
PF03237384 Terminase_6: Terminase-like family; InterPro: IPR0 89.48
KOG0391 1958 consensus SNF2 family DNA-dependent ATPase [Genera 89.47
TIGR03689512 pup_AAA proteasome ATPase. In the Actinobacteria, 89.45
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 89.43
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 89.37
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 89.36
COG4626 546 Phage terminase-like protein, large subunit [Gener 89.34
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 89.25
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 89.24
COG2255332 RuvB Holliday junction resolvasome, helicase subun 89.07
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 89.06
PRK06871325 DNA polymerase III subunit delta'; Validated 89.02
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 88.94
TIGR00959428 ffh signal recognition particle protein. This mode 88.92
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 88.85
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 88.85
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 88.84
KOG0652424 consensus 26S proteasome regulatory complex, ATPas 88.81
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 88.81
PRK14873 665 primosome assembly protein PriA; Provisional 88.76
PRK14970367 DNA polymerase III subunits gamma and tau; Provisi 88.7
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 88.67
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 88.65
TIGR02012321 tigrfam_recA protein RecA. This model describes or 88.63
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 88.51
PRK10436462 hypothetical protein; Provisional 88.44
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 88.31
PRK08506472 replicative DNA helicase; Provisional 88.26
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 88.18
PRK03992389 proteasome-activating nucleotidase; Provisional 87.97
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 87.94
KOG0333673 consensus U5 snRNP-like RNA helicase subunit [RNA 87.94
PF1355562 AAA_29: P-loop containing region of AAA domain 87.93
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 87.93
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 87.91
PRK13822 641 conjugal transfer coupling protein TraG; Provision 87.77
TIGR00763775 lon ATP-dependent protease La. This protein is ind 87.67
PRK04841 903 transcriptional regulator MalT; Provisional 87.49
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 87.44
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 87.44
PRK05973237 replicative DNA helicase; Provisional 87.38
TIGR02533486 type_II_gspE general secretory pathway protein E. 87.3
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 87.28
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 87.24
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 87.23
KOG0240 607 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] 87.21
PRK06090319 DNA polymerase III subunit delta'; Validated 87.07
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 86.89
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 86.86
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 86.72
PRK09354349 recA recombinase A; Provisional 86.71
TIGR00643630 recG ATP-dependent DNA helicase RecG. 86.7
PRK11747 697 dinG ATP-dependent DNA helicase DinG; Provisional 86.63
PRK07004460 replicative DNA helicase; Provisional 86.61
PTZ00424401 helicase 45; Provisional 86.58
PF06733174 DEAD_2: DEAD_2; InterPro: IPR010614 This represent 86.53
CHL00095821 clpC Clp protease ATP binding subunit 86.52
PRK07993334 DNA polymerase III subunit delta'; Validated 86.27
cd00983325 recA RecA is a bacterial enzyme which has roles in 86.26
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 86.24
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 86.19
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 86.15
PRK06904472 replicative DNA helicase; Validated 86.09
PRK13764602 ATPase; Provisional 86.06
PRK05580 679 primosome assembly protein PriA; Validated 86.04
CHL00176638 ftsH cell division protein; Validated 85.99
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 85.89
cd01128249 rho_factor Transcription termination factor rho is 85.86
PRK13880 636 conjugal transfer coupling protein TraG; Provision 85.86
TIGR00595 505 priA primosomal protein N'. All proteins in this f 85.86
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 85.76
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 85.75
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 85.65
PRK09376416 rho transcription termination factor Rho; Provisio 85.57
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 85.35
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 85.32
KOG0341610 consensus DEAD-box protein abstrakt [RNA processin 85.23
KOG1969 877 consensus DNA replication checkpoint protein CHL12 85.21
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 85.14
COG1198 730 PriA Primosomal protein N' (replication factor Y) 85.11
TIGR02767 623 TraG-Ti Ti-type conjugative transfer system protie 85.02
PRK05298652 excinuclease ABC subunit B; Provisional 84.9
COG1221403 PspF Transcriptional regulators containing an AAA- 84.79
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta s 84.7
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 84.57
PRK13876 663 conjugal transfer coupling protein TraG; Provision 84.57
KOG2228408 consensus Origin recognition complex, subunit 4 [R 84.55
cd03239178 ABC_SMC_head The structural maintenance of chromos 84.53
cd01393226 recA_like RecA is a bacterial enzyme which has rol 84.46
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamid 84.46
PRK13695174 putative NTPase; Provisional 84.36
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 84.34
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 84.33
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 84.15
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 84.08
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 83.82
PF10412386 TrwB_AAD_bind: Type IV secretion-system coupling p 83.73
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 83.71
>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=9.6e-55  Score=418.98  Aligned_cols=304  Identities=39%  Similarity=0.654  Sum_probs=273.1

Q ss_pred             ccccccccCCCCHHHHHHHHHcCCCCCcHHHHHHHHHHHhcCCcEEEEccCCChhhHHHHHHHHHHHHHHHHHHHhhhhh
Q 009003          172 TEFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGLPIMQRLLEEREKAAKMLED  251 (547)
Q Consensus       172 ~~~~~f~~l~l~~~l~~~l~~~~~~~~~~iQ~~~i~~~l~~~~dvli~a~TGsGKT~~~~lp~l~~l~~~~~~~~~~~~~  251 (547)
                      ..+.+|.+|++.+.|++++...||..||+||+++||.++ +|+|||+.|.||||||.+|+|||+++|+..          
T Consensus        58 e~~~sf~dLgv~~~L~~ac~~l~~~~PT~IQ~~aiP~~L-~g~dvIglAeTGSGKT~afaLPIl~~LL~~----------  126 (476)
T KOG0330|consen   58 ESFKSFADLGVHPELLEACQELGWKKPTKIQSEAIPVAL-GGRDVIGLAETGSGKTGAFALPILQRLLQE----------  126 (476)
T ss_pred             hhhcchhhcCcCHHHHHHHHHhCcCCCchhhhhhcchhh-CCCcEEEEeccCCCchhhhHHHHHHHHHcC----------
Confidence            346889999999999999999999999999999999998 799999999999999999999999999764          


Q ss_pred             hhhhhhhcCCCCCeEEEEEccCHHHHHHHHHHHHHhhcCCCcEEEEEEcCCCHHHHHHHhcCCCcEEEeChHHHHHHHhc
Q 009003          252 KGEEAEKYAPKGHLRALIITPTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWELMSG  331 (547)
Q Consensus       252 ~~~~~~~~~~~~~~~~lil~Ptr~La~qv~~~l~~~~~~~~~~v~~~~g~~~~~~~~~~~~~~~dIlv~TP~~l~~~l~~  331 (547)
                                ...+++|||+||||||.||.+.+..++..+|++++++.||.+...+...+..+++|||||||+|++++.+
T Consensus       127 ----------p~~~~~lVLtPtRELA~QI~e~fe~Lg~~iglr~~~lvGG~~m~~q~~~L~kkPhilVaTPGrL~dhl~~  196 (476)
T KOG0330|consen  127 ----------PKLFFALVLTPTRELAQQIAEQFEALGSGIGLRVAVLVGGMDMMLQANQLSKKPHILVATPGRLWDHLEN  196 (476)
T ss_pred             ----------CCCceEEEecCcHHHHHHHHHHHHHhccccCeEEEEEecCchHHHHHHHhhcCCCEEEeCcHHHHHHHHh
Confidence                      2348999999999999999999999999999999999999999999999999999999999999999974


Q ss_pred             CCCCcccCCCccEEEEeccchhhhcCChHHHHHHHHhCCCCCCCCCCCCcccccccccccccCCCcEEEEEeccCCCChh
Q 009003          332 GEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNKGQSEQTQNCVTVSSLQRKKRQTLVFSATIALSAD  411 (547)
Q Consensus       332 ~~~~~~~l~~l~~lViDEah~ll~~~~~~~l~~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~i~~SATl~~~~~  411 (547)
                        .+.+.|..++++|+||||+++++.|...+.+|+..+|                        ..+|+++||||++    
T Consensus       197 --Tkgf~le~lk~LVlDEADrlLd~dF~~~ld~ILk~ip------------------------~erqt~LfsATMt----  246 (476)
T KOG0330|consen  197 --TKGFSLEQLKFLVLDEADRLLDMDFEEELDYILKVIP------------------------RERQTFLFSATMT----  246 (476)
T ss_pred             --ccCccHHHhHHHhhchHHhhhhhhhHHHHHHHHHhcC------------------------ccceEEEEEeecc----
Confidence              4568899999999999999999999999999999999                        7899999999998    


Q ss_pred             HHHHhhhcccccccccCCcchHHHHHHHhcccCceeEEeccccccccccceEEEEEccccchHHHHHHHHHhcCCCcEEE
Q 009003          412 FRKKLKHGSLKSKQSVNGLNSIETLSERAGMRANVAIVDLTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGRTIV  491 (547)
Q Consensus       412 ~~~~l~~~~~~~~~~~~~~~~i~~l~~~~~~~~~~~~i~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~ll~~~~~~k~LV  491 (547)
                                         ..+..+. +. .-.++..+.........+.+.|.|+.++..+|..+|.++++...++.+||
T Consensus       247 -------------------~kv~kL~-ra-sl~~p~~v~~s~ky~tv~~lkQ~ylfv~~k~K~~yLV~ll~e~~g~s~iV  305 (476)
T KOG0330|consen  247 -------------------KKVRKLQ-RA-SLDNPVKVAVSSKYQTVDHLKQTYLFVPGKDKDTYLVYLLNELAGNSVIV  305 (476)
T ss_pred             -------------------hhhHHHH-hh-ccCCCeEEeccchhcchHHhhhheEeccccccchhHHHHHHhhcCCcEEE
Confidence                               2333333 11 22344455566666677789999999999999999999999999999999


Q ss_pred             EeCChHHHHHHHHHHHHcCCceEEecCCcCHHHHHHHHHHHHhhhhcC----CCCCCCCC
Q 009003          492 FCTSIAALRHISSLLKILGIDVWTLHAQMQQRARLKLFSQMITWIRKR----PKGDRGKD  547 (547)
Q Consensus       492 F~~s~~~a~~L~~~L~~~g~~v~~lhg~m~~~eR~~il~~F~~~~~k~----~~g~~~~~  547 (547)
                      ||+|+..++.++-.|+.+|+.+..+||+|++..|..+++.|+++.+..    -.|+||-|
T Consensus       306 F~~t~~tt~~la~~L~~lg~~a~~LhGqmsq~~Rlg~l~~Fk~~~r~iLv~TDVaSRGLD  365 (476)
T KOG0330|consen  306 FCNTCNTTRFLALLLRNLGFQAIPLHGQMSQSKRLGALNKFKAGARSILVCTDVASRGLD  365 (476)
T ss_pred             EEeccchHHHHHHHHHhcCcceecccchhhHHHHHHHHHHHhccCCcEEEecchhcccCC
Confidence            999999999999999999999999999999999999999999987653    34666654

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0347 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0343 consensus RNA Helicase [RNA processing and modification] Back     alignment and domain information
>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification] Back     alignment and domain information
>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>KOG0346 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0334 consensus RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG4284 consensus DEAD box protein [Transcription] Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification] Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>KOG2340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0354 consensus DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription] Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair] Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription] Back     alignment and domain information
>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair] Back     alignment and domain information
>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>KOG1803 consensus DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>KOG1802 consensus RNA helicase nonsense mRNA reducing factor (pNORF1) [RNA processing and modification] Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription] Back     alignment and domain information
>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>KOG1805 consensus DNA replication helicase [Replication, recombination and repair] Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>KOG1131 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 5'-3' helicase subunit RAD3 [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair] Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PHA03372 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG2170 consensus ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair] Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK13897 type IV secretion system component VirD4; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair] Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR02688 conserved hypothetical protein TIGR02688 Back     alignment and domain information
>PRK13850 type IV secretion system protein VirD4; Provisional Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] Back     alignment and domain information
>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only] Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>COG4626 Phage terminase-like protein, large subunit [General function prediction only] Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK13822 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>KOG0240 consensus Kinesin (SMY1 subfamily) [Cytoskeleton] Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>PRK07004 replicative DNA helicase; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK13880 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PRK09376 rho transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02767 TraG-Ti Ti-type conjugative transfer system protien TraG Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK13876 conjugal transfer coupling protein TraG; Provisional Back     alignment and domain information
>KOG2228 consensus Origin recognition complex, subunit 4 [Replication, recombination and repair] Back     alignment and domain information
>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 2e-28
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 6e-28
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 8e-27
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 2e-26
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 4e-25
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 3e-24
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 1e-23
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 8e-23
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 2e-22
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 2e-22
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 8e-22
3sqw_A 579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 2e-21
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 4e-21
3i5x_A 563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 5e-21
3sqx_A 512 Structure Of Mss116p (Nte And C-Tail Double Deletio 7e-21
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 8e-21
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 2e-20
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 3e-20
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 6e-20
2vso_A395 Crystal Structure Of A Translation Initiation Compl 1e-19
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 2e-19
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 5e-19
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 8e-19
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 9e-19
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 1e-18
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 3e-18
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 3e-18
2hyi_C413 Structure Of The Human Exon Junction Complex With A 3e-18
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 3e-18
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 4e-18
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 4e-18
1fuu_A394 Yeast Initiation Factor 4a Length = 394 5e-18
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 7e-18
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 7e-18
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 2e-17
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 2e-17
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 3e-17
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 4e-17
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 8e-17
3ly5_A262 Ddx18 Dead-Domain Length = 262 1e-16
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 1e-14
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 2e-14
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 2e-14
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 2e-14
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 2e-14
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 2e-14
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 5e-14
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 2e-11
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 2e-08
4f91_B 1724 Brr2 Helicase Region Length = 1724 6e-07
4f92_B 1724 Brr2 Helicase Region S1087l Length = 1724 6e-07
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure 
Iteration: 1

 Score =  123 bits (309), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 136/269 (50%), Gaps = 50/269 (18%)
Query: 150 SVAVS-NGPDDAEEELVNEAEISTEFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPA 208
           S+ VS  GPD +   ++         + ++EL+L P +  +I    ++ PTPIQK  IPA
Sbjct: 6   SIPVSVTGPDYSATNVI---------ENFDELKLDPTIRNNILLASYQRPTPIQKNAIPA 56
Query: 209 AAHQGKDVIGAAETGSGKTLAFGLPIMQRLLEEREKAAKMLEDKGEEAEKYAPKGHLRAL 268
                +D++  A+TGSGKT AF +PI+  L+          +D  ++  +Y+   + + L
Sbjct: 57  ILEH-RDIMACAQTGSGKTAAFLIPIINHLV---------CQDLNQQ--RYSKTAYPKCL 104
Query: 269 IITPTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWEL 328
           I+ PTRELA+Q+    +  +    +R   + GG  T  Q R ++    ++V TPGRL + 
Sbjct: 105 ILAPTRELAIQILSESQKFSLNTPLRSCVVYGGADTHSQIREVQMGCHLLVATPGRLVDF 164
Query: 329 MSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNKGQSEQTQNCVT 388
           +   EK+ + L    + VLDEADRM++ G   +++ II+   M +G N            
Sbjct: 165 I---EKNKISLEFCKYIVLDEADRMLDMGFEPQIRKIIEESNMPSGIN------------ 209
Query: 389 VSSLQRKKRQTLVFSATIA-----LSADF 412
                   RQTL+FSAT       L+ADF
Sbjct: 210 --------RQTLMFSATFPKEIQKLAADF 230
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|4F91|B Chain B, Brr2 Helicase Region Length = 1724 Back     alignment and structure
>pdb|4F92|B Chain B, Brr2 Helicase Region S1087l Length = 1724 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query547
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 7e-75
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 9e-69
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 2e-68
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 4e-65
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 1e-64
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 3e-63
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 5e-61
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 1e-60
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 3e-60
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 5e-60
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 1e-59
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 2e-59
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 7e-59
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 7e-59
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 1e-58
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 4e-58
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 4e-57
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 1e-55
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 1e-55
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 3e-55
3bor_A237 Human initiation factor 4A-II; translation initiat 2e-54
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 2e-54
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 1e-53
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 1e-53
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 5e-53
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 2e-50
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 2e-49
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 2e-49
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 7e-49
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 1e-47
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 2e-47
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 4e-12
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 2e-10
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
3b6e_A216 Interferon-induced helicase C domain-containing P; 6e-08
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 6e-07
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 3e-06
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 3e-06
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 5e-06
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 6e-06
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 2e-05
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 5e-05
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 6e-05
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 7e-05
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 2e-04
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 2e-04
1yks_A 440 Genome polyprotein [contains: flavivirin protease 2e-04
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 5e-04
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 Back     alignment and structure
 Score =  246 bits (630), Expect = 7e-75
 Identities = 91/441 (20%), Positives = 176/441 (39%), Gaps = 75/441 (17%)

Query: 107 DGDGDGDEDGSGVQKQEEKNLKN-ETGKKKKKKKKGKKIKTVEESVAVSNGPDDAEEELV 165
           DG+ D    G   +       +N     + + + +    +   +    S      +E+  
Sbjct: 6   DGNRDQRNFGRNQRNNNSNRYRNSRFNSRPRTRSREDDDEVHFDKTTFSKLIHVPKEDNS 65

Query: 166 NEAEISTEFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAA-AHQGKDVIGAAETGS 224
            E  + +  +   E  L   + K+I R++F   TP+Q+  I    + +  DVI  A+TG+
Sbjct: 66  KEVTLDSLLE---EGVLDKEIHKAITRMEFPGLTPVQQKTIKPILSSEDHDVIARAKTGT 122

Query: 225 GKTLAFGLPIMQRLLEEREKAAKMLEDKGEEAEKYAPKGHLRALIITPTRELALQVTDHL 284
           GKT AF +PI Q L+                  K+  +  ++A+I+ PTR+LALQ+   +
Sbjct: 123 GKTFAFLIPIFQHLI----------------NTKFDSQYMVKAVIVAPTRDLALQIEAEV 166

Query: 285 KGVAKG----INVRVVPIVGGMSTEKQ-ERLLKARPEVVVGTPGRLWELMSGGEKHLVEL 339
           K +            V +VGG        ++ K RP +V+ TPGRL +++   +      
Sbjct: 167 KKIHDMNYGLKKYACVSLVGGTDFRAAMNKMNKLRPNIVIATPGRLIDVLE--KYSNKFF 224

Query: 340 HTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNKGQSEQTQNCVTVSSLQRKKRQT 399
             + + VLDEADR++E G   +L++I  +L   N  +                     +T
Sbjct: 225 RFVDYKVLDEADRLLEIGFRDDLETISGILNEKNSKSADN-----------------IKT 267

Query: 400 LVFSATIALSADFRKKLKHGSLKSKQSVNGLNSIETLSERAGMRANVAIVDLTNMCVLAN 459
           L+FSAT+       +KL +  +  K+ +     ++T+ +                     
Sbjct: 268 LLFSATLDDKV---QKLANNIMNKKECL----FLDTVDKNE---------PEA-----HE 306

Query: 460 KLEESFIECKEEDKDAYLYY------ILSVHGQGRTIVFCTSIAALRHISSLLKIL---G 510
           ++++S +  ++     +         I       + I+F  ++     + S+LK      
Sbjct: 307 RIDQSVVISEKFANSIFAAVEHIKKQIKERDSNYKAIIFAPTVKFTSFLCSILKNEFKKD 366

Query: 511 IDVWTLHAQMQQRARLKLFSQ 531
           + +   H ++ Q  R  L  +
Sbjct: 367 LPILEFHGKITQNKRTSLVKR 387
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Length = 172 Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Length = 618 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Length = 459 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query547
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 100.0
3bor_A237 Human initiation factor 4A-II; translation initiat 100.0
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 100.0
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 100.0
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 100.0
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 100.0
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.98
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.97
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.97
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 99.97
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 99.97
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 99.97
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 99.97
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 99.97
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.97
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 99.97
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.96
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.96
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 99.95
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 99.95
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.95
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 99.94
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.94
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 99.93
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 99.93
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 99.92
3h1t_A590 Type I site-specific restriction-modification syst 99.91
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 99.91
1yks_A 440 Genome polyprotein [contains: flavivirin protease 99.91
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 99.91
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 99.91
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.9
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.88
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.88
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.87
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.87
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.86
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.86
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.85
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.84
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.83
3jux_A 822 Protein translocase subunit SECA; protein transloc 99.79
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.79
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.63
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.56
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.53
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.44
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.34
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.07
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.04
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.03
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 98.97
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 98.91
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 98.89
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.89
3eaq_A 212 Heat resistant RNA dependent ATPase; DEAD box RNA 98.84
3i32_A 300 Heat resistant RNA dependent ATPase; RNA helicase, 98.82
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 98.12
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 98.21
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 98.08
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 98.04
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 98.02
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 98.02
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 98.01
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 98.0
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 97.88
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 97.08
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.85
3cpe_A 592 Terminase, DNA packaging protein GP17; large termi 96.8
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 96.42
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.34
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 96.02
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.85
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 95.84
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 95.84
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 95.74
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.52
2chg_A226 Replication factor C small subunit; DNA-binding pr 95.37
3bos_A242 Putative DNA replication factor; P-loop containing 95.32
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.3
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 95.22
2v1u_A387 Cell division control protein 6 homolog; DNA repli 95.15
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 95.05
1pjr_A 724 PCRA; DNA repair, DNA replication, SOS response, h 95.05
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.96
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 94.8
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.79
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 94.74
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 94.67
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 94.61
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 94.59
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 94.47
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 94.44
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 94.4
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.31
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 94.25
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 94.21
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 94.2
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 94.19
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 94.04
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 93.78
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 93.66
2qgz_A308 Helicase loader, putative primosome component; str 93.66
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 93.64
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 93.62
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 93.37
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 93.21
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 93.11
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 92.91
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 92.9
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 92.56
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 92.52
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 92.41
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 91.67
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 91.56
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 91.45
3pvs_A447 Replication-associated recombination protein A; ma 91.33
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 91.31
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 91.23
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 91.06
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 91.0
2r6a_A454 DNAB helicase, replicative helicase; replication, 90.89
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 90.84
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 90.71
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 90.7
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 90.6
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 90.22
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 89.93
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 89.93
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 89.88
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 89.84
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 89.72
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 89.57
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 89.32
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 89.23
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 89.22
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 89.14
2gno_A305 DNA polymerase III, gamma subunit-related protein; 89.02
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 88.98
3hjh_A483 Transcription-repair-coupling factor; MFD, mutatio 88.98
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 88.57
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 88.24
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 88.0
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 88.15
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 88.0
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 87.94
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 87.88
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 87.78
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 87.75
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 87.44
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 87.25
2fna_A357 Conserved hypothetical protein; structural genomic 87.04
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 86.95
3co5_A143 Putative two-component system transcriptional RES 86.87
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 86.86
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 86.24
1yks_A440 Genome polyprotein [contains: flavivirin protease 86.18
2oap_1511 GSPE-2, type II secretion system protein; hexameri 85.47
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 85.47
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 85.24
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 84.03
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 83.11
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 82.88
2z43_A324 DNA repair and recombination protein RADA; archaea 82.69
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 82.54
3foj_A100 Uncharacterized protein; protein SSP1007, structur 82.29
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 82.29
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 82.06
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 81.99
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 81.95
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 81.81
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 81.45
1e9r_A437 Conjugal transfer protein TRWB; coupling protein, 80.99
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 80.88
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 80.04
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=3.7e-45  Score=385.96  Aligned_cols=303  Identities=28%  Similarity=0.453  Sum_probs=257.4

Q ss_pred             cccccccccccCCCCHHHHHHHHHcCCCCCcHHHHHHHHHHHhcCCcEEEEccCCChhhHHHHHHHHHHHHHHHHHHHhh
Q 009003          169 EISTEFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGLPIMQRLLEEREKAAKM  248 (547)
Q Consensus       169 ~~~~~~~~f~~l~l~~~l~~~l~~~~~~~~~~iQ~~~i~~~l~~~~dvli~a~TGsGKT~~~~lp~l~~l~~~~~~~~~~  248 (547)
                      ..|.+..+|.+++|++.++++|..+||..|||+|.++||.++ .|+|++++||||||||++|++|+++++....      
T Consensus        50 ~~p~~~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~ai~~i~-~g~d~i~~a~TGsGKT~a~~lpil~~l~~~~------  122 (434)
T 2db3_A           50 DVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVIS-SGRDLMACAQTGSGKTAAFLLPILSKLLEDP------  122 (434)
T ss_dssp             SCCCCCCCGGGSCCCHHHHHHHHHTTCCSCCHHHHHHHHHHH-TTCCEEEECCTTSSHHHHHHHHHHHHHHHSC------
T ss_pred             CCCCCcCChhhcCCCHHHHHHHHHcCCCCCCHHHHHHHHHHh-cCCCEEEECCCCCCchHHHHHHHHHHHHhcc------
Confidence            345667889999999999999999999999999999999998 7999999999999999999999999986431      


Q ss_pred             hhhhhhhhhhcCCCCCeEEEEEccCHHHHHHHHHHHHHhhcCCCcEEEEEEcCCCHHHHHHHhcCCCcEEEeChHHHHHH
Q 009003          249 LEDKGEEAEKYAPKGHLRALIITPTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWEL  328 (547)
Q Consensus       249 ~~~~~~~~~~~~~~~~~~~lil~Ptr~La~qv~~~l~~~~~~~~~~v~~~~g~~~~~~~~~~~~~~~dIlv~TP~~l~~~  328 (547)
                               ......++++|||+|||+||.|+++++.+++...++++.+++||.....+...+..+++|+|+||++|+++
T Consensus       123 ---------~~~~~~~~~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~  193 (434)
T 2db3_A          123 ---------HELELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDF  193 (434)
T ss_dssp             ---------CCCCTTCCSEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHH
T ss_pred             ---------cccccCCccEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHH
Confidence                     01223468999999999999999999999999889999999999999888888888999999999999999


Q ss_pred             HhcCCCCcccCCCccEEEEeccchhhhcCChHHHHHHHHhCCCCCCCCCCCCcccccccccccccCCCcEEEEEeccCCC
Q 009003          329 MSGGEKHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNKGQSEQTQNCVTVSSLQRKKRQTLVFSATIAL  408 (547)
Q Consensus       329 l~~~~~~~~~l~~l~~lViDEah~ll~~~~~~~l~~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~i~~SATl~~  408 (547)
                      +.+.   .+.+.++++|||||||+|++++|...+..|+..+...                      ..+|+++||||++ 
T Consensus       194 l~~~---~~~l~~~~~lVlDEah~~~~~gf~~~~~~i~~~~~~~----------------------~~~q~l~~SAT~~-  247 (434)
T 2db3_A          194 VDRT---FITFEDTRFVVLDEADRMLDMGFSEDMRRIMTHVTMR----------------------PEHQTLMFSATFP-  247 (434)
T ss_dssp             HHTT---SCCCTTCCEEEEETHHHHTSTTTHHHHHHHHHCTTSC----------------------SSCEEEEEESCCC-
T ss_pred             HHhC---CcccccCCeEEEccHhhhhccCcHHHHHHHHHhcCCC----------------------CCceEEEEeccCC-
Confidence            9654   3678999999999999999999999999999876421                      5689999999998 


Q ss_pred             ChhHHHHhhhcccccccccCCcchHHHHHHHhcccCceeEEeccccccccccceEEEEEccccchHHHHHHHHHhcCCCc
Q 009003          409 SADFRKKLKHGSLKSKQSVNGLNSIETLSERAGMRANVAIVDLTNMCVLANKLEESFIECKEEDKDAYLYYILSVHGQGR  488 (547)
Q Consensus       409 ~~~~~~~l~~~~~~~~~~~~~~~~i~~l~~~~~~~~~~~~i~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~ll~~~~~~k  488 (547)
                                            ..+..++..+  ..++..+...........+.+.+..+....+...|..++..... +
T Consensus       248 ----------------------~~~~~~~~~~--l~~~~~i~~~~~~~~~~~i~~~~~~~~~~~k~~~l~~~l~~~~~-~  302 (434)
T 2db3_A          248 ----------------------EEIQRMAGEF--LKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQAD-G  302 (434)
T ss_dssp             ----------------------HHHHHHHHTT--CSSCEEEEESSTTCCCTTEEEEEEECCGGGHHHHHHHHHHHCCT-T
T ss_pred             ----------------------HHHHHHHHHh--ccCCEEEEeccccccccccceEEEEeCcHHHHHHHHHHHHhCCC-C
Confidence                                  2333443332  22333343333333445678888888888899999999987754 4


Q ss_pred             EEEEeCChHHHHHHHHHHHHcCCceEEecCCcCHHHHHHHHHHHHhhhhc
Q 009003          489 TIVFCTSIAALRHISSLLKILGIDVWTLHAQMQQRARLKLFSQMITWIRK  538 (547)
Q Consensus       489 ~LVF~~s~~~a~~L~~~L~~~g~~v~~lhg~m~~~eR~~il~~F~~~~~k  538 (547)
                      +||||+++..|+.++..|...|+.+..+||+|++.+|.+++++|++|..+
T Consensus       303 ~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~  352 (434)
T 2db3_A          303 TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMK  352 (434)
T ss_dssp             EEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCS
T ss_pred             EEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCc
Confidence            99999999999999999999999999999999999999999999998654
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 547
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 1e-36
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 3e-31
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 1e-29
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 6e-28
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 1e-27
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 2e-27
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 2e-25
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 6e-24
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 2e-23
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 9e-20
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 1e-19
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 1e-17
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 6e-17
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 1e-07
d1t5ia_168 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 2e-05
d1a1va2 299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 3e-05
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 3e-04
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 0.002
d1oywa3 200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 0.002
d1yksa2 299 c.37.1.14 (A:325-623) YFV helicase domain {Yellow 0.003
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score =  133 bits (335), Expect = 1e-36
 Identities = 64/234 (27%), Positives = 112/234 (47%), Gaps = 49/234 (20%)

Query: 173 EFDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGL 232
           E+  +NEL L   ++ +I    F++PT IQ   IP   +   +++  A TGSGKT +F +
Sbjct: 2   EYMNFNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAI 61

Query: 233 PIMQRLLEEREKAAKMLEDKGEEAEKYAPKGHLRALIITPTRELALQVTDHLKGVAKGIN 292
           P+++                            + A+I+TPTRELA+QV D ++ +    N
Sbjct: 62  PLIEL---------------------VNENNGIEAIILTPTRELAIQVADEIESLKGNKN 100

Query: 293 VRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWELMSGGEKHLVELHTLSFFVLDEADR 352
           +++  I GG +   Q + LK    +VVGTPGR+ + +    +  + L  + +F+LDEAD 
Sbjct: 101 LKIAKIYGGKAIYPQIKALK-NANIVVGTPGRILDHI---NRGTLNLKNVKYFILDEADE 156

Query: 353 MIENGHFRELQSIIDMLPMTNGSNKGQSEQTQNCVTVSSLQRKKRQTLVFSATI 406
           M+  G  ++++ I++                           K ++ L+FSAT+
Sbjct: 157 MLNMGFIKDVEKILNACN------------------------KDKRILLFSATM 186
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Length = 299 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query547
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.93
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.93
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.92
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 99.92
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.89
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.73
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.72
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.71
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.71
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.69
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.62
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.24
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.24
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.23
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.14
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.13
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.11
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.03
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.01
d1oywa3 200 RecQ helicase domain {Escherichia coli [TaxId: 562 98.83
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 98.79
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 98.66
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.63
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.5
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.98
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 97.93
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 97.85
d1gkub2 248 Helicase-like "domain" of reverse gyrase {Archaeon 97.79
d1a1va2 299 HCV helicase domain {Human hepatitis C virus (HCV) 97.51
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 97.46
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 97.44
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 97.27
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 97.27
d1z3ix1 346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 97.23
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.79
d2eyqa5 211 Transcription-repair coupling factor, TRCF {Escher 96.71
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 96.24
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.1
d1yksa2 299 YFV helicase domain {Yellow fever virus [TaxId: 11 95.94
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 95.93
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 95.83
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 95.82
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 95.69
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.28
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 95.21
d2qy9a2211 GTPase domain of the signal recognition particle r 95.19
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 94.92
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 94.92
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 94.63
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 94.25
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 94.22
d1gm5a4 206 RecG helicase domain {Thermotoga maritima [TaxId: 94.13
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 94.1
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 94.06
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 93.99
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 93.73
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 93.65
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 93.41
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 93.39
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 93.39
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 93.38
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 93.1
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 92.73
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 92.56
d1ls1a2207 GTPase domain of the signal sequence recognition p 92.54
d1vmaa2213 GTPase domain of the signal recognition particle r 92.46
d1okkd2207 GTPase domain of the signal recognition particle r 92.36
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 91.92
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 91.81
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 91.11
d1j8yf2211 GTPase domain of the signal sequence recognition p 90.87
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 90.6
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 90.37
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 90.19
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 89.97
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 89.94
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 89.84
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 89.57
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 89.49
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 89.44
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 89.18
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 87.03
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 86.39
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 85.32
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 84.91
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 84.84
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 83.95
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 83.3
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 83.28
d1nkta4 219 Translocation ATPase SecA, nucleotide-binding doma 81.09
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 81.03
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 80.89
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 80.54
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 80.45
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 80.08
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 80.03
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.8e-41  Score=317.86  Aligned_cols=186  Identities=31%  Similarity=0.557  Sum_probs=172.9

Q ss_pred             ccccccCCCCHHHHHHHHHcCCCCCcHHHHHHHHHHHhcCCcEEEEccCCChhhHHHHHHHHHHHHHHHHHHHhhhhhhh
Q 009003          174 FDAWNELRLHPLLMKSIYRLQFKEPTPIQKACIPAAAHQGKDVIGAAETGSGKTLAFGLPIMQRLLEEREKAAKMLEDKG  253 (547)
Q Consensus       174 ~~~f~~l~l~~~l~~~l~~~~~~~~~~iQ~~~i~~~l~~~~dvli~a~TGsGKT~~~~lp~l~~l~~~~~~~~~~~~~~~  253 (547)
                      ..+|.+|+|++.++++|.++||..||++|+++||.++ +|+|++++||||||||++|++|+++++.              
T Consensus        16 ~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il-~g~dvi~~a~TGSGKTlayllPil~~l~--------------   80 (222)
T d2j0sa1          16 TPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQII-KGRDVIAQSQSGTGKTATFSISVLQCLD--------------   80 (222)
T ss_dssp             CCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHH-TTCCEEEECCTTSSHHHHHHHHHHHTCC--------------
T ss_pred             CCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHH-CCCCeEEEcCcchhhhhhhccccccccc--------------
Confidence            4579999999999999999999999999999999998 7999999999999999999999999863              


Q ss_pred             hhhhhcCCCCCeEEEEEccCHHHHHHHHHHHHHhhcCCCcEEEEEEcCCCHHHHHHHhcCCCcEEEeChHHHHHHHhcCC
Q 009003          254 EEAEKYAPKGHLRALIITPTRELALQVTDHLKGVAKGINVRVVPIVGGMSTEKQERLLKARPEVVVGTPGRLWELMSGGE  333 (547)
Q Consensus       254 ~~~~~~~~~~~~~~lil~Ptr~La~qv~~~l~~~~~~~~~~v~~~~g~~~~~~~~~~~~~~~dIlv~TP~~l~~~l~~~~  333 (547)
                            .....+++||++|||+||.|+++.+..++...++++..++|+.....+...+..+++|+|+|||+|.+++... 
T Consensus        81 ------~~~~~~~~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~-  153 (222)
T d2j0sa1          81 ------IQVRETQALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRR-  153 (222)
T ss_dssp             ------TTSCSCCEEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTT-
T ss_pred             ------ccccCceeEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhccccc-
Confidence                  2345689999999999999999999999999999999999999998888888889999999999999998654 


Q ss_pred             CCcccCCCccEEEEeccchhhhcCChHHHHHHHHhCCCCCCCCCCCCcccccccccccccCCCcEEEEEeccCC
Q 009003          334 KHLVELHTLSFFVLDEADRMIENGHFRELQSIIDMLPMTNGSNKGQSEQTQNCVTVSSLQRKKRQTLVFSATIA  407 (547)
Q Consensus       334 ~~~~~l~~l~~lViDEah~ll~~~~~~~l~~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~q~i~~SATl~  407 (547)
                        .+.+++++++|+||||+|++.+|...+..|++.++                        +.+|+++||||++
T Consensus       154 --~~~~~~l~~lVlDEaD~ll~~~f~~~i~~I~~~l~------------------------~~~Q~ilfSAT~~  201 (222)
T d2j0sa1         154 --SLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLP------------------------PATQVVLISATLP  201 (222)
T ss_dssp             --SSCCTTCCEEEEETHHHHTSTTTHHHHHHHHTTSC------------------------TTCEEEEEESCCC
T ss_pred             --ccccccceeeeecchhHhhhcCcHHHHHHHHHhCC------------------------CCCEEEEEEEeCC
Confidence              47799999999999999999999999999999998                        6789999999998
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure