Citrus Sinensis ID: 010101


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52
MEVAAKNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSMEFSHISEVDKLIQHPTLPAIVSYRLKSSRKSSDEACKNTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNTKIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPLIALAVGSRGLISQLLGPKFGGFLVYGSLGGKSVPGLPTLVSLKQVYQLEHINPDTKIFGLVSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPAVACCDEVHPLAKSIGAVNTIIRRPIDGKLVGYNTDCESAISAIEDALRERQGINGVASHTSPIAGKIFVLVGAGGAGRALAFGAKSRGARVIIFNRNYERAKALADAVSGEALHFEYLHEFFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGATVVSGVEMFIRQALGQFRLFTGGLAPEDFMRKLVLEQF
cccccccccEEEEEEccccHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHccccccEEEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHccccEEEEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEcccccccHHHHHHHHHHccccEEEEEcccccccHHHccccccccccccccccccccccccHHHHHHHHccccccccccEEEEEcccccccccHHHHHHHHHHcccccEEEEcccccHHHHHHHcccccccEEEEccccHHHHHHHHccccHHHHHHccccEEEEcccccEEEEEcccHHHHHHHHHHHHHHHccccccccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHccccccccccccccccccccEEEEccccccccccccccccccccccccEEEEEcccccccHHHHHHHHcccEEEccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHc
cccccccccEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHcccccEEEEEccccccHHHHEcccccccccccccccccccccccHHHHHHHHHHcccccccEEEEEEEcccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccccEEEccccHHHHHHHHHHccHHHHHHccEEEEEEccccccEEccccHHHHHHHHHHHHccccccccccccccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHcccccccHHHHHHHccccccEEEEccccccccccccccccHHHcccccEEEEEEEcccccHHHHHHHHcccEEEcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHc
MEVAAKNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDsmefshisevdkliqhptlpaiVSYRLkssrkssdeaCKNTCLQVLRRALDLDVEFVEMDYevasdplmsEIIYSRSNTKIIVSSylngggkpttekLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPLIALAVGSrglisqllgpkfggflvygslggksvpglptlvSLKQVYQlehinpdtkifglvsnpvghskgpilhnpafrhtrfngiyvpMLVDDVKEFFRtysgtdfagfsvgiphkepavaccdevhplaksigavntiirrpidgklvgyntDCESAISAIEDALRErqgingvashtspiaGKIFVLVGAGGAGRALAFGAKSRGARVIIFNRNYERAKALADAVSGEALHFEylheffpekGMILANAsaigmepnsdqspvpkEALKAYELVFDAVYTPRNTRLLREAAEVGATVVSGVEMFIRQALGQfrlftgglapeDFMRKLVLEQF
mevaaknsllvCTQLECETTEEMQASIEQAKVEGADLVELCIDSMEFSHISEvdkliqhptlPAIVSYRLKssrkssdeacKNTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNTKIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPLIALAVGSRGLISQLLGPKFGGFLVYGSLGGKSVPGLPTLVSLKQVYQLEHINPDTKIFGLVSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPAVACCDEVHPLAksigavntiirrpidgkLVGYNTDCESAISAIEDALRERQGINGvashtspiAGKIFVLVGAGGAGRALafgaksrgaRVIIFNRNYERAKALADAVSGEALHFEYLHEFFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGATVVSGVEMFIRQALGQFRLFTGGLAPEDFMRKLVLEQF
MEVAAKNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSMEFSHISEVDKLIQHPTLPAIVSYRLKSSRKSSDEACKNTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNTKIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPLIALAVGSRGLISQLLGPKFGGFLVYGSLGGKSVPGLPTLVSLKQVYQLEHINPDTKIFGLVSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPAVACCDEVHPLAKSIGAVNTIIRRPIDGKLVGYNTDCESAISAIEDALRERQGINGVASHTSPIAGKIfvlvgaggagralafgaKSRGARVIIFNRNYERAKALADAVSGEALHFEYLHEFFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGATVVSGVEMFIRQALGQFRLFTGGLAPEDFMRKLVLEQF
***********************************DLVELCIDSMEFSHISEVDKLIQHPTLPAIVSYRL*********ACKNTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNTKIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPLIALAVGSRGLISQLLGPKFGGFLVYGSLGGKSVPGLPTLVSLKQVYQLEHINPDTKIFGLVSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPAVACCDEVHPLAKSIGAVNTIIRRPIDGKLVGYNTDCESAISAIEDALRERQGINGVASHTSPIAGKIFVLVGAGGAGRALAFGAKSRGARVIIFNRNYERAKALADAVSGEALHFEYLHEFFPEKGMILANASA***************ALKAYELVFDAVYTPRNTRLLREAAEVGATVVSGVEMFIRQALGQFRLFTGGLAPEDFMRKLV****
*****KN***VCTQLECETTEEMQASIEQAKVEGADLVELCIDSMEFSHISEVDKLIQHPTLPAIVSYRLKSSRKSSDEACKNTCLQVLRRALDLDVEFVEMDYEVASDPLMS***YSRSNTKIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPLIALAVGSRGLISQLLGPKFGGFLVYGSLGGKSVPGLPTLVSLKQVYQLEHINPDTKIFGLVSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPAVACCDEVHPLAKSIGAVNTIIRRPIDGKLVGYNTDCESAISAIEDALRERQGINGVASHTSPIAGKIFVLVGAGGAGRALAFGAKSRGARVIIFNRNYERAKALADAVSGEALHFEYLHEFFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGATVVSGVEMFIRQALGQFRLFTGGLAPEDFMRKLVLEQF
MEVAAKNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSMEFSHISEVDKLIQHPTLPAIVSYRL**********CKNTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNTKIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPLIALAVGSRGLISQLLGPKFGGFLVYGSLGGKSVPGLPTLVSLKQVYQLEHINPDTKIFGLVSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPAVACCDEVHPLAKSIGAVNTIIRRPIDGKLVGYNTDCESAISAIEDALRERQGINGVASHTSPIAGKIFVLVGAGGAGRALAFGAKSRGARVIIFNRNYERAKALADAVSGEALHFEYLHEFFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGATVVSGVEMFIRQALGQFRLFTGGLAPEDFMRKLVLEQF
***AAKNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSMEFSHISEVDKLIQHPTLPAIVSYRLKSSRKSSDEACKNTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNTKIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPLIALAVGSRGLISQLLGPKFGGFLVYGSLGGKSVPGLPTLVSLKQVYQLEHINPDTKIFGLVSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPAVACCDEVHPLAKSIGAVNTIIRRPIDGKLVGYNTDCESAISAIEDALRE***********SPIAGKIFVLVGAGGAGRALAFGAKSRGARVIIFNRNYERAKALADAVSGEALHFEYLHEFFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGATVVSGVEMFIRQALGQFRLFTGGLAPEDFMRKLVLEQF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVAAKNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSMEFSHISEVDKLIQHPTLPAIVSYRLKSSRKSSDEACKNTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNTKIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPLIALAVGSRGLISQLLGPKFGGFLVYGSLGGKSVPGLPTLVSLKQVYQLEHINPDTKIFGLVSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPAVACCDEVHPLAKSIGAVNTIIRRPIDGKLVGYNTDCESAISAIEDALRERQGINGVASHTSPIAGKIFVLVGAGGAGRALAFGAKSRGARVIIFNRNYERAKALADAVSGEALHFEYLHEFFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGATVVSGVEMFIRQALGQFRLFTGGLAPEDFMRKLVLEQF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query518 2.2.26 [Sep-21-2011]
Q9SQT8603 Bifunctional 3-dehydroqui yes no 0.978 0.840 0.472 1e-121
A9VHW1277 Shikimate dehydrogenase O yes no 0.513 0.960 0.340 1e-40
Q818D0277 Shikimate dehydrogenase O yes no 0.509 0.953 0.344 3e-40
B7HCW1277 Shikimate dehydrogenase O yes no 0.509 0.953 0.344 3e-40
B7IYI7277 Shikimate dehydrogenase O yes no 0.509 0.953 0.344 4e-40
C3L5T8277 Shikimate dehydrogenase O yes no 0.509 0.953 0.344 9e-40
B9IYA1277 Shikimate dehydrogenase O yes no 0.513 0.960 0.347 1e-39
B7HPN3277 Shikimate dehydrogenase O yes no 0.513 0.960 0.347 1e-39
Q6HDI8277 Shikimate dehydrogenase O yes no 0.509 0.953 0.344 2e-39
Q634K8277 Shikimate dehydrogenase O yes no 0.509 0.953 0.344 2e-39
>sp|Q9SQT8|DHQSD_ARATH Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic OS=Arabidopsis thaliana GN=EMB3004 PE=1 SV=1 Back     alignment and function desciption
 Score =  435 bits (1119), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 242/512 (47%), Positives = 342/512 (66%), Gaps = 5/512 (0%)

Query: 6   KNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSM-EFSHISEVDKLIQHPTLPA 64
           KN  L+C  +  ++ ++M     +A   GADLVE+ +D + +F+ + ++  +I+   LP 
Sbjct: 91  KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPLEDLKTIIKKSPLPT 150

Query: 65  IVSYRLKSSRKSSDEACKNTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNTKI 124
           + +YR K       E  +N    VLR A++L  ++++++ +VAS+ + S         K+
Sbjct: 151 LFTYRPKW-EGGQYEGDENERRDVLRLAMELGADYIDVELQVASEFIKSIDGKKPGKFKV 209

Query: 125 IVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPLIA 184
           IVSS+ N    P+ E L  ++A +Q TGAD++K+      I D+A +F + +  QVP I 
Sbjct: 210 IVSSH-NYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHITSKAQVPTIG 268

Query: 185 LAVGSRGLISQLLGPKFGGFLVYGSLGGKSV--PGLPTLVSLKQVYQLEHINPDTKIFGL 242
           L +G RGL+S++L  KFGG+L +G+L    V  PG PT+  L  +Y    I PDTK++G+
Sbjct: 269 LVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVYGI 328

Query: 243 VSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPA 302
           +  PV HSK PI+HN AF+   FNG+YV +LVD++  F + YS +DFAGFS  IPHKE A
Sbjct: 329 IGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKEAA 388

Query: 303 VACCDEVHPLAKSIGAVNTIIRRPIDGKLVGYNTDCESAISAIEDALRERQGINGVASHT 362
           + CCDEV PLAKSIGAVNTI+RR  DGKL+GYNTDC  +ISAIED LR     + V S +
Sbjct: 389 LQCCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGSISAIEDGLRSSGDPSSVPSSS 448

Query: 363 SPIAGKIFVLVGAGGAGRALAFGAKSRGARVIIFNRNYERAKALADAVSGEALHFEYLHE 422
           SP+A K  V++GAGGAG+ALA+GAK +GA+V+I NR YERA  LA+A+ G+AL    L  
Sbjct: 449 SPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYERALELAEAIGGKALSLTDLDN 508

Query: 423 FFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGATV 482
           + PE GM+LAN +++GM+PN +++P+ K+ALK Y LVFDAVYTPR TRLLREA E GA  
Sbjct: 509 YHPEDGMVLANTTSMGMQPNVEETPISKDALKHYALVFDAVYTPRITRLLREAEESGAIT 568

Query: 483 VSGVEMFIRQALGQFRLFTGGLAPEDFMRKLV 514
           VSG EMF+RQA  QF +FTG  AP++   +++
Sbjct: 569 VSGSEMFVRQAYEQFEIFTGLPAPKELYWQIM 600





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 5
>sp|A9VHW1|AROE_BACWK Shikimate dehydrogenase OS=Bacillus weihenstephanensis (strain KBAB4) GN=aroE PE=3 SV=1 Back     alignment and function description
>sp|Q818D0|AROE_BACCR Shikimate dehydrogenase OS=Bacillus cereus (strain ATCC 14579 / DSM 31) GN=aroE PE=3 SV=1 Back     alignment and function description
>sp|B7HCW1|AROE_BACC4 Shikimate dehydrogenase OS=Bacillus cereus (strain B4264) GN=aroE PE=3 SV=1 Back     alignment and function description
>sp|B7IYI7|AROE_BACC2 Shikimate dehydrogenase OS=Bacillus cereus (strain G9842) GN=aroE PE=3 SV=1 Back     alignment and function description
>sp|C3L5T8|AROE_BACAC Shikimate dehydrogenase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=aroE PE=3 SV=1 Back     alignment and function description
>sp|B9IYA1|AROE_BACCQ Shikimate dehydrogenase OS=Bacillus cereus (strain Q1) GN=aroE PE=3 SV=1 Back     alignment and function description
>sp|B7HPN3|AROE_BACC7 Shikimate dehydrogenase OS=Bacillus cereus (strain AH187) GN=aroE PE=3 SV=1 Back     alignment and function description
>sp|Q6HDI8|AROE_BACHK Shikimate dehydrogenase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=aroE PE=3 SV=1 Back     alignment and function description
>sp|Q634K8|AROE_BACCZ Shikimate dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=aroE PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
255559348515 shikimate dehydrogenase, putative [Ricin 0.994 1.0 0.771 0.0
224128592504 dehydroquinate dehydratase/ shikimate de 0.972 1.0 0.769 0.0
255542470519 shikimate dehydrogenase, putative [Ricin 0.982 0.980 0.575 1e-156
116787099514 unknown [Picea sitchensis] 0.980 0.988 0.566 1e-155
224130894518 dehydroquinate dehydratase/ shikimate de 0.980 0.980 0.571 1e-154
225451144519 PREDICTED: bifunctional 3-dehydroquinate 0.986 0.984 0.554 1e-153
57920902521 3-dehydroquinate dehydratase / shikimate 0.986 0.980 0.565 1e-153
224125426518 dehydroquinate dehydratase/ shikimate de 0.982 0.982 0.563 1e-153
356504076524 PREDICTED: bifunctional 3-dehydroquinate 0.986 0.975 0.551 1e-147
224128596337 predicted protein [Populus trichocarpa] 0.650 1.0 0.820 1e-147
>gi|255559348|ref|XP_002520694.1| shikimate dehydrogenase, putative [Ricinus communis] gi|223540079|gb|EEF41656.1| shikimate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  783 bits (2022), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/516 (77%), Positives = 455/516 (88%), Gaps = 1/516 (0%)

Query: 3   VAAKNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSMEFSHISEVDKLIQHPTL 62
           +A +N+LLVCT LECET  EM + +E+A+ EGADLVEL +DSM FSHIS+V+KLI+  TL
Sbjct: 1   MAFQNNLLVCTPLECETAGEMLSCMEKARGEGADLVELRVDSMSFSHISQVEKLIKLRTL 60

Query: 63  PAIVSYRLKSSRKSSDEACKNTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNT 122
           PAIVS+R K+S+ SS+   K TCLQVL  ALDLDVEFVEM+YEVASD  M+E IY+RS+ 
Sbjct: 61  PAIVSFRPKTSKISSNGDSKKTCLQVLSLALDLDVEFVEMEYEVASDVSMAEYIYNRSSG 120

Query: 123 KIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPL 182
           K+IVSSY+NGG KP+ EKLG++IA +Q+TGADV+KL I VD ITDLAPVF+ML HCQVPL
Sbjct: 121 KLIVSSYVNGG-KPSAEKLGNLIANLQSTGADVIKLVINVDYITDLAPVFKMLAHCQVPL 179

Query: 183 IALAVGSRGLISQLLGPKFGGFLVYGSLGGKSVPGLPTLVSLKQVYQLEHINPDTKIFGL 242
           IALAVGSRGLISQLLGPKFGGFLVYGSL  K+VPG+PTL SL+ VY+LE+IN DTK+FGL
Sbjct: 180 IALAVGSRGLISQLLGPKFGGFLVYGSLRDKAVPGMPTLFSLRHVYKLEYINSDTKVFGL 239

Query: 243 VSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPA 302
           +SNPVGHSKGPILHNPAFRHT +NGIYVPM VDD+KEFFRTY+ TDFAGFSVGIPHKE A
Sbjct: 240 ISNPVGHSKGPILHNPAFRHTGYNGIYVPMQVDDIKEFFRTYTSTDFAGFSVGIPHKEAA 299

Query: 303 VACCDEVHPLAKSIGAVNTIIRRPIDGKLVGYNTDCESAISAIEDALRERQGINGVASHT 362
           V+CCDEVHPLAKSIGAVNTI+RRP DGKLVGYNTDCE++I+AIEDALRER+  N  A  T
Sbjct: 300 VSCCDEVHPLAKSIGAVNTIVRRPTDGKLVGYNTDCEASITAIEDALRERRPTNRGALDT 359

Query: 363 SPIAGKIFVLVGAGGAGRALAFGAKSRGARVIIFNRNYERAKALADAVSGEALHFEYLHE 422
           SP+AGK FVL+GAGGAGRALAFGA SRGARV++FNRN+ERAK+LA+AVSGEAL ++ L  
Sbjct: 360 SPLAGKTFVLIGAGGAGRALAFGASSRGARVVVFNRNFERAKSLANAVSGEALPYKALDR 419

Query: 423 FFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGATV 482
           F  E  MILANASA+GMEPN+ QSPV KEALK+YELVFDAVYTPRNTRLL+EA EVGA V
Sbjct: 420 FQRENDMILANASAVGMEPNTHQSPVSKEALKSYELVFDAVYTPRNTRLLQEAKEVGAVV 479

Query: 483 VSGVEMFIRQALGQFRLFTGGLAPEDFMRKLVLEQF 518
           VSGVEMFIRQALGQFRLFTGGLAPE FMRKLVLEQF
Sbjct: 480 VSGVEMFIRQALGQFRLFTGGLAPEAFMRKLVLEQF 515




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224128592|ref|XP_002320370.1| dehydroquinate dehydratase/ shikimate dehydrogenase [Populus trichocarpa] gi|222861143|gb|EEE98685.1| dehydroquinate dehydratase/ shikimate dehydrogenase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255542470|ref|XP_002512298.1| shikimate dehydrogenase, putative [Ricinus communis] gi|223548259|gb|EEF49750.1| shikimate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|116787099|gb|ABK24375.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|224130894|ref|XP_002328402.1| dehydroquinate dehydratase/ shikimate dehydrogenase [Populus trichocarpa] gi|222838117|gb|EEE76482.1| dehydroquinate dehydratase/ shikimate dehydrogenase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225451144|ref|XP_002270055.1| PREDICTED: bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic [Vitis vinifera] gi|298204989|emb|CBI34296.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|57920902|gb|AAS90324.2| 3-dehydroquinate dehydratase / shikimate dehydrogenase isoform 2 [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|224125426|ref|XP_002319583.1| dehydroquinate dehydratase/ shikimate dehydrogenase [Populus trichocarpa] gi|222857959|gb|EEE95506.1| dehydroquinate dehydratase/ shikimate dehydrogenase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356504076|ref|XP_003520825.1| PREDICTED: bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|224128596|ref|XP_002320371.1| predicted protein [Populus trichocarpa] gi|222861144|gb|EEE98686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query518
TAIR|locus:2081036603 MEE32 "MATERNAL EFFECT EMBRYO 0.967 0.830 0.454 5.8e-114
TIGR_CMR|BA_4561308 BA_4561 "shikimate 5-dehydroge 0.509 0.857 0.313 2.3e-32
TIGR_CMR|CHY_0623280 CHY_0623 "shikimate 5-dehydrog 0.511 0.946 0.295 2.6e-26
TIGR_CMR|DET_0465286 DET_0465 "shikimate 5-dehydrog 0.503 0.912 0.291 2e-25
TIGR_CMR|SPO_3891277 SPO_3891 "shikimate 5-dehydrog 0.482 0.902 0.309 1.2e-24
POMBASE|SPAC1834.021573 aro1 "pentafunctional aromatic 0.868 0.286 0.272 1.9e-20
CGD|CAL00043461551 ARO1 [Candida albicans (taxid: 0.915 0.305 0.264 1.4e-19
ASPGD|ASPL00000559691583 aromA [Emericella nidulans (ta 0.594 0.194 0.293 2.7e-19
TIGR_CMR|GSU_1490286 GSU_1490 "shikimate 5-dehydrog 0.511 0.926 0.266 3e-19
SGD|S0000025341588 ARO1 "Pentafunctional arom pro 0.934 0.304 0.254 2.4e-18
TAIR|locus:2081036 MEE32 "MATERNAL EFFECT EMBRYO ARREST 32" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1124 (400.7 bits), Expect = 5.8e-114, P = 5.8e-114
 Identities = 230/506 (45%), Positives = 323/506 (63%)

Query:     6 KNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSM-EFSHISEVDKLIQHPTLPA 64
             KN  L+C  +  ++ ++M     +A   GADLVE+ +D + +F+ + ++  +I+   LP 
Sbjct:    91 KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPLEDLKTIIKKSPLPT 150

Query:    65 IVSYRLKSSRKSSDEACKNTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNTKI 124
             + +YR K       E  +N    VLR A++L  ++++++ +VAS+ + S         K+
Sbjct:   151 LFTYRPKWEG-GQYEGDENERRDVLRLAMELGADYIDVELQVASEFIKSIDGKKPGKFKV 209

Query:   125 IVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPLIA 184
             IVSS+ N    P+ E L  ++A +Q TGAD++K+      I D+A +F + +  QVP I 
Sbjct:   210 IVSSH-NYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHITSKAQVPTIG 268

Query:   185 LAVGSRGLISQLLGPKFGGFLVYGSLGGKSV--PGLPTLVSLKQVYQLEHINPDTKIFGL 242
             L +G RGL+S++L  KFGG+L +G+L    V  PG PT+  L  +Y    I PDTK++G+
Sbjct:   269 LVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVYGI 328

Query:   243 VSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPA 302
             +  PV HSK PI+HN AF+   FNG+YV +LVD++  F + YS +DFAGFS  IPHKE A
Sbjct:   329 IGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKEAA 388

Query:   303 VACCDEVHPLAKSIGAVNTIIRRPIDGKLVGYNTDCESAISAIEDALRERQGINGVASHT 362
             + CCDEV PLAKSIGAVNTI+RR  DGKL+GYNTDC  +ISAIED LR     + V S +
Sbjct:   389 LQCCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGSISAIEDGLRSSGDPSSVPSSS 448

Query:   363 SPIAGKIXXXXXXXXXXXXXXXXXKSRGARVIIFNRNYERAKALADAVSGEALHFEYLHE 422
             SP+A K                  K +GA+V+I NR YERA  LA+A+ G+AL    L  
Sbjct:   449 SPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYERALELAEAIGGKALSLTDLDN 508

Query:   423 FFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGATV 482
             + PE GM+LAN +++GM+PN +++P+ K+ALK Y LVFDAVYTPR TRLLREA E GA  
Sbjct:   509 YHPEDGMVLANTTSMGMQPNVEETPISKDALKHYALVFDAVYTPRITRLLREAEESGAIT 568

Query:   483 VSGVEMFIRQALGQFRLFTGGLAPED 508
             VSG EMF+RQA  QF +FTG  AP++
Sbjct:   569 VSGSEMFVRQAYEQFEIFTGLPAPKE 594




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0003855 "3-dehydroquinate dehydratase activity" evidence=IEA;IDA
GO:0004764 "shikimate 3-dehydrogenase (NADP+) activity" evidence=IEA;IDA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP;NAS
GO:0050661 "NADP binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0019632 "shikimate metabolic process" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0006865 "amino acid transport" evidence=RCA
TIGR_CMR|BA_4561 BA_4561 "shikimate 5-dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0623 CHY_0623 "shikimate 5-dehydrogenase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0465 DET_0465 "shikimate 5-dehydrogenase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_3891 SPO_3891 "shikimate 5-dehydrogenase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
POMBASE|SPAC1834.02 aro1 "pentafunctional aromatic polypeptide Aro1 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0004346 ARO1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
ASPGD|ASPL0000055969 aromA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1490 GSU_1490 "shikimate 5-dehydrogenase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
SGD|S000002534 ARO1 "Pentafunctional arom protein" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SQT8DHQSD_ARATH1, ., 1, ., 1, ., 2, 50.47260.97870.8407yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer4.2.1.100.914
3rd Layer1.1.10.921
3rd Layer4.2.10.921
4th Layer1.1.1.250.914

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
DHQD5
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25 4.2.1.10) (504 aa)
(Populus trichocarpa)
Predicted Functional Partners:
DHQS6
SubName- Full=Putative uncharacterized protein; (375 aa)
   0.972
SK2
shikimate kinase (EC-2.7.1.71) (286 aa)
     0.951
SK3
shikimate kinase (EC-2.7.1.71) (294 aa)
     0.949
SKp
shikimate kinase (EC-2.7.1.71) (223 aa)
     0.947
SK1
shikimate kinase (EC-2.7.1.71) (286 aa)
     0.939
DHQD2
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25) (521 aa)
     0.903
DHQD4
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25) (518 aa)
     0.903
DHQD3
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25 4.2.1.10) (518 aa)
     0.902
DHQD1
dehydroquinate dehydratase/ shikimate dehydrogenase (EC-1.1.1.25 4.2.1.10) (518 aa)
     0.902
EPSPS
3-phosphoshikimate 1-carboxyvinyltransferase (EC-2.5.1.19) (519 aa)
   0.686

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
PLN02520529 PLN02520, PLN02520, bifunctional 3-dehydroquinate 0.0
COG0169283 COG0169, AroE, Shikimate 5-dehydrogenase [Amino ac 1e-82
PRK00258278 PRK00258, aroE, shikimate 5-dehydrogenase; Reviewe 1e-76
TIGR00507270 TIGR00507, aroE, shikimate 5-dehydrogenase 2e-64
PRK12548289 PRK12548, PRK12548, shikimate 5-dehydrogenase; Pro 7e-42
cd01065155 cd01065, NAD_bind_Shikimate_DH, NAD(P) binding dom 4e-37
PRK09310477 PRK09310, aroDE, bifunctional 3-dehydroquinate deh 6e-37
pfam01487222 pfam01487, DHquinase_I, Type I 3-dehydroquinase 3e-34
PRK12550272 PRK12550, PRK12550, shikimate 5-dehydrogenase; Rev 4e-33
PRK12749288 PRK12749, PRK12749, quinate/shikimate dehydrogenas 9e-32
PRK12549284 PRK12549, PRK12549, shikimate 5-dehydrogenase; Rev 3e-31
cd00502225 cd00502, DHQase_I, Type I 3-dehydroquinase, (3-deh 2e-27
TIGR01809282 TIGR01809, Shik-DH-AROM, shikimate-5-dehydrogenase 7e-27
pfam0850183 pfam08501, Shikimate_dh_N, Shikimate dehydrogenase 1e-25
TIGR01093228 TIGR01093, aroD, 3-dehydroquinate dehydratase, typ 7e-25
PRK14027283 PRK14027, PRK14027, quinate/shikimate dehydrogenas 2e-20
COG0710231 COG0710, AroD, 3-dehydroquinate dehydratase [Amino 8e-18
PRK02412253 PRK02412, aroD, 3-dehydroquinate dehydratase; Prov 3e-10
pfam01488133 pfam01488, Shikimate_DH, Shikimate / quinate 5-deh 1e-09
PRK13575238 PRK13575, PRK13575, 3-dehydroquinate dehydratase; 2e-07
COG0373414 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme m 3e-07
PRK00045423 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed 3e-07
cd05213311 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-bindi 1e-06
TIGR01035417 TIGR01035, hemA, glutamyl-tRNA reductase 1e-05
PRK08277 278 PRK08277, PRK08277, D-mannonate oxidoreductase; Pr 5e-04
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 0.002
PRK05872 296 PRK05872, PRK05872, short chain dehydrogenase; Pro 0.003
cd12161315 cd12161, GDH_like_1, Putative glycerate dehydrogen 0.004
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 0.004
PRK08324 681 PRK08324, PRK08324, short chain dehydrogenase; Val 0.004
>gnl|CDD|178135 PLN02520, PLN02520, bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
 Score =  603 bits (1556), Expect = 0.0
 Identities = 264/516 (51%), Positives = 355/516 (68%), Gaps = 14/516 (2%)

Query: 4   AAKNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSME-FSHISEVDKLIQHPTL 62
             +N  L+C  +  ++ ++M   + +AK  GADLVE+ +D ++ F+   ++  LI+   L
Sbjct: 18  VRRNPTLICVPIMADSVDKMLIEMAKAKELGADLVEIRLDFLKNFNPREDLKTLIKQSPL 77

Query: 63  PAIVSYRLK--SSRKSSDEACKNTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRS 120
           P +V+YR K    +   DE   N     LR A++L  ++V+++ +VA    ++ I   + 
Sbjct: 78  PTLVTYRPKWEGGQYEGDE---NKRQDALRLAMELGADYVDVELKVA-HEFINSISGKKP 133

Query: 121 -NTKIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQ 179
              K+IVSS+ N    P+ E+LG+++A +QATGAD++K+      ITD+A +F++  H Q
Sbjct: 134 EKCKVIVSSH-NYENTPSVEELGNLVARIQATGADIVKIATTALDITDVARMFQITVHSQ 192

Query: 180 VPLIALAVGSRGLISQLLGPKFGGFLVYGSL--GGKSVPGLPTLVSLKQVYQLEHINPDT 237
           VP I L +G RGLIS++L PKFGG+L +G+L  G  S PG PT+  L  +Y    I PDT
Sbjct: 193 VPTIGLVMGERGLISRILCPKFGGYLTFGTLEAGKVSAPGQPTIKDLLDLYNFRQIGPDT 252

Query: 238 KIFGLVSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIP 297
           K++G++  PVGHSK PILHN AF+   FNG+YV +LVDD+ +F +TYS  DFAGFS  IP
Sbjct: 253 KVYGIIGKPVGHSKSPILHNEAFKSVGFNGVYVHLLVDDLAKFLQTYSSPDFAGFSCTIP 312

Query: 298 HKEPAVACCDEVHPLAKSIGAVNTIIRRPIDGKLVGYNTDCESAISAIEDALRERQGING 357
           HKE A+ CCDEV P+AKSIGA+NTIIRRP DGKLVGYNTD   AISAIED LR       
Sbjct: 313 HKEDALKCCDEVDPIAKSIGAINTIIRRPSDGKLVGYNTDYIGAISAIEDGLR---ASGS 369

Query: 358 VASHTSPIAGKIFVLVGAGGAGRALAFGAKSRGARVIIFNRNYERAKALADAVSGEALHF 417
             +  SP+AGK+FV++GAGGAG+ALA+GAK +GARV+I NR YERAK LADAV G+AL  
Sbjct: 370 SPASGSPLAGKLFVVIGAGGAGKALAYGAKEKGARVVIANRTYERAKELADAVGGQALTL 429

Query: 418 EYLHEFFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAE 477
             L  F PE+GMILAN +++GM+PN D++P+ K ALK Y LVFDAVYTP+ TRLLREA E
Sbjct: 430 ADLENFHPEEGMILANTTSVGMQPNVDETPISKHALKHYSLVFDAVYTPKITRLLREAEE 489

Query: 478 VGATVVSGVEMFIRQALGQFRLFTGGLAPEDFMRKL 513
            GA +VSG EMFIRQA  QF  FTG  AP++  R++
Sbjct: 490 SGAIIVSGTEMFIRQAYEQFERFTGLPAPKELFREI 525


Length = 529

>gnl|CDD|223247 COG0169, AroE, Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|234703 PRK00258, aroE, shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|161904 TIGR00507, aroE, shikimate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|183585 PRK12548, PRK12548, shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|133443 cd01065, NAD_bind_Shikimate_DH, NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>gnl|CDD|137204 PRK09310, aroDE, bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>gnl|CDD|216526 pfam01487, DHquinase_I, Type I 3-dehydroquinase Back     alignment and domain information
>gnl|CDD|183587 PRK12550, PRK12550, shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|183721 PRK12749, PRK12749, quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|183586 PRK12549, PRK12549, shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|188633 cd00502, DHQase_I, Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase) Back     alignment and domain information
>gnl|CDD|233580 TIGR01809, Shik-DH-AROM, shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>gnl|CDD|149523 pfam08501, Shikimate_dh_N, Shikimate dehydrogenase substrate binding domain Back     alignment and domain information
>gnl|CDD|233268 TIGR01093, aroD, 3-dehydroquinate dehydratase, type I Back     alignment and domain information
>gnl|CDD|172521 PRK14027, PRK14027, quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223782 COG0710, AroD, 3-dehydroquinate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|235036 PRK02412, aroD, 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|216527 pfam01488, Shikimate_DH, Shikimate / quinate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|184156 PRK13575, PRK13575, 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|223450 COG0373, HemA, Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|234592 PRK00045, hemA, glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>gnl|CDD|133452 cd05213, NAD_bind_Glutamyl_tRNA_reduct, NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>gnl|CDD|233242 TIGR01035, hemA, glutamyl-tRNA reductase Back     alignment and domain information
>gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240638 cd12161, GDH_like_1, Putative glycerate dehydrogenase and related proteins of the D-specific 2-hydroxy dehydrogenase family Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 518
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 100.0
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 100.0
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 100.0
PRK14027283 quinate/shikimate dehydrogenase; Provisional 100.0
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 100.0
PRK12549284 shikimate 5-dehydrogenase; Reviewed 100.0
PRK12548289 shikimate 5-dehydrogenase; Provisional 100.0
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 100.0
PRK12550272 shikimate 5-dehydrogenase; Reviewed 100.0
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 100.0
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 100.0
PRK02412253 aroD 3-dehydroquinate dehydratase; Provisional 100.0
COG0710231 AroD 3-dehydroquinate dehydratase [Amino acid tran 100.0
TIGR01093228 aroD 3-dehydroquinate dehydratase, type I. Type II 100.0
PF01487224 DHquinase_I: Type I 3-dehydroquinase; InterPro: IP 100.0
cd00502225 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinat 100.0
PRK13575238 3-dehydroquinate dehydratase; Provisional 100.0
PRK13576216 3-dehydroquinate dehydratase; Provisional 100.0
PRK01261229 aroD 3-dehydroquinate dehydratase; Provisional 100.0
KOG0692595 consensus Pentafunctional AROM protein [Amino acid 100.0
PF0850183 Shikimate_dh_N: Shikimate dehydrogenase substrate 99.95
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 99.91
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 99.91
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 99.64
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 99.6
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 99.5
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 99.4
PRK08291330 ectoine utilization protein EutC; Validated 99.32
TIGR02992326 ectoine_eutC ectoine utilization protein EutC. Mem 99.31
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 99.26
PRK13940414 glutamyl-tRNA reductase; Provisional 99.26
PRK08306296 dipicolinate synthase subunit A; Reviewed 99.24
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 99.18
PLN00203519 glutamyl-tRNA reductase 98.8
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 98.77
PRK06141314 ornithine cyclodeaminase; Validated 98.61
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 98.59
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.59
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 98.54
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 98.52
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.43
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 98.42
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.36
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 98.34
PRK08618325 ornithine cyclodeaminase; Validated 98.32
PRK07340304 ornithine cyclodeaminase; Validated 98.26
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.23
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 98.23
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.22
PRK14982340 acyl-ACP reductase; Provisional 98.17
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 98.13
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.13
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.11
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.08
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.08
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 98.07
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 98.05
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.05
PRK00676338 hemA glutamyl-tRNA reductase; Validated 98.04
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.02
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 98.01
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 98.01
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.96
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 97.95
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.93
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 97.93
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and relate 97.91
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.91
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.9
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.9
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.9
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 97.88
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 97.88
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.85
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.85
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.85
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.82
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.82
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 97.8
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.8
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.79
PRK06046326 alanine dehydrogenase; Validated 97.75
TIGR00872 298 gnd_rel 6-phosphogluconate dehydrogenase (decarbox 97.71
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.71
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.71
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transpor 97.68
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 97.65
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.65
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 97.65
COG0300265 DltE Short-chain dehydrogenases of various substra 97.63
PRK06823315 ornithine cyclodeaminase; Validated 97.61
KOG0409 327 consensus Predicted dehydrogenase [General functio 97.61
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 97.6
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.57
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 97.56
TIGR02371325 ala_DH_arch alanine dehydrogenase, Archaeoglobus f 97.55
PTZ00075476 Adenosylhomocysteinase; Provisional 97.55
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Rev 97.55
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 97.54
PRK15461 296 NADH-dependent gamma-hydroxybutyrate dehydrogenase 97.53
TIGR01505 291 tartro_sem_red 2-hydroxy-3-oxopropionate reductase 97.53
PLN02928347 oxidoreductase family protein 97.52
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 97.5
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.49
PRK12490 299 6-phosphogluconate dehydrogenase-like protein; Rev 97.47
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 97.46
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.45
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.44
PRK08328231 hypothetical protein; Provisional 97.44
PRK13243333 glyoxylate reductase; Reviewed 97.44
PF02423313 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst 97.44
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 97.43
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 97.43
PLN02350 493 phosphogluconate dehydrogenase (decarboxylating) 97.43
PRK08655 437 prephenate dehydrogenase; Provisional 97.43
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 97.42
PRK06407301 ornithine cyclodeaminase; Provisional 97.42
PRK06199379 ornithine cyclodeaminase; Validated 97.36
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 97.36
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.35
PRK07589346 ornithine cyclodeaminase; Validated 97.35
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 97.35
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 97.35
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.33
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 97.28
PRK07417 279 arogenate dehydrogenase; Reviewed 97.28
PLN02256 304 arogenate dehydrogenase 97.26
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 97.25
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 97.24
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.23
TIGR00873 467 gnd 6-phosphogluconate dehydrogenase, decarboxylat 97.22
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 97.21
PRK05479 330 ketol-acid reductoisomerase; Provisional 97.21
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 97.12
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 97.1
KOG4230 935 consensus C1-tetrahydrofolate synthase [Coenzyme t 97.1
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 97.1
PRK06719157 precorrin-2 dehydrogenase; Validated 97.08
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 97.07
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 97.07
COG2423330 Predicted ornithine cyclodeaminase, mu-crystallin 97.07
PLN02494477 adenosylhomocysteinase 97.07
PTZ00142 470 6-phosphogluconate dehydrogenase; Provisional 97.07
PRK06476 258 pyrroline-5-carboxylate reductase; Reviewed 97.06
PRK13403 335 ketol-acid reductoisomerase; Provisional 97.04
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 97.01
PRK13304 265 L-aspartate dehydrogenase; Reviewed 97.0
PRK05866 293 short chain dehydrogenase; Provisional 96.98
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 96.97
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 96.96
PRK06545 359 prephenate dehydrogenase; Validated 96.95
PRK06436303 glycerate dehydrogenase; Provisional 96.95
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 96.95
PRK05597 355 molybdopterin biosynthesis protein MoeB; Validated 96.94
PLN02712 667 arogenate dehydrogenase 96.93
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 96.91
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 96.91
PLN02712 667 arogenate dehydrogenase 96.91
PRK05872 296 short chain dehydrogenase; Provisional 96.86
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 96.85
PRK09260 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.84
PRK00421 461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 96.84
TIGR01692 288 HIBADH 3-hydroxyisobutyrate dehydrogenase. This en 96.84
PRK12480330 D-lactate dehydrogenase; Provisional 96.84
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 96.84
PRK12491 272 pyrroline-5-carboxylate reductase; Reviewed 96.84
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 96.84
PRK15059 292 tartronate semialdehyde reductase; Provisional 96.83
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 96.83
PRK08605332 D-lactate dehydrogenase; Validated 96.83
COG2085211 Predicted dinucleotide-binding enzymes [General fu 96.8
PRK14618 328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.8
PRK05600 370 thiamine biosynthesis protein ThiF; Validated 96.77
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 96.76
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 96.76
COG0345 266 ProC Pyrroline-5-carboxylate reductase [Amino acid 96.75
PRK07060245 short chain dehydrogenase; Provisional 96.75
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 96.75
PRK08507 275 prephenate dehydrogenase; Validated 96.74
PRK07574385 formate dehydrogenase; Provisional 96.72
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 96.71
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 96.69
PRK06139 330 short chain dehydrogenase; Provisional 96.68
PRK06057255 short chain dehydrogenase; Provisional 96.68
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 96.67
PF00208244 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Val 96.67
PRK08818 370 prephenate dehydrogenase; Provisional 96.66
PRK06196 315 oxidoreductase; Provisional 96.66
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.65
PRK08293 287 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.64
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 96.63
PLN03139386 formate dehydrogenase; Provisional 96.63
PRK07825 273 short chain dehydrogenase; Provisional 96.62
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 96.62
TIGR00465 314 ilvC ketol-acid reductoisomerase. This is the seco 96.62
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 96.61
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 96.61
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 96.61
PLN03209 576 translocon at the inner envelope of chloroplast su 96.59
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 96.59
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 96.59
PRK15116268 sulfur acceptor protein CsdL; Provisional 96.58
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.56
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 96.55
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.55
KOG0172 445 consensus Lysine-ketoglutarate reductase/saccharop 96.53
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 96.52
COG0569225 TrkA K+ transport systems, NAD-binding component [ 96.51
PRK06130 311 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.51
KOG1208 314 consensus Dehydrogenases with different specificit 96.5
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 96.48
PRK08339 263 short chain dehydrogenase; Provisional 96.48
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.46
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 96.43
PRK11199 374 tyrA bifunctional chorismate mutase/prephenate deh 96.43
PRK05854 313 short chain dehydrogenase; Provisional 96.42
PRK08223 287 hypothetical protein; Validated 96.42
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 96.41
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 96.41
PRK07819 286 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.4
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 96.38
PRK01390 460 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.37
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 96.36
KOG3007333 consensus Mu-crystallin [Amino acid transport and 96.35
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.34
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.34
PRK07523255 gluconate 5-dehydrogenase; Provisional 96.33
PRK06522 304 2-dehydropantoate 2-reductase; Reviewed 96.32
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 96.32
PRK07680 273 late competence protein ComER; Validated 96.31
PLN02688 266 pyrroline-5-carboxylate reductase 96.3
PRK05867253 short chain dehydrogenase; Provisional 96.3
PRK06500249 short chain dehydrogenase; Provisional 96.29
PRK08862227 short chain dehydrogenase; Provisional 96.28
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.27
PRK06487317 glycerate dehydrogenase; Provisional 96.26
COG0673 342 MviM Predicted dehydrogenases and related proteins 96.25
PRK06932314 glycerate dehydrogenase; Provisional 96.25
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 96.25
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferroc 96.23
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 96.21
PLN02477410 glutamate dehydrogenase 96.21
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 96.21
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 96.19
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 96.19
PLN02858 1378 fructose-bisphosphate aldolase 96.18
PRK08265 261 short chain dehydrogenase; Provisional 96.16
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 96.15
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 96.15
PRK07063 260 short chain dehydrogenase; Provisional 96.15
PRK01368 454 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.13
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 96.13
PRK07424406 bifunctional sterol desaturase/short chain dehydro 96.13
PRK08085254 gluconate 5-dehydrogenase; Provisional 96.11
PLN02858 1378 fructose-bisphosphate aldolase 96.1
PRK12367245 short chain dehydrogenase; Provisional 96.1
PRK14619 308 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 96.1
PRK06182 273 short chain dehydrogenase; Validated 96.1
PRK12829 264 short chain dehydrogenase; Provisional 96.1
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 96.1
KOG1014 312 consensus 17 beta-hydroxysteroid dehydrogenase typ 96.1
PLN02780 320 ketoreductase/ oxidoreductase 96.09
PRK12742237 oxidoreductase; Provisional 96.08
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 96.07
PRK07478254 short chain dehydrogenase; Provisional 96.07
PLN02306386 hydroxypyruvate reductase 96.05
PRK05717255 oxidoreductase; Validated 96.05
PRK02006 498 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.02
PRK06949258 short chain dehydrogenase; Provisional 96.01
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 96.0
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.99
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 95.98
PRK09414445 glutamate dehydrogenase; Provisional 95.97
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 95.97
KOG0725 270 consensus Reductases with broad range of substrate 95.96
PRK09242257 tropinone reductase; Provisional 95.96
PLN02545 295 3-hydroxybutyryl-CoA dehydrogenase 95.95
PRK06124256 gluconate 5-dehydrogenase; Provisional 95.95
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 95.95
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 95.95
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 95.95
PRK08277 278 D-mannonate oxidoreductase; Provisional 95.94
PRK02705 459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.94
PRK09186256 flagellin modification protein A; Provisional 95.93
PRK06180 277 short chain dehydrogenase; Provisional 95.93
cd01483143 E1_enzyme_family Superfamily of activating enzymes 95.93
PRK08703239 short chain dehydrogenase; Provisional 95.92
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 95.91
PRK07062 265 short chain dehydrogenase; Provisional 95.9
PRK07774250 short chain dehydrogenase; Provisional 95.88
PRK06125259 short chain dehydrogenase; Provisional 95.85
PRK07890 258 short chain dehydrogenase; Provisional 95.83
PRK06172253 short chain dehydrogenase; Provisional 95.83
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 95.83
PRK09880343 L-idonate 5-dehydrogenase; Provisional 95.82
PRK08589 272 short chain dehydrogenase; Validated 95.81
PRK09291257 short chain dehydrogenase; Provisional 95.8
PRK03803 448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.79
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 95.79
PRK07814 263 short chain dehydrogenase; Provisional 95.78
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 95.78
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 95.77
PRK06484520 short chain dehydrogenase; Validated 95.73
PRK14030445 glutamate dehydrogenase; Provisional 95.73
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 95.71
PRK06197 306 short chain dehydrogenase; Provisional 95.71
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 95.68
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 95.68
PRK07035252 short chain dehydrogenase; Provisional 95.67
PRK07831262 short chain dehydrogenase; Provisional 95.67
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 95.67
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 95.65
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 95.65
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 95.63
PRK07109 334 short chain dehydrogenase; Provisional 95.63
PRK07067257 sorbitol dehydrogenase; Provisional 95.61
PRK12921 305 2-dehydropantoate 2-reductase; Provisional 95.61
PRK05876 275 short chain dehydrogenase; Provisional 95.61
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 95.6
PRK07097 265 gluconate 5-dehydrogenase; Provisional 95.6
PRK06194 287 hypothetical protein; Provisional 95.59
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 95.58
PRK07453 322 protochlorophyllide oxidoreductase; Validated 95.57
PRK07411 390 hypothetical protein; Validated 95.56
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 95.56
PRK06720169 hypothetical protein; Provisional 95.56
PRK06484 520 short chain dehydrogenase; Validated 95.55
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 95.54
PRK07878 392 molybdopterin biosynthesis-like protein MoeZ; Vali 95.54
KOG0069336 consensus Glyoxylate/hydroxypyruvate reductase (D- 95.54
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.54
TIGR01082 448 murC UDP-N-acetylmuramate--alanine ligase. UDP-N-a 95.53
PRK09496 453 trkA potassium transporter peripheral membrane com 95.52
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 95.52
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 95.5
PTZ00082 321 L-lactate dehydrogenase; Provisional 95.48
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 95.48
COG3268 382 Uncharacterized conserved protein [Function unknow 95.48
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 95.47
PLN02253 280 xanthoxin dehydrogenase 95.46
PRK06483236 dihydromonapterin reductase; Provisional 95.45
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 95.44
PRK09072 263 short chain dehydrogenase; Provisional 95.44
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 95.43
PRK07576 264 short chain dehydrogenase; Provisional 95.43
PRK07677252 short chain dehydrogenase; Provisional 95.42
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 95.42
PRK06138252 short chain dehydrogenase; Provisional 95.42
PRK07326237 short chain dehydrogenase; Provisional 95.4
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 95.4
PRK08324 681 short chain dehydrogenase; Validated 95.38
PRK14620 326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.38
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 95.36
PRK05875 276 short chain dehydrogenase; Provisional 95.35
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.35
PRK12939250 short chain dehydrogenase; Provisional 95.33
PRK07454241 short chain dehydrogenase; Provisional 95.32
PRK14806 735 bifunctional cyclohexadienyl dehydrogenase/ 3-phos 95.32
PRK12828239 short chain dehydrogenase; Provisional 95.28
PRK08643 256 acetoin reductase; Validated 95.28
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.24
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 95.24
PRK05562223 precorrin-2 dehydrogenase; Provisional 95.23
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.23
PRK09496453 trkA potassium transporter peripheral membrane com 95.22
PRK05993 277 short chain dehydrogenase; Provisional 95.22
PRK09287 459 6-phosphogluconate dehydrogenase; Validated 95.21
PRK15057 388 UDP-glucose 6-dehydrogenase; Provisional 95.2
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 95.19
PRK03806 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.18
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 95.18
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 95.18
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 95.15
PRK08213259 gluconate 5-dehydrogenase; Provisional 95.15
PRK08251248 short chain dehydrogenase; Provisional 95.14
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 95.13
PRK14031444 glutamate dehydrogenase; Provisional 95.13
PRK08263 275 short chain dehydrogenase; Provisional 95.12
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 95.1
TIGR01761 343 thiaz-red thiazolinyl imide reductase. This reduct 95.09
PRK06101240 short chain dehydrogenase; Provisional 95.08
PRK05884223 short chain dehydrogenase; Provisional 95.08
PRK14573 809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 95.07
PRK08267 260 short chain dehydrogenase; Provisional 95.07
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 95.07
PRK07024 257 short chain dehydrogenase; Provisional 95.07
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 95.07
PRK08303 305 short chain dehydrogenase; Provisional 95.06
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Mem 95.06
COG0059 338 IlvC Ketol-acid reductoisomerase [Amino acid trans 95.05
PRK07074 257 short chain dehydrogenase; Provisional 95.03
PRK06940 275 short chain dehydrogenase; Provisional 95.03
PRK08628258 short chain dehydrogenase; Provisional 94.99
PRK04663 438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.97
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 94.96
PRK08340 259 glucose-1-dehydrogenase; Provisional 94.94
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 94.91
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 94.9
PRK07904253 short chain dehydrogenase; Provisional 94.9
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 94.89
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 94.89
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 94.88
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 94.87
TIGR01087 433 murD UDP-N-acetylmuramoylalanine--D-glutamate liga 94.86
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.86
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.86
PRK06914 280 short chain dehydrogenase; Provisional 94.85
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 94.8
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 94.79
PRK07102243 short chain dehydrogenase; Provisional 94.79
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 94.78
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 94.77
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 94.76
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.74
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 94.7
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 94.65
PRK08017 256 oxidoreductase; Provisional 94.64
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 94.63
PRK14851 679 hypothetical protein; Provisional 94.63
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 94.62
PRK12331448 oxaloacetate decarboxylase; Provisional 94.61
PRK12862 763 malic enzyme; Reviewed 94.6
PRK06928 277 pyrroline-5-carboxylate reductase; Reviewed 94.59
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 94.59
PRK06841255 short chain dehydrogenase; Provisional 94.58
PRK07791 286 short chain dehydrogenase; Provisional 94.56
PRK10538248 malonic semialdehyde reductase; Provisional 94.55
TIGR01108582 oadA oxaloacetate decarboxylase alpha subunit. Thi 94.52
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 94.5
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.47
PRK07806248 short chain dehydrogenase; Provisional 94.45
PTZ00117 319 malate dehydrogenase; Provisional 94.43
PRK05225 487 ketol-acid reductoisomerase; Validated 94.43
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.41
PRK06198 260 short chain dehydrogenase; Provisional 94.4
PRK08936 261 glucose-1-dehydrogenase; Provisional 94.4
PRK06114254 short chain dehydrogenase; Provisional 94.38
PRK07832 272 short chain dehydrogenase; Provisional 94.36
CHL00194 317 ycf39 Ycf39; Provisional 94.32
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 94.31
PRK06181 263 short chain dehydrogenase; Provisional 94.31
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 94.3
PLN02896 353 cinnamyl-alcohol dehydrogenase 94.29
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 94.27
cd01491 286 Ube1_repeat1 Ubiquitin activating enzyme (E1), rep 94.25
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy pr 94.24
COG5322351 Predicted dehydrogenase [General function predicti 94.21
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 94.18
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-la 94.16
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 94.15
PRK06398258 aldose dehydrogenase; Validated 94.15
cd00650 263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 94.14
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 94.12
PRK05599246 hypothetical protein; Provisional 94.11
PRK13303 265 L-aspartate dehydrogenase; Provisional 94.11
PRK12747252 short chain dehydrogenase; Provisional 94.08
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 94.06
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 94.04
PRK08264238 short chain dehydrogenase; Validated 93.99
PRK07856252 short chain dehydrogenase; Provisional 93.99
PRK06223 307 malate dehydrogenase; Reviewed 93.95
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 93.92
TIGR02415 254 23BDH acetoin reductases. One member of this famil 93.91
PRK12746254 short chain dehydrogenase; Provisional 93.86
PTZ00345 365 glycerol-3-phosphate dehydrogenase; Provisional 93.86
PRK10637 457 cysG siroheme synthase; Provisional 93.85
PRK06523260 short chain dehydrogenase; Provisional 93.84
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 93.82
PRK06924251 short chain dehydrogenase; Provisional 93.81
PLN02602 350 lactate dehydrogenase 93.81
PLN02586360 probable cinnamyl alcohol dehydrogenase 93.8
PRK07201 657 short chain dehydrogenase; Provisional 93.79
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.79
PRK05650 270 short chain dehydrogenase; Provisional 93.78
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 93.77
PLN02214 342 cinnamoyl-CoA reductase 93.76
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 93.76
KOG1370434 consensus S-adenosylhomocysteine hydrolase [Coenzy 93.75
PRK08226 263 short chain dehydrogenase; Provisional 93.71
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 93.71
PRK05855 582 short chain dehydrogenase; Validated 93.68
KOG1209 289 consensus 1-Acyl dihydroxyacetone phosphate reduct 93.66
PRK08278 273 short chain dehydrogenase; Provisional 93.64
KOG2733 423 consensus Uncharacterized membrane protein [Functi 93.64
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 93.63
PRK12439 341 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 93.61
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 93.59
PRK05693 274 short chain dehydrogenase; Provisional 93.59
PRK06482 276 short chain dehydrogenase; Provisional 93.59
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 93.59
PRK11730 715 fadB multifunctional fatty acid oxidation complex 93.56
PRK14041467 oxaloacetate decarboxylase; Provisional 93.55
PLN02172461 flavin-containing monooxygenase FMO GS-OX 93.52
PRK06300 299 enoyl-(acyl carrier protein) reductase; Provisiona 93.5
PRK07775 274 short chain dehydrogenase; Provisional 93.48
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 93.47
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 93.46
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 93.44
cd05297 423 GH4_alpha_glucosidase_galactosidase Glycoside Hydr 93.41
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 93.4
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
Probab=100.00  E-value=1.3e-119  Score=975.65  Aligned_cols=508  Identities=51%  Similarity=0.859  Sum_probs=458.6

Q ss_pred             cccCCceEEEeecCCCHHHHHHHHHHHHhhCCCEEEEEeccCC-CCcHHHHHHHhcCCCCcEEEEeecCCCCCCCCCCcH
Q 010101            4 AAKNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSME-FSHISEVDKLIQHPTLPAIVSYRLKSSRKSSDEACK   82 (518)
Q Consensus         4 ~~~~~~~icv~l~~~~~~~~~~~~~~~~~~g~D~vElRlD~l~-~~~~~~l~~l~~~~~~PiI~T~R~~~eGG~~~~~~~   82 (518)
                      |++++|+||+||++++.++++.+++++...++|+||||+|+|. .+..+++..+++..++|+|||+|+++|||.|+++ +
T Consensus        18 ~~~~~~~icv~i~~~~~~e~~~~~~~~~~~~~D~vElRlD~l~~~~~~~~~~~~~~~~~~plI~T~R~~~eGG~~~~~-~   96 (529)
T PLN02520         18 VRRNPTLICVPIMADSVDKMLIEMAKAKELGADLVEIRLDFLKNFNPREDLKTLIKQSPLPTLVTYRPKWEGGQYEGD-E   96 (529)
T ss_pred             cccCCCEEEEEeCCCCHHHHHHHHHHhhhcCCCEEEEEeccccccCCHHHHHHHHhcCCCcEEEEeccHHHCCCCCCC-H
Confidence            7899999999999999999999988887789999999999998 4444567777777889999999999999999999 9


Q ss_pred             HHHHHHHHHHhhcCCcEEEEecCCCCchhhHHHhhcCCCcEEEEeeecCCCCCCChhHHHHHHHHHHHcCCCEEEEEccc
Q 010101           83 NTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNTKIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAV  162 (518)
Q Consensus        83 ~~~~~ll~~~~~~g~~yvDiEl~~~~~~~~~l~~~~~~~~kiI~S~H~f~~~tp~~~~l~~~~~~~~~~gadivKia~~~  162 (518)
                      ++|+++++.+++.|+||||||++..++..+.+...|+.++++|+||||| ++||+.++|.+++++|.++||||+|||+||
T Consensus        97 ~~~~~ll~~~~~~~~d~iDiEl~~~~~~~~~~~~~~~~~~~vI~S~H~f-~~tP~~~el~~~~~~~~~~gaDi~Kia~~~  175 (529)
T PLN02520         97 NKRQDALRLAMELGADYVDVELKVAHEFINSISGKKPEKCKVIVSSHNY-ENTPSVEELGNLVARIQATGADIVKIATTA  175 (529)
T ss_pred             HHHHHHHHHHHHhCCCEEEEEcCCchhHHHHHHhhhhcCCEEEEEecCC-CCCCCHHHHHHHHHHHHHhCCCEEEEecCC
Confidence            9999999999999999999999988766555544666799999999999 999999999999999999999999999999


Q ss_pred             CCcccHHHHHHHhccCCCCEEEEecCCccchhhhcCCCCCCcccccccC--CCCCCCCCCHHHHHHHhhhccCCCCceEE
Q 010101          163 DSITDLAPVFEMLTHCQVPLIALAVGSRGLISQLLGPKFGGFLVYGSLG--GKSVPGLPTLVSLKQVYQLEHINPDTKIF  240 (518)
Q Consensus       163 ~~~~D~~~l~~~~~~~~~p~i~~~mG~~G~~sRi~~~~~gs~~ty~~~~--~~sApGQ~~~~~l~~~~~~~~~~~~t~~~  240 (518)
                      ++.+|++++++++.+.++|+|+|+||+.|++||+++++|||++||++++  .++||||+++++++++|++.+++++|++|
T Consensus       176 ~~~~D~~~ll~~~~~~~~p~i~~~MG~~G~~sRi~~~~~GS~lTy~~~~~~~~sAPGQ~~~~~l~~~~~~~~~~~~t~~~  255 (529)
T PLN02520        176 LDITDVARMFQITVHSQVPTIGLVMGERGLISRILCPKFGGYLTFGTLEAGKVSAPGQPTIKDLLDLYNFRQIGPDTKVY  255 (529)
T ss_pred             CCHHHHHHHHHHHhhcCCCEEEEecCCCCchheecccccCCceeeeecCcccccCCCCCCHHHHHHHhhhhcccCCceEE
Confidence            9999999999988777889999999999999999999999999999987  45999999999999999999999999999


Q ss_pred             EEecCCCCcccCHHHHHHHHHHcCCCceEEecccCcHHHHHHHhcCCCCCEEEecccchHHHHhcccccChhhhhcCcee
Q 010101          241 GLVSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPAVACCDEVHPLAKSIGAVN  320 (518)
Q Consensus       241 ~liG~pi~hS~SP~~hn~~f~~~gl~~~y~~~~~~~l~~~~~~l~~~~~~G~~VT~P~K~~v~~~~d~~~~~A~~iGavN  320 (518)
                      ||||+||+||+||.|||++|+++|+|+.|.++++++++++++.++.++|.|+|||||||+++++|+|++|+.|+.+||||
T Consensus       256 ~liG~Pi~hS~SP~ihn~~f~~~gl~~~Y~~~~v~~l~~~~~~l~~~~~~G~nVTiP~K~~v~~~lD~~~~~A~~iGAVN  335 (529)
T PLN02520        256 GIIGKPVGHSKSPILHNEAFKSVGFNGVYVHLLVDDLAKFLQTYSSPDFAGFSCTIPHKEDALKCCDEVDPIAKSIGAIN  335 (529)
T ss_pred             EEEcCCcccccCHHHHHHHHHHCCCCcEEEEeehhhHHHHHHHHhhCCCCEEEECcCCHHHHHHHhccCCHHHHHhCCce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEeccCCeEEEeecCHHHHHHHHHHHHHhhccCCCCCCCCcccCCcEEEEEccchhHHHHHHHHHHCCCeEEEEeCCH
Q 010101          321 TIIRRPIDGKLVGYNTDCESAISAIEDALRERQGINGVASHTSPIAGKIFVLVGAGGAGRALAFGAKSRGARVIIFNRNY  400 (518)
Q Consensus       321 Ti~~~~~~g~l~G~NTD~~G~~~~l~~~l~~~~~~~~~~~~~~~l~~k~vlvlGaGg~araia~~L~~~G~~v~i~nRt~  400 (518)
                      ||++++++|+|+||||||.||+.+|++.+...+.   .+.....+++|+++|+|+||+|++++++|++.|++|+++||+.
T Consensus       336 Tvv~~~~~g~l~G~NTD~~G~~~~l~~~~~~~~~---~~~~~~~~~~k~vlIlGaGGagrAia~~L~~~G~~V~i~nR~~  412 (529)
T PLN02520        336 TIIRRPSDGKLVGYNTDYIGAISAIEDGLRASGS---SPASGSPLAGKLFVVIGAGGAGKALAYGAKEKGARVVIANRTY  412 (529)
T ss_pred             EEEEeCCCCEEEEEcccHHHHHHHHHhhhccccc---ccccccCCCCCEEEEECCcHHHHHHHHHHHHCCCEEEEEcCCH
Confidence            9998622789999999999999999753321000   0000135778999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCcccccccccccCCCCccEEEEcCCCCCCCCCCCCCCChhhhcCCCEEEEEeeCCCchHHHHHHHHCCC
Q 010101          401 ERAKALADAVSGEALHFEYLHEFFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGA  480 (518)
Q Consensus       401 ~ka~~la~~~~~~~~~~~~l~~~~~~~~divInatp~g~~~~~~~~~~~~~~l~~~~~v~Di~Y~P~~T~ll~~A~~~G~  480 (518)
                      ++++++++.++...+.++++.+.....+|+||||||+||.|..+..|++..++++..+|+|++|+|.+|+|+++|+++||
T Consensus       413 e~a~~la~~l~~~~~~~~~~~~~~~~~~diiINtT~vGm~~~~~~~pl~~~~l~~~~~v~D~vY~P~~T~ll~~A~~~G~  492 (529)
T PLN02520        413 ERAKELADAVGGQALTLADLENFHPEEGMILANTTSVGMQPNVDETPISKHALKHYSLVFDAVYTPKITRLLREAEESGA  492 (529)
T ss_pred             HHHHHHHHHhCCceeeHhHhhhhccccCeEEEecccCCCCCCCCCCcccHhhCCCCCEEEEeccCCCcCHHHHHHHHCCC
Confidence            99999999886555555554331234579999999999998777778888889999999999999999999999999999


Q ss_pred             eeeccHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHh
Q 010101          481 TVVSGVEMFIRQALGQFRLFTGGLAPEDFMRKLVLE  516 (518)
Q Consensus       481 ~~i~G~~ml~~Qa~~qf~lw~g~~~p~~~~~~~~~~  516 (518)
                      ++++|++||++||+.||++|||.++|.+.|++++.+
T Consensus       493 ~~~~Gl~MLv~Qa~~~f~lwtg~~~~~~~~~~~l~~  528 (529)
T PLN02520        493 IIVSGTEMFIRQAYEQFERFTGLPAPKELFREIMSK  528 (529)
T ss_pred             eEeCcHHHHHHHHHHHHHHHhCCCCCHHHHHHHHhh
Confidence            999999999999999999999999999999986643



>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK02412 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>COG0710 AroD 3-dehydroquinate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01093 aroD 3-dehydroquinate dehydratase, type I Back     alignment and domain information
>PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4 Back     alignment and domain information
>cd00502 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase Back     alignment and domain information
>PRK13575 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>PRK13576 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>PRK01261 aroD 3-dehydroquinate dehydratase; Provisional Back     alignment and domain information
>KOG0692 consensus Pentafunctional AROM protein [Amino acid transport and metabolism] Back     alignment and domain information
>PF08501 Shikimate_dh_N: Shikimate dehydrogenase substrate binding domain; InterPro: IPR013708 This domain is the substrate binding domain of shikimate dehydrogenase [] Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK08291 ectoine utilization protein EutC; Validated Back     alignment and domain information
>TIGR02992 ectoine_eutC ectoine utilization protein EutC Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK06141 ornithine cyclodeaminase; Validated Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK07340 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK06046 alanine dehydrogenase; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06823 ornithine cyclodeaminase; Validated Back     alignment and domain information
>KOG0409 consensus Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PLN02350 phosphogluconate dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>PRK06407 ornithine cyclodeaminase; Provisional Back     alignment and domain information
>PRK06199 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07589 ornithine cyclodeaminase; Validated Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>KOG4230 consensus C1-tetrahydrofolate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK07679 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK06476 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK12491 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK15059 tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PF00208 ELFV_dehydrog: Glutamate/Leucine/Phenylalanine/Valine dehydrogenase; InterPro: IPR006096 Glutamate, leucine, phenylalanine and valine dehydrogenases are structurally and functionally related Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>TIGR00465 ilvC ketol-acid reductoisomerase Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG0172 consensus Lysine-ketoglutarate reductase/saccharopine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG3007 consensus Mu-crystallin [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07680 late competence protein ComER; Validated Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09287 6-phosphogluconate dehydrogenase; Validated Back     alignment and domain information
>PRK15057 UDP-glucose 6-dehydrogenase; Provisional Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd00300 LDH_like L-lactate dehydrogenase-like enzymes Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK14851 hypothetical protein; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>PRK06928 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01484 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-like Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>cd01491 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG5322 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>cd05290 LDH_3 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02602 lactate dehydrogenase Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
2gpt_A523 Crystal Structure Of Arabidopsis Dehydroquinate Deh 1e-121
2o7q_A523 Crystal Structure Of The A. Thaliana Dhq-Dehydroshi 1e-118
1nvt_A287 Crystal Structure Of Shikimate Dehydrogenase (Aroe 2e-31
2egg_A297 Crystal Structure Of Shikimate 5-Dehydrogenase (Aro 2e-24
1wxd_A263 Crystal Structure Of Shikimate 5-dehydrogenase (aro 6e-23
3don_A277 Crystal Structure Of Shikimate Dehydrogenase From S 7e-23
2hk7_A269 Crystal Structure Of Shikimate Dehydrogenase From A 1e-22
2hk9_A275 Crystal Structure Of Shikimate Dehydrogenase From A 1e-22
3toz_A315 2.2 Angstrom Crystal Structure Of Shikimate 5-Dehyd 1e-21
3t4e_A312 1.95 Angstrom Crystal Structure Of Shikimate 5-Dehy 6e-20
1npy_A271 Structure Of Shikimate 5-Dehydrogenase-Like Protein 1e-15
1vi2_A300 Crystal Structure Of Shikimate-5-Dehydrogenase With 3e-15
1npd_A288 X-Ray Structure Of Shikimate Dehydrogenase Complexe 4e-15
3phg_A269 Crystal Structure Of The Shikimate 5-Dehydrogenase 9e-15
4foo_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 1e-14
4fpx_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 2e-14
4fr5_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 2e-14
4fos_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 2e-14
4fq8_A271 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 2e-14
3fbt_A282 Crystal Structure Of A Chorismate MutaseSHIKIMATE 5 8e-14
4fsh_A271 Crystal Structure Of Shikimate Dehydrogenase (aroe) 3e-12
3pgj_A302 2.49 Angstrom Resolution Crystal Structure Of Shiki 2e-10
3o8q_A281 1.45 Angstrom Resolution Crystal Structure Of Shiki 2e-10
3o8q_B275 1.45 Angstrom Resolution Crystal Structure Of Shiki 2e-10
2nlo_A302 Crystal Structure Of The Quinate Dehydrogenase From 6e-10
3jyo_A283 Quinate Dehydrogenase From Corynebacterium Glutamic 8e-10
1nyt_A271 Shikimate Dehydrogenase Aroe Complexed With Nadp+ L 4e-09
3tum_B269 2.15 Angstrom Resolution Crystal Structure Of A Shi 6e-09
3u62_A253 Crystal Structure Of Shikimate Dehydrogenase From T 2e-08
1qfe_A252 The Structure Of Type I 3-Dehydroquinate Dehydratas 3e-08
3o1n_A276 1.03 Angstrom Crystal Structure Of Q236a Mutant Typ 9e-07
3m7w_A255 Crystal Structure Of Type I 3-Dehydroquinate Dehydr 9e-07
3l2i_A276 1.85 Angstrom Crystal Structure Of The 3-Dehydroqui 1e-06
4guf_A276 1.5 Angstrom Crystal Structure Of The Salmonella En 2e-06
3nnt_A276 Crystal Structure Of K170m Mutant Of Type I 3-Dehyd 7e-06
3js3_A258 Crystal Structure Of Type I 3-Dehydroquinate Dehydr 2e-05
1p74_A272 Crystal Structure Of Shikimate Dehydrogenase (Aroe) 2e-05
1sfl_A238 1.9a Crystal Structure Of Staphylococcus Aureus Typ 3e-05
1sfj_A238 2.4a Crystal Structure Of Staphylococcus Aureus Typ 9e-05
3pwz_A272 Crystal Structure Of An Ael1 Enzyme From Pseudomona 1e-04
>pdb|2GPT|A Chain A, Crystal Structure Of Arabidopsis Dehydroquinate Dehydratase- Shikimate Dehydrogenase In Complex With Tartrate And Shikimate Length = 523 Back     alignment and structure

Iteration: 1

Score = 431 bits (1107), Expect = e-121, Method: Compositional matrix adjust. Identities = 230/512 (44%), Positives = 326/512 (63%), Gaps = 5/512 (0%) Query: 6 KNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSM-EFSHISEVDKLIQHPTLPA 64 KN L+C + ++ ++M +A GADLVE+ +D + +F+ + ++ +I+ LP Sbjct: 2 KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPLEDLKTIIKKSPLPT 61 Query: 65 IVSYRLKSSRKSSDEACKNTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNTKI 124 + +YR K E +N VLR A++L ++++++ +VAS+ + S K+ Sbjct: 62 LFTYRPKW-EGGQYEGDENERRDVLRLAMELGADYIDVELQVASEFIKSIDGKKPGKFKV 120 Query: 125 IVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPLIA 184 IVSS+ N P+ E L ++A +Q TGAD++K+ I D+A +F + + QVP I Sbjct: 121 IVSSH-NYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHITSKAQVPTIG 179 Query: 185 LAVGSRGLISQLLGPKFGGFLVYGSLGGKSV--PGLPTLVSLKQVYQLEHINPDTKIFGL 242 L +G RGL+S++L KFGG+L +G+L V PG PT+ L +Y I PDTK++G+ Sbjct: 180 LVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVYGI 239 Query: 243 VSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPA 302 + PV HSK PI+HN AF+ FNG+YV +LVD++ F + YS +DFAGFS IPHKE A Sbjct: 240 IGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKEAA 299 Query: 303 VACCDEVHPLAKSIGAVNTIIRRPIDGKLVGYNTDCESAISAIEDALRERQGINGVASHT 362 + CCDEV PLAKSIGAVNTI+RR DGKL+GYNTDC +ISAIED LR + V S + Sbjct: 300 LQCCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGSISAIEDGLRSSGDPSSVPSSS 359 Query: 363 SPIAGKIXXXXXXXXXXXXXXXXXKSRGARVIIFNRNYERAKALADAVSGEALHFEYLHE 422 SP+A K K +GA+V+I NR YERA LA+A+ G+AL L Sbjct: 360 SPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYERALELAEAIGGKALSLTDLDN 419 Query: 423 FFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGATV 482 + PE GM+LAN +++GM+PN +++P+ K+ALK Y LVFDAVYTPR TRLLREA E GA Sbjct: 420 YHPEDGMVLANTTSMGMQPNVEETPISKDALKHYALVFDAVYTPRITRLLREAEESGAIT 479 Query: 483 VSGVEMFIRQALGQFRLFTGGLAPEDFMRKLV 514 VSG EMF+RQA QF +FTG AP++ +++ Sbjct: 480 VSGSEMFVRQAYEQFEIFTGLPAPKELYWQIM 511
>pdb|2O7Q|A Chain A, Crystal Structure Of The A. Thaliana Dhq-Dehydroshikimate-Sdh- Shikimate-Nadp(H) Length = 523 Back     alignment and structure
>pdb|1NVT|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe Or Mj1084) In Complex With Nadp+ Length = 287 Back     alignment and structure
>pdb|2EGG|A Chain A, Crystal Structure Of Shikimate 5-Dehydrogenase (Aroe) From Geobacillus Kaustophilus Length = 297 Back     alignment and structure
>pdb|1WXD|A Chain A, Crystal Structure Of Shikimate 5-dehydrogenase (aroe) From Thermus Thermophilus Hb8 Length = 263 Back     alignment and structure
>pdb|3DON|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Staphylococcus Epidermidis Length = 277 Back     alignment and structure
>pdb|2HK7|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Aquifex Aeolicus In Complex With Mercury At 2.5 Angstrom Resolution Length = 269 Back     alignment and structure
>pdb|2HK9|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Aquifex Aeolicus In Complex With Shikimate And Nadp+ At 2.2 Angstrom Resolution Length = 275 Back     alignment and structure
>pdb|3TOZ|A Chain A, 2.2 Angstrom Crystal Structure Of Shikimate 5-Dehydrogenase From Listeria Monocytogenes In Complex With Nad. Length = 315 Back     alignment and structure
>pdb|3T4E|A Chain A, 1.95 Angstrom Crystal Structure Of Shikimate 5-Dehydrogenase (Aroe) From Salmonella Enterica Subsp. Enterica Serovar Typhimurium In Complex With Nad Length = 312 Back     alignment and structure
>pdb|1NPY|A Chain A, Structure Of Shikimate 5-Dehydrogenase-Like Protein Hi0607 Length = 271 Back     alignment and structure
>pdb|1VI2|A Chain A, Crystal Structure Of Shikimate-5-Dehydrogenase With Nad Length = 300 Back     alignment and structure
>pdb|1NPD|A Chain A, X-Ray Structure Of Shikimate Dehydrogenase Complexed With Nad+ From E.Coli (Ydib) Northeast Structural Genomics Research Consortium (Nesg) Target Er24 Length = 288 Back     alignment and structure
>pdb|3PHG|A Chain A, Crystal Structure Of The Shikimate 5-Dehydrogenase (Aroe) From Helicobacter Pylori Length = 269 Back     alignment and structure
>pdb|4FOO|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Q237k Mutant From Helicobacter Pylori Length = 271 Back     alignment and structure
>pdb|4FPX|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Q237n Mutant From Helicobacter Pylori Length = 271 Back     alignment and structure
>pdb|4FR5|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Y210s Mutant From Helicobacter Pylori In Complex With Shikimate Length = 271 Back     alignment and structure
>pdb|4FOS|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Q237a Mutant From Helicobacter Pylori In Complex With Shikimate Length = 271 Back     alignment and structure
>pdb|4FQ8|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) Y210a Mutant From Helicobacter Pylori In Complex With Shikimate Length = 271 Back     alignment and structure
>pdb|3FBT|A Chain A, Crystal Structure Of A Chorismate MutaseSHIKIMATE 5- Dehydrogenase Fusion Protein From Clostridium Acetobutylicum Length = 282 Back     alignment and structure
>pdb|4FSH|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (aroe) Clinical Variant V2356 From Helicobacter Pylori In Complex With Shikimate Length = 271 Back     alignment and structure
>pdb|3PGJ|A Chain A, 2.49 Angstrom Resolution Crystal Structure Of Shikimate 5- Dehydrogenase (Aroe) From Vibrio Cholerae O1 Biovar Eltor Str. N16961 In Complex With Shikimate Length = 302 Back     alignment and structure
>pdb|3O8Q|A Chain A, 1.45 Angstrom Resolution Crystal Structure Of Shikimate 5- Dehydrogenase (Aroe) From Vibrio Cholerae Length = 281 Back     alignment and structure
>pdb|3O8Q|B Chain B, 1.45 Angstrom Resolution Crystal Structure Of Shikimate 5- Dehydrogenase (Aroe) From Vibrio Cholerae Length = 275 Back     alignment and structure
>pdb|2NLO|A Chain A, Crystal Structure Of The Quinate Dehydrogenase From Corynebacterium Glutamicum Length = 302 Back     alignment and structure
>pdb|3JYO|A Chain A, Quinate Dehydrogenase From Corynebacterium Glutamicum In Complex With Nad Length = 283 Back     alignment and structure
>pdb|1NYT|A Chain A, Shikimate Dehydrogenase Aroe Complexed With Nadp+ Length = 271 Back     alignment and structure
>pdb|3U62|A Chain A, Crystal Structure Of Shikimate Dehydrogenase From Thermotoga Maritima Length = 253 Back     alignment and structure
>pdb|1QFE|A Chain A, The Structure Of Type I 3-Dehydroquinate Dehydratase From Salmonella Typhi Length = 252 Back     alignment and structure
>pdb|3O1N|A Chain A, 1.03 Angstrom Crystal Structure Of Q236a Mutant Type I Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Length = 276 Back     alignment and structure
>pdb|3M7W|A Chain A, Crystal Structure Of Type I 3-Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Lt2 In Covalent Complex With Dehydroquinate Length = 255 Back     alignment and structure
>pdb|3L2I|A Chain A, 1.85 Angstrom Crystal Structure Of The 3-Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Lt2. Length = 276 Back     alignment and structure
>pdb|4GUF|A Chain A, 1.5 Angstrom Crystal Structure Of The Salmonella Enterica 3- Dehydroquinate Dehydratase (arod) E86a Mutant Length = 276 Back     alignment and structure
>pdb|3NNT|A Chain A, Crystal Structure Of K170m Mutant Of Type I 3-Dehydroquinate Dehydratase (Arod) From Salmonella Typhimurium Lt2 In Non-Covalent Complex With Dehydroquinate. Length = 276 Back     alignment and structure
>pdb|3JS3|A Chain A, Crystal Structure Of Type I 3-Dehydroquinate Dehydratase (Arod) From Clostridium Difficile With Covalent Reaction Intermediate Length = 258 Back     alignment and structure
>pdb|1P74|A Chain A, Crystal Structure Of Shikimate Dehydrogenase (Aroe) From Haemophilus Influenzae Length = 272 Back     alignment and structure
>pdb|1SFL|A Chain A, 1.9a Crystal Structure Of Staphylococcus Aureus Type I 3- Dehydroquinase, Apo Form Length = 238 Back     alignment and structure
>pdb|1SFJ|A Chain A, 2.4a Crystal Structure Of Staphylococcus Aureus Type I 3- Dehydroquinase, With 3-Dehydroquinate Bound Length = 238 Back     alignment and structure
>pdb|3PWZ|A Chain A, Crystal Structure Of An Ael1 Enzyme From Pseudomonas Putida Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query518
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 0.0
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 1e-105
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 1e-104
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 1e-103
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 1e-102
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 1e-100
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 3e-98
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 4e-97
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 2e-95
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 3e-93
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 2e-87
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 5e-80
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 7e-75
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 2e-68
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 1e-67
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 5e-66
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 2e-62
2egz_A219 3-dehydroquinate dehydratase; aquifex aeolicus VF5 2e-38
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 1e-36
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 6e-36
3l9c_A259 3-dehydroquinate dehydratase; AROD, amino-acid bio 2e-32
2ocz_A231 3-dehydroquinate dehydratase; structural genomics, 3e-32
3js3_A258 3-dehydroquinate dehydratase; AROD, covalent react 3e-32
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 6e-31
2ox1_A196 3-dehydroquinate dehydratase; (beta-alpha)8 barrel 7e-28
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 1e-11
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 2e-06
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 1e-05
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 1e-04
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 6e-04
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 6e-04
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 6e-04
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Length = 523 Back     alignment and structure
 Score =  543 bits (1400), Expect = 0.0
 Identities = 242/518 (46%), Positives = 343/518 (66%), Gaps = 9/518 (1%)

Query: 6   KNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSME-FSHISEVDKLIQHPTLPA 64
           KN  L+C  +  ++ ++M     +A   GADLVE+ +D ++ F+ + ++  +I+   LP 
Sbjct: 2   KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPLEDLKTIIKKSPLPT 61

Query: 65  IVSYRLKS--SRKSSDEACKNTCLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNT 122
           + +YR K    +   DE        VLR A++L  ++++++ +VAS+ + S         
Sbjct: 62  LFTYRPKWEGGQYEGDEN---ERRDVLRLAMELGADYIDVELQVASEFIKSIDGKKPGKF 118

Query: 123 KIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTHCQVPL 182
           K+IVSS+ N    P+ E L  ++A +Q TGAD++K+      I D+A +F + +  QVP 
Sbjct: 119 KVIVSSH-NYQNTPSVEDLDGLVARIQQTGADIVKIATTAVDIADVARMFHITSKAQVPT 177

Query: 183 IALAVGSRGLISQLLGPKFGGFLVYGSL--GGKSVPGLPTLVSLKQVYQLEHINPDTKIF 240
           I L +G RGL+S++L  KFGG+L +G+L     S PG PT+  L  +Y    I PDTK++
Sbjct: 178 IGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVY 237

Query: 241 GLVSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKE 300
           G++  PV HSK PI+HN AF+   FNG+YV +LVD++  F + YS +DFAGFS  IPHKE
Sbjct: 238 GIIGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKE 297

Query: 301 PAVACCDEVHPLAKSIGAVNTIIRRPIDGKLVGYNTDCESAISAIEDALRERQGINGVAS 360
            A+ CCDEV PLAKSIGAVNTI+RR  DGKL+GYNTDC  +ISAIED LR     + V S
Sbjct: 298 AALQCCDEVDPLAKSIGAVNTILRRKSDGKLLGYNTDCIGSISAIEDGLRSSGDPSSVPS 357

Query: 361 HTSPIAGKIFVLVGAGGAGRALAFGAKSRGARVIIFNRNYERAKALADAVSGEALHFEYL 420
            +SP+A K  V++GAGGAG+ALA+GAK +GA+V+I NR YERA  LA+A+ G+AL    L
Sbjct: 358 SSSPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYERALELAEAIGGKALSLTDL 417

Query: 421 HEFFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGA 480
             + PE GM+LAN +++GM+PN +++P+ K+ALK Y LVFDAVYTPR TRLLREA E GA
Sbjct: 418 DNYHPEDGMVLANTTSMGMQPNVEETPISKDALKHYALVFDAVYTPRITRLLREAEESGA 477

Query: 481 TVVSGVEMFIRQALGQFRLFTGGLAPEDFMRKLVLEQF 518
             VSG EMF+RQA  QF +FTG  AP++   +++ +  
Sbjct: 478 ITVSGSEMFVRQAYEQFEIFTGLPAPKELYWQIMSKYG 515


>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Length = 312 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Length = 287 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Length = 315 Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Length = 271 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Length = 297 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Length = 275 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Length = 263 Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Length = 283 Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Length = 282 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Length = 277 Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* Length = 269 Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Length = 253 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Length = 271 Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Length = 281 Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Length = 272 Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Length = 272 Back     alignment and structure
>2egz_A 3-dehydroquinate dehydratase; aquifex aeolicus VF5, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TLA; 1.75A {Aquifex aeolicus} PDB: 2ysw_A Length = 219 Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Length = 238 Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Length = 257 Back     alignment and structure
>3l9c_A 3-dehydroquinate dehydratase; AROD, amino-acid biosynthesis, aromatic amino acid biosynthe schiff base, lyase; 1.60A {Streptococcus mutans} Length = 259 Back     alignment and structure
>2ocz_A 3-dehydroquinate dehydratase; structural genomics, DH streptococcus pyogenes, dehydroshikimate, PSI-2, protein ST initiative; HET: MSE; 1.85A {Streptococcus pyogenes serotype M1} Length = 231 Back     alignment and structure
>3js3_A 3-dehydroquinate dehydratase; AROD, covalent reaction intermediate, amino-acid biosynthesis, aromatic amino acid biosynthesis, lyase; HET: DHS; 2.20A {Clostridium difficile} Length = 258 Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 3nnt_A* 3oex_A 3m7w_A 1gqn_A 1l9w_A* 1qfe_A* Length = 276 Back     alignment and structure
>2ox1_A 3-dehydroquinate dehydratase; (beta-alpha)8 barrel, lyase; 2.33A {Archaeoglobus fulgidus} Length = 196 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Length = 144 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Length = 404 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 100.0
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 100.0
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 100.0
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 100.0
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 100.0
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 100.0
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 100.0
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 100.0
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 100.0
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 100.0
1npy_A271 Hypothetical shikimate 5-dehydrogenase-like protei 100.0
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 100.0
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 100.0
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 100.0
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 100.0
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 100.0
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 100.0
4h3d_A258 3-dehydroquinate dehydratase; structural genomics, 100.0
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 100.0
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 100.0
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 100.0
2d5c_A263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 100.0
3l9c_A259 3-dehydroquinate dehydratase; AROD, amino-acid bio 100.0
2ocz_A231 3-dehydroquinate dehydratase; structural genomics, 100.0
2egz_A219 3-dehydroquinate dehydratase; aquifex aeolicus VF5 100.0
2ox1_A196 3-dehydroquinate dehydratase; (beta-alpha)8 barrel 100.0
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 100.0
2dvm_A439 Malic enzyme, 439AA long hypothetical malate oxido 100.0
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 99.72
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 99.48
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 99.47
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 99.45
3l07_A285 Bifunctional protein fold; structural genomics, ID 99.45
3p2o_A285 Bifunctional protein fold; structural genomics, ce 99.42
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 99.41
2rir_A300 Dipicolinate synthase, A chain; structural genomic 99.27
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 99.22
2i99_A312 MU-crystallin homolog; thyroid hormine binding pro 99.19
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 99.17
1omo_A322 Alanine dehydrogenase; two-domain, beta-sandwich-d 99.15
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 99.11
1x7d_A350 Ornithine cyclodeaminase; binds NAD+, binds L-orni 99.01
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 98.94
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 98.77
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 98.47
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 98.46
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 98.45
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 98.42
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 98.36
3hdj_A313 Probable ornithine cyclodeaminase; APC62486, borde 98.32
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 98.3
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 98.23
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 98.2
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.19
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 98.13
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 97.97
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.96
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.93
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 97.9
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 97.85
1tt5_B 434 Ubiquitin-activating enzyme E1C isoform 1; cell cy 97.82
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.81
3obb_A 300 Probable 3-hydroxyisobutyrate dehydrogenase; struc 97.81
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 97.8
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 97.79
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 97.74
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.74
1lss_A140 TRK system potassium uptake protein TRKA homolog; 97.73
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 97.72
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 97.71
4e21_A 358 6-phosphogluconate dehydrogenase (decarboxylating; 97.68
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 97.67
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 97.66
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 97.65
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 97.64
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 97.62
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 97.61
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 97.61
3h9u_A436 Adenosylhomocysteinase; NAD CO-factor complex, str 97.56
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 97.52
3d1l_A 266 Putative NADP oxidoreductase BF3122; structural ge 97.52
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 97.52
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 97.51
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.51
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 97.5
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 97.5
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.49
3pdu_A 287 3-hydroxyisobutyrate dehydrogenase family protein; 97.49
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.49
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 97.48
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 97.48
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 97.47
4ezb_A 317 Uncharacterized conserved protein; structural geno 97.46
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 97.46
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 97.44
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 97.44
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 97.43
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; 97.42
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 97.42
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 97.42
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 97.42
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 97.41
1yqg_A 263 Pyrroline-5-carboxylate reductase; structural geno 97.41
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 97.4
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.4
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 97.39
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 97.39
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 97.35
4gwg_A 484 6-phosphogluconate dehydrogenase, decarboxylating; 97.35
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 97.35
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 97.34
1v8b_A479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 97.33
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 97.33
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 97.33
4e12_A 283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.33
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 97.31
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.3
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 97.3
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 97.3
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 97.29
3tri_A 280 Pyrroline-5-carboxylate reductase; amino acid bios 97.29
2p4q_A 497 6-phosphogluconate dehydrogenase, decarboxylating; 97.29
2ahr_A 259 Putative pyrroline carboxylate reductase; pyrrolin 97.29
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 97.28
3qha_A 296 Putative oxidoreductase; seattle structural genomi 97.28
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 97.27
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 97.26
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 97.26
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 97.26
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 97.26
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 97.25
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 97.25
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 97.24
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 97.23
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 97.22
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 97.22
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 97.22
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 97.21
4eso_A255 Putative oxidoreductase; NADP, structural genomics 97.21
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 97.21
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 97.21
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 97.2
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 97.2
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 97.2
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 97.2
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 97.19
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 97.19
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 97.19
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 97.18
4dqx_A277 Probable oxidoreductase protein; structural genomi 97.18
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 97.17
2cvz_A 289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 97.17
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 97.16
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 97.16
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 97.16
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 97.15
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 97.14
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.14
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 97.14
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 97.13
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 97.12
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 97.12
1np3_A 338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 97.11
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 97.11
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 97.09
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 97.08
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 97.08
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 97.08
1f0y_A 302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 97.08
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 97.08
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 97.08
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 97.07
1nff_A260 Putative oxidoreductase RV2002; directed evolution 97.06
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.06
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 97.06
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 97.05
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 97.03
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 97.03
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 97.02
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 97.02
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 97.01
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 97.01
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.0
3qsg_A 312 NAD-binding phosphogluconate dehydrogenase-like P; 97.0
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 96.98
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 96.98
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 96.98
1spx_A 278 Short-chain reductase family member (5L265); paral 96.97
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 96.96
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 96.95
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 96.94
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 96.94
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 96.94
1z82_A 335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 96.94
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 96.93
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.92
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 96.92
3b1f_A 290 Putative prephenate dehydrogenase; enzyme, 4-hydro 96.92
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 96.91
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 96.91
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 96.91
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 96.9
2dpo_A 319 L-gulonate 3-dehydrogenase; structural genomics, N 96.9
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 96.88
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 96.87
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 96.87
1hyh_A 309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 96.86
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 96.85
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 96.84
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 96.84
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 96.83
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; 96.83
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 96.83
3gem_A260 Short chain dehydrogenase; structural genomics, AP 96.81
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.81
1pgj_A 478 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o 96.81
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 96.8
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 96.78
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 96.77
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 96.76
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 96.76
4gsl_A 615 Ubiquitin-like modifier-activating enzyme ATG7; ub 96.74
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 96.74
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 96.74
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 96.73
2gf2_A 296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 96.73
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 96.73
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 96.72
2i76_A 276 Hypothetical protein; NADP, dehydrogenase, TM1727, 96.72
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 96.72
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 96.72
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 96.72
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 96.7
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 96.69
3k96_A 356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 96.69
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 96.69
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 96.68
1evy_A 366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 96.68
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 96.67
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 96.67
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 96.67
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 96.67
2uyy_A 316 N-PAC protein; long-chain dehydrogenase, cytokine; 96.66
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 96.66
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 96.65
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 96.65
3imf_A257 Short chain dehydrogenase; structural genomics, in 96.64
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 96.64
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.63
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 96.63
3gg2_A 450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 96.63
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 96.62
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 96.62
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 96.62
4hv4_A 494 UDP-N-acetylmuramate--L-alanine ligase; MURC, yers 96.62
1a5z_A 319 L-lactate dehydrogenase; oxidoreductase, glycolysi 96.61
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 96.61
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 96.61
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 96.61
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.6
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 96.6
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 96.6
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.59
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 96.59
1i36_A 264 Conserved hypothetical protein MTH1747; NADP bindi 96.59
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 96.58
1y8q_A 346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 96.58
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 96.57
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 96.57
1ydw_A 362 AX110P-like protein; structural genomics, protein 96.57
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 96.56
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 96.56
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 96.56
4had_A 350 Probable oxidoreductase protein; structural genomi 96.55
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 96.55
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G057370 96.55
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 96.55
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 96.55
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 96.54
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 96.54
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 96.53
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 96.53
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 96.53
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 96.53
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 96.52
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.52
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 96.52
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 96.52
3hwr_A 318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 96.51
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 96.51
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 96.51
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 96.51
1xq6_A253 Unknown protein; structural genomics, protein stru 96.51
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 96.51
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 96.5
2pgd_A 482 6-phosphogluconate dehydrogenase; oxidoreductase ( 96.5
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 96.5
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 96.5
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 96.49
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.48
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 96.47
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 95.48
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 96.46
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 96.45
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 96.45
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 96.45
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 96.44
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 96.44
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 96.44
3vku_A 326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 96.44
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 96.44
2ewd_A 317 Lactate dehydrogenase,; protein-substrate_cofactor 96.43
3pqe_A 326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 96.43
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 96.43
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 96.42
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 96.42
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 96.42
3rih_A293 Short chain dehydrogenase or reductase; structural 96.41
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 96.41
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 96.41
1txg_A 335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 96.4
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 96.4
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 96.4
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 96.4
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 96.38
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 96.38
1xq1_A266 Putative tropinone reducatse; structural genomics, 96.38
1ldn_A 316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 96.38
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 96.37
1xkq_A 280 Short-chain reductase family member (5D234); parra 96.37
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 96.37
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 96.37
4g65_A 461 TRK system potassium uptake protein TRKA; structur 96.35
3cxt_A 291 Dehydrogenase with different specificities; rossma 96.35
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 96.35
2v6b_A 304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 96.35
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 96.34
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.34
3pid_A 432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 96.33
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 96.33
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 96.33
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 96.33
1xhl_A 297 Short-chain dehydrogenase/reductase family member 96.32
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 96.32
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 96.31
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 96.3
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 96.3
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 96.3
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 96.3
3hn7_A 524 UDP-N-acetylmuramate-L-alanine ligase; ATP-binding 96.29
3ego_A 307 Probable 2-dehydropantoate 2-reductase; structural 96.28
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 96.28
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 96.28
3p7m_A 321 Malate dehydrogenase; putative dehydrogenase, enzy 96.27
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.27
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 96.26
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 96.26
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 96.25
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 96.24
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 96.23
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 96.23
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 96.23
4aj2_A 331 L-lactate dehydrogenase A chain; oxidoreductase-in 96.22
3k6j_A 460 Protein F01G10.3, confirmed by transcript evidenc; 96.21
3gvi_A 324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 96.21
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.2
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 96.2
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 96.18
4a7p_A 446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 96.17
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 96.17
3tl2_A 315 Malate dehydrogenase; center for structural genomi 96.15
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 96.14
1zcj_A 463 Peroxisomal bifunctional enzyme; peroxisomal multi 96.13
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 96.13
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 96.13
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 96.12
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 96.12
1yj8_A 375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 96.11
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 96.1
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.1
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 96.09
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.07
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 96.07
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 96.06
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 96.05
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 96.04
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 96.04
3g79_A 478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 96.03
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.03
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 96.03
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 96.03
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 96.03
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 96.02
3ojo_A 431 CAP5O; rossmann fold, complex with cofactor NAD an 96.01
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 96.0
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 96.0
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 96.0
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 96.0
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 95.99
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 95.98
2izz_A 322 Pyrroline-5-carboxylate reductase 1; amino-acid bi 95.96
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 95.96
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 95.95
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 95.95
1x0v_A 354 GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase 95.94
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 95.94
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 95.93
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 95.92
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 95.92
1lld_A 319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 95.92
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 95.91
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 95.91
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 95.91
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 95.9
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 95.89
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 95.88
3ado_A 319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 95.88
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 95.87
1oju_A 294 MDH, malate dehydrogenase; hyperthermophilic, oxid 95.86
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 95.85
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.85
1mv8_A 436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 95.84
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 95.84
3edm_A259 Short chain dehydrogenase; structural genomics, ox 95.82
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 95.82
2xxj_A 310 L-LDH, L-lactate dehydrogenase; oxidoreductase, hy 95.82
2hjr_A 328 Malate dehydrogenase; malaria, structural genomics 95.81
1ez4_A 318 Lactate dehydrogenase; rossmann fold, oxidoreducta 95.8
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 95.8
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 95.78
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 95.76
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 95.75
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 95.74
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 95.73
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 95.72
3i83_A 320 2-dehydropantoate 2-reductase; structural genomics 95.72
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 95.71
1pzg_A 331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 95.71
2zqz_A 326 L-LDH, L-lactate dehydrogenase; oxidoreductase, ro 95.66
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 95.65
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 95.65
1t2d_A 322 LDH-P, L-lactate dehydrogenase; ternary complex, o 95.65
1ur5_A 309 Malate dehydrogenase; oxidoreductase, tricarboxyli 95.64
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 95.64
1guz_A 310 Malate dehydrogenase; oxidoreductase, tricarboxyli 95.63
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 95.62
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 95.61
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 95.61
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.61
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 95.6
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 95.59
2qyt_A 317 2-dehydropantoate 2-reductase; APC81190, porphyrom 95.56
2pv7_A 298 T-protein [includes: chorismate mutase (EC 5.4.99 95.56
3nep_X 314 Malate dehydrogenase; halophIle, molecular adpatat 95.56
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 95.56
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 95.55
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 95.55
3d0o_A 317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 95.52
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.51
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 95.51
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 95.5
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 95.5
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.49
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 95.48
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 95.47
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 95.46
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 95.45
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 95.45
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 95.45
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 95.44
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 95.43
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 95.43
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 95.42
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 95.4
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 95.39
3ldh_A 330 Lactate dehydrogenase; oxidoreductase, CHOH donor, 95.39
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 95.36
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 95.35
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 95.34
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 95.34
3ghy_A 335 Ketopantoate reductase protein; oxidoreductase, NA 95.34
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 95.34
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 95.33
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 95.32
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 95.32
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 95.32
3fi9_A 343 Malate dehydrogenase; structural genomics, oxidore 95.32
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 95.3
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 95.3
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 95.29
4eye_A342 Probable oxidoreductase; structural genomics, niai 95.29
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 95.29
4h3v_A 390 Oxidoreductase domain protein; structural genomics 95.28
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 95.27
2x0j_A 294 Malate dehydrogenase; oxidoreductase, hyperthermop 95.25
2d4a_B 308 Malate dehydrogenase; archaea, hyperthermophIle, o 95.25
1dlj_A 402 UDP-glucose dehydrogenase; rossmann fold, ternary 95.23
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 95.21
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 95.18
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 95.18
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
Probab=100.00  E-value=3.9e-112  Score=921.87  Aligned_cols=509  Identities=47%  Similarity=0.814  Sum_probs=449.3

Q ss_pred             cCCceEEEeecCCCHHHHHHHHHHHHhhCCCEEEEEeccCC-CCcHHHHHHHhcCCCCcEEEEeecCCCCCCCCCCcHHH
Q 010101            6 KNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSME-FSHISEVDKLIQHPTLPAIVSYRLKSSRKSSDEACKNT   84 (518)
Q Consensus         6 ~~~~~icv~l~~~~~~~~~~~~~~~~~~g~D~vElRlD~l~-~~~~~~l~~l~~~~~~PiI~T~R~~~eGG~~~~~~~~~   84 (518)
                      +++|+||+||+++|.++++.+++++.+.|+|+||||+|+|. +++.+++..+++..++|+|||+|+++|||.|+++ +++
T Consensus         2 ~~~~~icv~l~~~~~~~~~~~~~~~~~~g~D~vElRvD~l~~~~~~~~l~~l~~~~~~PiI~T~R~~~eGG~~~~~-~~~   80 (523)
T 2o7s_A            2 KNPSLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWLKDFNPLEDLKTIIKKSPLPTLFTYRPKWEGGQYEGD-ENE   80 (523)
T ss_dssp             CSCCEEEEEECCSSHHHHHHHHHHHHHHTCSEEEEEGGGCSSCCHHHHHHHHHHHCSSCEEEECCBGGGTSSBCSC-HHH
T ss_pred             CCCCEEEEEecCCCHHHHHHHHHHhhhcCCCEEEEEEecccccChHHHHHHHHhcCCCcEEEEecccccCCCCCCC-HHH
Confidence            67899999999999999999999888899999999999998 6656688888888899999999999999999999 999


Q ss_pred             HHHHHHHHhhcCCcEEEEecCCCCchhhHHHhhcCCCcEEEEeeecCCCCCCChhHHHHHHHHHHHcCCCEEEEEcccCC
Q 010101           85 CLQVLRRALDLDVEFVEMDYEVASDPLMSEIIYSRSNTKIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDS  164 (518)
Q Consensus        85 ~~~ll~~~~~~g~~yvDiEl~~~~~~~~~l~~~~~~~~kiI~S~H~f~~~tp~~~~l~~~~~~~~~~gadivKia~~~~~  164 (518)
                      |+++|+.++++|++|||||++.+++.++.+...+..++|||+||||| ++||++++|.++|++|.++||||+|||+||++
T Consensus        81 ~~~ll~~~~~~~~~yiDvEl~~~~~~~~~~~~~~~~~~kiI~S~H~f-~~tp~~~~~~~~~~~~~~~gaDivKia~~a~~  159 (523)
T 2o7s_A           81 RRDVLRLAMELGADYIDVELQVASEFIKSIDGKKPGKFKVIVSSHNY-QNTPSVEDLDGLVARIQQTGADIVKIATTAVD  159 (523)
T ss_dssp             HHHHHHHHHHHTCSEEEEEHHHHHHHHHHTTTCCCTTCEEEEEEECS-SCCCCHHHHHHHHHHHHTTTCSEEEEEEECSS
T ss_pred             HHHHHHHHHHhCCCEEEEECCCchHHHHHHHHhccCCCEEEEEcccC-CCCcCHHHHHHHHHHHHHhCCCEEEEEecCCC
Confidence            99999999999999999999998877777765444589999999999 99999999999999999999999999999999


Q ss_pred             cccHHHHHHHhccCCCCEEEEecCCccchhhhcCCCCCCcccccccCCC--CCCCCCCHHHHHHHhhhccCCCCceEEEE
Q 010101          165 ITDLAPVFEMLTHCQVPLIALAVGSRGLISQLLGPKFGGFLVYGSLGGK--SVPGLPTLVSLKQVYQLEHINPDTKIFGL  242 (518)
Q Consensus       165 ~~D~~~l~~~~~~~~~p~i~~~mG~~G~~sRi~~~~~gs~~ty~~~~~~--sApGQ~~~~~l~~~~~~~~~~~~t~~~~l  242 (518)
                      .+|+++|++++.+.++|+|+|+||+.|++||+++++|||++||++++.+  +||||+++++++++|++.+++++|++|||
T Consensus       160 ~~D~~~l~~~~~~~~~p~i~~~MG~~G~~SRil~~~~gs~lt~~~l~~~~~sApGQ~~~~~l~~~~~~~~~~~~~~~~~v  239 (523)
T 2o7s_A          160 IADVARMFHITSKAQVPTIGLVMGERGLMSRILCSKFGGYLTFGTLDSSKVSAPGQPTIKDLLDLYNFRRIGPDTKVYGI  239 (523)
T ss_dssp             GGGHHHHHHHHHHCSSCEEEEEESGGGTHHHHCTTTTTCSEEECBSSTTCCSSTTCCBHHHHHHTSCGGGCCTTCEEEEE
T ss_pred             HHHHHHHHHHHhhcCCCEEEEEcCCCCchhhhhhhhcCCceeecCCCccccCCCCCCcHHHHHHHHhhhhccccceEEEE
Confidence            9999999999988889999999999999999999999999999999866  99999999999999999999999999999


Q ss_pred             ecCCCCcccCHHHHHHHHHHcCCCceEEecccCcHHHHHHHhcCCCCCEEEecccchHHHHhcccccChhhhhcCceeEE
Q 010101          243 VSNPVGHSKGPILHNPAFRHTRFNGIYVPMLVDDVKEFFRTYSGTDFAGFSVGIPHKEPAVACCDEVHPLAKSIGAVNTI  322 (518)
Q Consensus       243 iG~pi~hS~SP~~hn~~f~~~gl~~~y~~~~~~~l~~~~~~l~~~~~~G~~VT~P~K~~v~~~~d~~~~~A~~iGavNTi  322 (518)
                      ||+||+||+||.|||++|+++|+|+.|.++++++++++++.++.++|.|+|||||||++|++|+|++++.|+.+||||||
T Consensus       240 iG~pi~hS~SP~~hn~~f~~~gl~~~Y~~~~~~~l~~~~~~~~~~~~~G~nVTiP~K~~i~~~ld~~~~~A~~iGAvNti  319 (523)
T 2o7s_A          240 IGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLVDNLVSFLQAYSSSDFAGFSCTIPHKEAALQCCDEVDPLAKSIGAVNTI  319 (523)
T ss_dssp             EESSCTTCCHHHHHHHHHHHTTCSEEEEEEECSCHHHHHHHTCSTTEEEEEECTTCHHHHHHHCSEECHHHHHHTCCSEE
T ss_pred             ECCCccCCccHHHHHHHHHHcCCCcEEEeEEcchHHHHHHHHhcCCCCEEEECCCCHHHHHHHhcccCHHHHHhCCCeEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeccCCeEEEeecCHHHHHHHHHHHHHhhccCCCCCCCCcccCCcEEEEEccchhHHHHHHHHHHCCCeEEEEeCCHHH
Q 010101          323 IRRPIDGKLVGYNTDCESAISAIEDALRERQGINGVASHTSPIAGKIFVLVGAGGAGRALAFGAKSRGARVIIFNRNYER  402 (518)
Q Consensus       323 ~~~~~~g~l~G~NTD~~G~~~~l~~~l~~~~~~~~~~~~~~~l~~k~vlvlGaGg~araia~~L~~~G~~v~i~nRt~~k  402 (518)
                      +++..+|+|+||||||.||+.+|+..+...++.+........+++++++|+|+||+|++++++|++.|++|+++||+.++
T Consensus       320 ~~~~~~gk~~g~nTD~~G~~~~l~~~~~~~~~~~~~~~~~~~l~~k~vlV~GaGGig~aia~~L~~~G~~V~i~~R~~~~  399 (523)
T 2o7s_A          320 LRRKSDGKLLGYNTDCIGSISAIEDGLRSSGDPSSVPSSSSPLASKTVVVIGAGGAGKALAYGAKEKGAKVVIANRTYER  399 (523)
T ss_dssp             EECTTTCCEEEECCHHHHHHHHHHHHC-------------------CEEEECCSHHHHHHHHHHHHHCC-CEEEESSHHH
T ss_pred             EEecCCCeEEEEcCCHHHHHHHHHHhhhhccccccccccccccCCCEEEEECCcHHHHHHHHHHHHCCCEEEEEECCHHH
Confidence            98622689999999999999999764321100000000012467899999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCcccccccccccCCCCccEEEEcCCCCCCCCCCCCCCChhhhcCCCEEEEEeeCCCchHHHHHHHHCCCee
Q 010101          403 AKALADAVSGEALHFEYLHEFFPEKGMILANASAIGMEPNSDQSPVPKEALKAYELVFDAVYTPRNTRLLREAAEVGATV  482 (518)
Q Consensus       403 a~~la~~~~~~~~~~~~l~~~~~~~~divInatp~g~~~~~~~~~~~~~~l~~~~~v~Di~Y~P~~T~ll~~A~~~G~~~  482 (518)
                      ++++++.++.....++++..+.....|++||+|++||.|..+..+++...+.....++|++|.|..|+|+++|+++||.+
T Consensus       400 a~~la~~~~~~~~~~~dl~~~~~~~~DilVN~agvg~~~~~~~~~~~~~~~~~~~~v~Dvny~p~~T~ll~~a~~~G~~~  479 (523)
T 2o7s_A          400 ALELAEAIGGKALSLTDLDNYHPEDGMVLANTTSMGMQPNVEETPISKDALKHYALVFDAVYTPRITRLLREAEESGAIT  479 (523)
T ss_dssp             HHHHHHHTTC-CEETTTTTTC--CCSEEEEECSSTTCTTCTTCCSSCTTTGGGEEEEEECCCSSSSCHHHHHHHTTTCEE
T ss_pred             HHHHHHHcCCceeeHHHhhhccccCceEEEECCCCCCCCCCCCCCCChHHcCcCcEEEEEeeCCccCHHHHHHHHCCCEE
Confidence            99999998755445555543223457999999999987754444565555666688999999999999999999999999


Q ss_pred             eccHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHh
Q 010101          483 VSGVEMFIRQALGQFRLFTGGLAPEDFMRKLVLE  516 (518)
Q Consensus       483 i~G~~ml~~Qa~~qf~lw~g~~~p~~~~~~~~~~  516 (518)
                      ++|++||++||+.||++|||.++|.+.|++++.+
T Consensus       480 i~Gl~mlv~Qa~~~f~lwtg~~~~~~~~~~~~~~  513 (523)
T 2o7s_A          480 VSGSEMFVRQAYEQFEIFTGLPAPKELYWQIMSK  513 (523)
T ss_dssp             ECHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHH
T ss_pred             ECcHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHH
Confidence            9999999999999999999999999999997754



>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>4h3d_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, aldolase class I; HET: PGE SHL; 1.95A {Clostridium difficile} PDB: 3js3_A* Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>3l9c_A 3-dehydroquinate dehydratase; AROD, amino-acid biosynthesis, aromatic amino acid biosynthe schiff base, lyase; 1.60A {Streptococcus mutans} Back     alignment and structure
>2ocz_A 3-dehydroquinate dehydratase; structural genomics, DH streptococcus pyogenes, dehydroshikimate, PSI-2, protein ST initiative; HET: MSE; 1.85A {Streptococcus pyogenes serotype M1} Back     alignment and structure
>2egz_A 3-dehydroquinate dehydratase; aquifex aeolicus VF5, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: TLA; 1.75A {Aquifex aeolicus} PDB: 2ysw_A Back     alignment and structure
>2ox1_A 3-dehydroquinate dehydratase; (beta-alpha)8 barrel, lyase; 2.33A {Archaeoglobus fulgidus} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} Back     alignment and structure
>1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1tt5_B Ubiquitin-activating enzyme E1C isoform 1; cell cycle, ligase; 2.60A {Homo sapiens} SCOP: c.111.1.2 PDB: 3dbl_B 3dbr_B 3dbh_B 3gzn_B* 1yov_B 1r4m_B 1r4n_B* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4hv4_A UDP-N-acetylmuramate--L-alanine ligase; MURC, yersinia pestis peptidoglycan synthesis; HET: AMP; 2.25A {Yersinia pestis} PDB: 2f00_A Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; ATP-binding, nucleotide-binding, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 518
d1gqna_252 c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase 1e-36
d1sfla_236 c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase 3e-34
d1vi2a2102 c.58.1.5 (A:5-106) Putative shikimate dehydrogenas 3e-27
d1nvta2110 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE 5e-27
d1p77a2101 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE 2e-26
d1npya2102 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like 6e-26
d1nyta2101 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE 8e-25
d1npya1167 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like 6e-22
d1nyta1170 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE 2e-20
d1vi2a1182 c.2.1.7 (A:107-288) Putative shikimate dehydrogena 3e-19
d1nvta1177 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE 1e-17
d1p77a1171 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE 1e-17
d1e5qa1182 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase 7e-08
d1jaya_212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 4e-06
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 2e-05
d1gpja2159 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle 3e-05
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 5e-05
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 1e-04
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 1e-04
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-04
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 1e-04
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 2e-04
d1xhla_ 274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 3e-04
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3e-04
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 3e-04
d1bdba_ 276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 3e-04
d1iy8a_ 258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 3e-04
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 4e-04
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 4e-04
d1yxma1 297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 4e-04
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 5e-04
d1fjha_ 257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 5e-04
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 5e-04
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 6e-04
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 7e-04
d1w6ua_ 294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 7e-04
d1zema1 260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 7e-04
d1gega_ 255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 7e-04
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 7e-04
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 8e-04
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 0.001
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 0.001
d2rhca1 257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 0.001
d1spxa_ 264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 0.001
d2bgka1 268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 0.001
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 0.001
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 0.002
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 0.002
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 0.002
d2h7ma1 268 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri 0.002
d1oaaa_259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 0.002
d1xkqa_ 272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 0.002
d1xu9a_ 269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 0.002
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 0.003
d2voua1 265 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydr 0.003
d1wmaa1 275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 0.003
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 0.003
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 0.004
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 0.004
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Length = 252 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Type I 3-dehydroquinate dehydratase
species: Salmonella typhi [TaxId: 90370]
 Score =  134 bits (338), Expect = 1e-36
 Identities = 44/235 (18%), Positives = 93/235 (39%), Gaps = 13/235 (5%)

Query: 10  LVCTQLECETTEEMQASIEQAKVEGADLVELCIDSME-FSHISEVDKLIQH-----PTLP 63
            +   L       ++A     +    D++E  +D     +    V    +      P +P
Sbjct: 17  KIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIP 76

Query: 64  AIVSYRLKSSRKSSDEACKNTCLQVLRRALDLD-VEFVEMDYEVASDPLMSEIIYSRSNT 122
            + ++R                L + R A+D   V+ ++++       + + + Y+ ++ 
Sbjct: 77  LLFTFRSAKEG-GEQTITTQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHN 135

Query: 123 KIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMKLEIAVDSITDLAPVFEMLTH----- 177
             +V S  +    P+ E++   +  MQA GAD+ K+ +   S  D+  +           
Sbjct: 136 VYVVMSNHDFHQTPSAEEMVSRLRKMQALGADIPKIAVMPQSKHDVLTLLTATLEMQQHY 195

Query: 178 CQVPLIALAVGSRGLISQLLGPKFGGFLVYGSLGGKSVPGLPTLVSLKQVYQLEH 232
              P+I +++   G+IS+L G  FG    +G++   S PG   +  L+ V  + H
Sbjct: 196 ADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMILH 250


>d1sfla_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]} Length = 236 Back     information, alignment and structure
>d1vi2a2 c.58.1.5 (A:5-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Length = 102 Back     information, alignment and structure
>d1nvta2 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 110 Back     information, alignment and structure
>d1p77a2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Length = 101 Back     information, alignment and structure
>d1npya2 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Length = 102 Back     information, alignment and structure
>d1nyta2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Length = 101 Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Length = 167 Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Length = 170 Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Length = 182 Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 177 Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Length = 171 Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 182 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Length = 159 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 265 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query518
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 100.0
d1sfla_236 Type I 3-dehydroquinate dehydratase {Staphylococcu 100.0
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 100.0
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 100.0
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 100.0
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 100.0
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 100.0
d1vi2a2102 Putative shikimate dehydrogenase YdiB {Escherichia 100.0
d1p77a2101 Shikimate 5-dehydrogenase AroE {Haemophilus influe 100.0
d1nyta2101 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 100.0
d1nvta2110 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 99.97
d1npya2102 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 99.97
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 99.43
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.11
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 98.68
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 98.09
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 97.86
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 97.86
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 97.85
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 97.84
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.83
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.81
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 97.8
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 97.79
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 97.77
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 97.76
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 97.71
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 97.71
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 97.69
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 97.68
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 97.68
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.67
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 97.66
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 97.65
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 97.64
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 97.63
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 97.63
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 97.62
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 97.6
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 97.6
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.59
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.56
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 97.55
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 97.55
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 97.53
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 97.51
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 97.5
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 97.5
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 97.48
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 97.44
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 97.4
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 97.39
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 97.37
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 97.37
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 97.34
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 97.34
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 97.33
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 97.33
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 97.32
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 97.32
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 97.31
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 97.3
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 97.29
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 97.27
d1omoa_320 Archaeal alanine dehydrogenase {Archaeon Archaeogl 97.26
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 97.26
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 97.26
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 97.26
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 97.25
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 97.25
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 97.25
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 97.22
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 97.21
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 97.21
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 97.2
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 97.19
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 97.18
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 97.15
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 97.15
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 97.12
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 97.12
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.1
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 97.08
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 97.08
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 97.08
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 97.07
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.07
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 97.06
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 97.05
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 97.0
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.99
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 96.97
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.95
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 96.95
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 96.94
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.93
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 96.93
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 96.9
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 96.89
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.89
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 96.88
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.86
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 96.85
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.85
d1x7da_340 Ornithine cyclodeaminase {Pseudomonas putida [TaxI 96.82
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 96.81
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 96.79
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 96.79
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 96.79
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 96.76
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 96.76
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.75
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 96.75
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 96.74
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 96.73
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 96.73
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 96.72
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 96.71
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 96.68
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 96.66
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 96.63
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 96.61
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 96.59
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.56
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 96.54
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 96.53
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 96.5
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 96.5
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 96.48
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 96.47
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 96.42
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 96.42
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.42
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 96.41
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 96.39
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 96.34
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 96.31
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 96.28
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 96.27
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.23
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 96.21
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 96.19
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 96.1
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 96.09
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 96.09
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 96.03
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 95.98
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 95.95
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 95.9
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 95.9
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 95.89
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.88
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 95.86
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 95.66
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.64
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 95.63
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.61
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 95.6
d1np3a2182 Class I ketol-acid reductoisomerase (KARI) {Pseudo 95.58
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.46
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 95.44
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 95.33
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 95.31
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 95.28
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 95.27
d1id1a_153 Rck domain from putative potassium channel Kch {Es 95.24
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 95.17
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 95.14
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 95.13
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.11
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.11
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.09
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 95.08
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 95.06
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 94.92
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 94.91
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 94.87
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 94.82
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 94.79
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 94.73
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 94.72
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 94.63
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 94.55
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 94.55
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 94.38
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.35
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 94.35
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 94.33
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 94.28
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.28
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 94.19
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 94.18
d1obba1171 Alpha-glucosidase AglA {Thermotoga maritima [TaxId 94.17
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 94.11
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 94.07
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 94.06
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 94.04
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 94.0
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 93.97
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 93.96
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 93.94
d1u8xx1167 Maltose-6'-phosphate glucosidase GlvA {Bacillus su 93.81
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 93.69
d1ryia1 276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 93.64
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 93.58
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 93.58
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 93.55
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 93.46
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.43
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 93.38
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 93.35
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.31
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.29
d3c96a1 288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 93.25
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 93.21
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 93.2
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 93.14
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 93.08
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 93.08
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 93.06
d1pj5a2 305 N,N-dimethylglycine oxidase {Arthrobacter globifor 93.0
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 92.96
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 92.9
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 92.76
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 92.69
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 92.69
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 92.66
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 92.62
d1k0ia1 292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 92.53
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 92.37
d1vjta1193 Putative alpha-glucosidase TM0752 {Thermotoga mari 92.3
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 92.3
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 92.17
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 92.08
d1vl6a1222 Malate oxidoreductase (malic enzyme) {Thermotoga m 92.03
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 91.83
d2gf3a1 281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 91.79
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 91.77
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 91.76
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 91.76
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 91.72
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 91.68
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 91.65
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 91.61
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 91.57
d1yovb1 426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 91.51
d1up7a1162 6-phospho-beta-glucosidase {Thermotoga maritima [T 91.5
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 91.37
d1yx1a1250 Hypothetical protein PA2260 {Pseudomonas aeruginos 91.3
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 91.28
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 91.23
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 90.72
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 90.66
d1s6ya1169 6-phospho-beta-glucosidase {Bacillus stearothermop 90.55
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 90.47
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 90.38
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.35
d1qmga2226 Class II ketol-acid reductoisomerase (KARI) {Spina 90.31
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 90.11
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 89.95
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 89.57
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 89.57
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 89.5
d1y0pa2 308 Flavocytochrome c3 (respiratory fumarate reductase 89.46
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 89.42
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 89.38
d1ad1a_264 Dihydropteroate synthetase {Staphylococcus aureus 89.18
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 89.18
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 88.88
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 88.78
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 88.47
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 88.21
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 88.13
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 87.96
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 87.87
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 87.81
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 87.8
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 87.75
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 87.74
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 87.63
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 87.62
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 87.61
d1d4ca2 322 Flavocytochrome c3 (respiratory fumarate reductase 87.59
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 87.55
d1dxha2185 Ornithine transcarbamoylase {Pseudomonas aeruginos 87.52
d1qo8a2 317 Flavocytochrome c3 (respiratory fumarate reductase 87.45
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 87.43
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 87.31
d2bs2a2 336 Fumarate reductase {Wolinella succinogenes [TaxId: 87.28
d2gmha1 380 Electron transfer flavoprotein-ubiquinone oxidored 87.05
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 87.05
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 86.79
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 86.55
d1pvva2163 Ornithine transcarbamoylase {Archaeon Pyrococcus f 86.54
d1vlva2161 Ornithine transcarbamoylase {Thermotoga maritima [ 86.22
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 86.16
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 86.01
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 85.8
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 85.62
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 85.04
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 84.97
d1onfa1 259 Glutathione reductase {Plasmodium falciparum [TaxI 84.95
d2gjca1 311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 84.79
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 84.53
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 84.11
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 84.08
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 83.96
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 83.96
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 83.8
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 83.78
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 83.77
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 83.4
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 83.12
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 83.11
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 83.03
d1pn0a1 360 Phenol hydroxylase {Soil-living yeast (Trichosporo 82.97
d2ax3a2211 Hypothetical protein TM0922, N-terminal domain {Th 82.8
d1vkza290 Glycinamide ribonucleotide synthetase (GAR-syn), N 82.72
d1n4wa1 367 Cholesterol oxidase of GMC family {Streptomyces sp 82.35
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 81.65
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 81.25
d1wdda1325 Ribulose 1,5-bisphosphate carboxylase-oxygenase {R 81.16
d1neka2 330 Succinate dehydogenase {Escherichia coli [TaxId: 5 80.99
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 80.91
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 80.35
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 80.22
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 80.21
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 80.11
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 80.06
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Aldolase
family: Class I aldolase
domain: Type I 3-dehydroquinate dehydratase
species: Salmonella typhi [TaxId: 90370]
Probab=100.00  E-value=1.7e-54  Score=423.61  Aligned_cols=224  Identities=19%  Similarity=0.312  Sum_probs=204.2

Q ss_pred             cCCceEEEeecCCCHHHHHHHHHHHHhhCCCEEEEEeccCC-C-Cc---HHHHHHHhcC-CCCcEEEEeecCCCCCCCCC
Q 010101            6 KNSLLVCTQLECETTEEMQASIEQAKVEGADLVELCIDSME-F-SH---ISEVDKLIQH-PTLPAIVSYRLKSSRKSSDE   79 (518)
Q Consensus         6 ~~~~~icv~l~~~~~~~~~~~~~~~~~~g~D~vElRlD~l~-~-~~---~~~l~~l~~~-~~~PiI~T~R~~~eGG~~~~   79 (518)
                      .++|+|||||++++.+++++++.++.+.|||+||||+|+|. . +.   .+.+..+++. .++|+|||+|+++|||.|++
T Consensus        13 ~g~pkIcv~l~~~~~~~~~~~~~~~~~~~aD~vE~RlD~l~~~~~~~~l~~~~~~lr~~~~~~PiI~T~R~~~eGG~~~~   92 (252)
T d1gqna_          13 EGMPKIIVSLMGRDINSVKAEALAYREATFDILEWRVDHFMDIASTQSVLTAARVIRDAMPDIPLLFTFRSAKEGGEQTI   92 (252)
T ss_dssp             SSSCEEEEEECCSSHHHHHHHHHHHTTSCCSEEEEEGGGCSCTTCHHHHHHHHHHHHHHCTTSCEEEECCBGGGTCSBCC
T ss_pred             CCCCEEEEEeCCCCHHHHHHHHHHHhhcCCCEEEEEEccccccCCHHHHHHHHHHHHHhcCCCCEEEEEechhhCCCCCC
Confidence            46899999999999999999999988899999999999997 3 32   2345556554 46999999999999999999


Q ss_pred             CcHHHHHHHHHHHhhcC-CcEEEEecCCCCchhhHHHh-hcCCCcEEEEeeecCCCCCCChhHHHHHHHHHHHcCCCEEE
Q 010101           80 ACKNTCLQVLRRALDLD-VEFVEMDYEVASDPLMSEII-YSRSNTKIIVSSYLNGGGKPTTEKLGDVIACMQATGADVMK  157 (518)
Q Consensus        80 ~~~~~~~~ll~~~~~~g-~~yvDiEl~~~~~~~~~l~~-~~~~~~kiI~S~H~f~~~tp~~~~l~~~~~~~~~~gadivK  157 (518)
                      + +++|+++++.++++| +||||||++..++.+.++.. +++.++++|+||||| ++||+.+++.+++++|.++||||+|
T Consensus        93 ~-~~~~~~ll~~~~~~~~~d~iDiEl~~~~~~~~~li~~a~~~~~~vI~S~Hdf-~~TP~~~~l~~~~~~m~~~gaDivK  170 (252)
T d1gqna_          93 T-TQHYLTLNRAAIDSGLVDMIDLELFTGDADVKATVDYAHAHNVYVVMSNHDF-HQTPSAEEMVSRLRKMQALGADIPK  170 (252)
T ss_dssp             C-HHHHHHHHHHHHHHSCCSEEEEEGGGCHHHHHHHHHHHHHTTCEEEEEEEES-SCCCCHHHHHHHHHHHHHTTCSEEE
T ss_pred             C-HHHHHHHHHHHHHcCCCceEeccccccHHHHHHHHHHhhcCCCeEEEEecCC-CCCCCHHHHHHHHHHHHHhCCCeEE
Confidence            9 999999999999999 99999999999887777776 567899999999999 9999999999999999999999999


Q ss_pred             EEcccCCcccHHHHHHHhcc-----CCCCEEEEecCCccchhhhcCCCCCCcccccccCCCCCCCCCCHHHHHHHhhhc
Q 010101          158 LEIAVDSITDLAPVFEMLTH-----CQVPLIALAVGSRGLISQLLGPKFGGFLVYGSLGGKSVPGLPTLVSLKQVYQLE  231 (518)
Q Consensus       158 ia~~~~~~~D~~~l~~~~~~-----~~~p~i~~~mG~~G~~sRi~~~~~gs~~ty~~~~~~sApGQ~~~~~l~~~~~~~  231 (518)
                      +|+||++.+|++++++++.+     .++|+|+|+||+.|++||++++.|||++||+++++++||||+++++++++++..
T Consensus       171 ia~~a~~~~D~~~ll~~~~~~~~~~~~~P~I~~~MG~~G~~SRi~~~~~GS~~tya~~~~~sAPGQ~~~~~l~~~l~~l  249 (252)
T d1gqna_         171 IAVMPQSKHDVLTLLTATLEMQQHYADRPVITMSMAKEGVISRLAGEVFGSAATFGAVKQASAPGQIAVNDLRSVLMIL  249 (252)
T ss_dssp             EEECCSSHHHHHHHHHHHHHHHHHTCSSCCEEEECTTTTHHHHHCHHHHTCCEEECBSSSCCSTTCCBHHHHHHHHHHH
T ss_pred             EEecCCCHHHHHHHHHHHHHHHHhCCCCCEEEEecCCcchhHHHHHHHhCCceEeccCCCCCCCCCCCHHHHHHHHHHH
Confidence            99999999999999998643     378999999999999999999999999999999999999999999999998754



>d1sfla_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vi2a2 c.58.1.5 (A:5-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nyta2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nvta2 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1npya2 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2ax3a2 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wdda1 c.1.14.1 (A:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure